CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP033532	Acinetobacter pittii strain 2014S07-126 plasmid p2014S07-126-2, complete sequence	0 crisprs	NA	0
CP033530	Acinetobacter pittii strain 2014S07-126 chromosome, complete genome	1 crisprs	DEDDh,WYL,csa3	3
CP033534	Acinetobacter pittii strain 2014S07-126 plasmid p2014S07-126-4, complete sequence	0 crisprs	NA	0
CP033531	Acinetobacter pittii strain 2014S07-126 plasmid p2014S07-126-1, complete sequence	0 crisprs	NA	1
CP033533	Acinetobacter pittii strain 2014S07-126 plasmid p2014S07-126-3, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033530_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033530_1

2021162-2021271

Orphan

Consensus_repeat	Method
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033530_1

>merge|CP033530|1|2021162-2021271|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCTTCTCAGGGCAAAGCGTTGCTTTACTTATC

>CP033530|1|1|2021162-2021271|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATC	TCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAAC
CGCTTCTCAGGGCAAAGCGTTGCTTTACTTATC

Protein	Signature genes	Signature genes Name	Protein_function
CP033530.1\|AZB94802.1\|2030984_2032004_-\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP033530.1\|AZB94797.1\|2011910_2013197_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182433
CP033530.1\|AZB94792.1\|2000049_2000754_+\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
CP033530.1\|AZB94801.1\|2029447_2030983_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP033530.1\|AZB94803.1\|2032017_2032980_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP033530.1\|AZB94808.1\|2047165_2047330_+\|hypothetical-protein	unknown	unknown	unknown
CP033530.1\|AZB94805.1\|2036746_2036998_+\|hypothetical-protein	unknown	unknown	unknown
CP033530.1\|AZB94807.1\|2046394_2046655_-\|YcgL-domain-containing-protein	unknown	unknown	gnl\|CDD\|377477
CP033530.1\|AZB94796.1\|2007713_2009132_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
CP033530.1\|AZB95624.1\|2046016_2046274_-\|hypothetical-protein	unknown	unknown	unknown
CP033530.1\|AZB94806.1\|2042689_2043895_-\|tryptophan-synthase-subunit-beta	unknown	unknown	gnl\|CDD\|183851
CP033530.1\|AZB94795.1\|2007127_2007310_-\|hypothetical-protein	unknown	unknown	unknown
CP033530.1\|AZB94799.1\|2020302_2021073_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP033530.1\|AZB94793.1\|2000755_2001397_+\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
CP033530.1\|AZB94800.1\|2022932_2023580_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP033530.1\|AZB94798.1\|2015910_2016765_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
CP033530.1\|AZB94794.1\|2002990_2004163_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|238383
CP033530.1\|AZB95623.1\|2004212_2005106_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176148
CP033530.1\|AZB94791.1\|1998414_1998804_+\|hypothetical-protein	unknown	unknown	unknown
CP033530.1\|AZB94804.1\|2033342_2034329_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261

Protein	Function_ID	Function_description	E-value
CP033530.1\|AZB94802.1\|2030984_2032004_-\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	7.15262e-167
CP033530.1\|AZB94797.1\|2011910_2013197_+\|MFS-transporter	gnl\|CDD\|182433	PRK10406, PRK10406, alpha-ketoglutarate transporter; Provisional.	6.94672e-167
CP033530.1\|AZB94792.1\|2000049_2000754_+\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	4.45037e-112
CP033530.1\|AZB94801.1\|2029447_2030983_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	2.88036e-113
CP033530.1\|AZB94803.1\|2032017_2032980_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP033530.1\|AZB94796.1\|2007713_2009132_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
CP033530.1\|AZB94806.1\|2042689_2043895_-\|tryptophan-synthase-subunit-beta	gnl\|CDD\|183851	PRK13028, PRK13028, tryptophan synthase subunit beta; Provisional.	0
CP033530.1\|AZB94807.1\|2046394_2046655_-\|YcgL-domain-containing-protein	gnl\|CDD\|377477	pfam05166, YcgL, YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure.	8.78248e-25
CP033530.1\|AZB94799.1\|2020302_2021073_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.80572e-22
CP033530.1\|AZB94793.1\|2000755_2001397_+\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	3.15321e-124
CP033530.1\|AZB94800.1\|2022932_2023580_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.49732e-75
CP033530.1\|AZB94798.1\|2015910_2016765_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
CP033530.1\|AZB94794.1\|2002990_2004163_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	0
CP033530.1\|AZB95623.1\|2004212_2005106_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176148	cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.95792e-83
CP033530.1\|AZB94804.1\|2033342_2034329_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0

>CP033530.1|AZB94799.1|2020302_2021073_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLAGIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVGITSAFALACAVGMLLGRRAIRFIPSAIVQKVFALMVLLSQFIWSLR
>CP033530.1|AZB94798.1|2015910_2016765_-|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>CP033530.1|AZB94797.1|2011910_2013197_+|MFS-transporter
MTYTQEEKRSRIRGIVGAASGNLVEWFDFYIYAVFAAYFTQALTAPDMDSTTKSIYVWGVFAASFFMRPIGSWVFGRIADRHGRKKSMVISICLMALSSFLFAALPTYDQVGLFAPFLLLVVRLLQGLSVGGEYGAVATYMSELGLKGQRGFYSSFQYVTLSGGQLLASLLGVILLTFLSEQQLHDGGWRIPFVIGGIAAILSLLARSRLEETLSHQDSERKESGSLRELFKKHWKTFLLVVGYTSAGSLTFYVETVYSKTYLTNLGMDGKTVGYIMTFALFVYMCAQPVFGAISDRIGRRSSMLAFSLLSAIFIYPVMVIGMRAYIDSPIIIALLLIFMMMLLSFYTSISGLVKAEMFPPHVRALGVGFSYAVGNALFGGSAPSVALQFKAAGIENTFFIYVIVMLIICFLCSLALPKKPDYLEHDH
>CP033530.1|AZB94796.1|2007713_2009132_+|aspartate-ammonia-lyase
MMNAEITTRIEKDLIGYREINNNDYYGVQTLRALENFNLTQSKVGNFPHLIKALAMVKLACAEANYNLKSLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHAKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFRNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALAKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLACFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQSKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQMLDDILSINNMVKPKMSA
>CP033530.1|AZB94795.1|2007127_2007310_-|hypothetical-protein
MLKVTAALIILGSFTYYVLFHGEEKSESKTSRLLKEAEQSIASAETSVNKANSIVPISYK
>CP033530.1|AZB95623.1|2004212_2005106_-|LysR-family-transcriptional-regulator
MFDLDSRLLNIFYHIYRFKSVSMAADAIGLTQPSVSNGLNKIRQHFNDPLFIRVGNEMIPTELAKEIFPLISEVIDKVESINNFSVNFDPLTSDQLFTIAMTDVSHLVLLPQLTNYLKEKAPLIRLNIRPITPETSYQMANGEIDLAIGFLPQLEEGFYQQKFFKQHYVVISSKSHPRLDPNNFTLDDYMREYHIDIDAGIGHYHIKNELQNKGLDRNILIRLPSYLGVGLVVQETDAIATVPYYLSQVLLVRENLQILPAPLDFPTYDVKQHWHMSCHHKSSHKWFRQTCYELFKV
>CP033530.1|AZB94794.1|2002990_2004163_+|acetyl-CoA-C-acyltransferase
MSSIVIVSGSRTAMGGFQGSLSALTAPELGAAVIRESIQRAGVAPDQVDEVIFGCVLSAGIGQGPARQAMRKASVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTNAPYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDNFAISSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVIDQDEQPLKANLEKIPTLRPAFSKDGTITAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPIGAIQKVLEHAGWSVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNIHGGACALGHPIGATGSRIILSLIYALKRLGKKKGVAALCIGGGEATAVAIEV
>CP033530.1|AZB94793.1|2000755_2001397_+|CoA-transferase-subunit-B
MAWSRNEMAQRAAKELEDGFYVNLGIGLPTLVANYIPENINVWLQSENGLLGIGEFPTEETVDADLINAGKQTVTARPGAAFFSSSESFAMIRGGHVNIAILGAMEVSENGDLANWMIPGKKVKGMGGAMDLVVGVQKVVVLMEHCAKDGTPKIVKNCSLPLTGKSVVHRVITDLGVMDITQQGVELIELAKDVTLEQIQAATGVEFYKTLVA
>CP033530.1|AZB94792.1|2000049_2000754_+|CoA-transferase-subunit-A
MNKVYANAEAALKDVIADNQTLAVGGFGLCGIPEKLIVAVKQSGVTGLTCISNNAGVDDFGLGILLQTKQIKKMISSYVGENKEFERQYLNGELDVELTPQGTLAEKLRAGGAGIPAFYTQTGVGTLIAEGKEERTFNGKNYILEESLTADVALVKAYKADKAGNLVFRKTAQNFNPECAMAGKITIAEVEQVVEIGELDPDEIHLAGIYVNRIVLNASPEKRIEHKTLSTEAV
>CP033530.1|AZB94791.1|1998414_1998804_+|hypothetical-protein
MICIKFIIYPLGMFVLWQIIFIITQLSLTYLNTPQVIVAILSLIINCGMQILIGYKIPQLAPKYKFVASATYIILFTFLLAIYSTTILLEGLKVAPQSIWLGYLFFHVVGMALYFANNTDEFCWENLLK
>CP033530.1|AZB94800.1|2022932_2023580_-|MBL-fold-metallo-hydrolase
MLGCEETRGAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSEVSCGDILITHGCMLKVGNLSIEARYTPGHTNACTSYLVENMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHRQLFSLPDDTIVYPGHDYKGRLSSTIGNERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>CP033530.1|AZB94801.1|2029447_2030983_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEISDAEIEQFITSLGGSAAKAPETPSEQSKAETFAPVTEKAEQPQPVAASASVPVKTAKGDYAVPESLQGYQASDELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP033530.1|AZB94802.1|2030984_2032004_-|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENELEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDAAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>CP033530.1|AZB94803.1|2032017_2032980_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP033530.1|AZB94804.1|2033342_2034329_+|lipoyl-synthase
MDLKRQIETGIKLRGADKVARIPIKILPTEELPTKPDWIRAKITDFEEINRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPKPLDEDEPKHLAETVKNLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRKRCPETLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLELLKRFKAYCPDIKTKSGLMVGLGEIEAEVLALLNDLKDYQVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTRHGKRLGFKNIWSGPMVRSSYFADRQYFGEEVPKPFSRQDVLS
>CP033530.1|AZB94805.1|2036746_2036998_+|hypothetical-protein
MKLQGSNILGQEQIDLLTTRGLNFVWFPKQLETIYRFQYQNGAAYEFRYRAPIILILGEFKHEVRQFEKSYDNQQAEQISLMV
>CP033530.1|AZB94806.1|2042689_2043895_-|tryptophan-synthase-subunit-beta
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELSDLFTNYVGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETGAGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVDSAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACVGGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEAGEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALESSHAVAWAIREASKLSKETMIVVNLSGRGDKDSDYVAEKLKL
>CP033530.1|AZB95624.1|2046016_2046274_-|hypothetical-protein
MRRLPTTFGAISWLIVFAILVTPTVSEGPNASVAPAIFGLLFGVLTKDSPLIWSNLSLILFVVGLGLVIGYCWSKYSTNKSMRSI
>CP033530.1|AZB94807.1|2046394_2046655_-|YcgL-domain-containing-protein
MYIARPNYPDNTEQADPFENVPEAVLQAFGRATFVMHLELAPTRKLARVNVLHVLDSLQTKGFFIQMPPEGLINPNAVEPEGLRGA
>CP033530.1|AZB94808.1|2047165_2047330_+|hypothetical-protein
MPRGDKTAYTAKQKRQAKHIVESEVDRGHSQEEAERIAWSTVNKQDGGGKKKSH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

942778 : 954633

Acinetobacter_phage(90.91%)

head,terminase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB94383.1\|942778_944437_+\|terminase	terminase	A0A0P0IVT4	Acinetobacter_phage	0.0e+00	95.8
AZB95583.1\|944448_945861_+	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	4.6e-259	100.0
AZB95582.1\|945932_946580_+\|head	phage head morphogenesis protein	A0A0P0IKX5	Acinetobacter_phage	2.0e-108	100.0
AZB94384.1\|946582_946747_+	DUF2158 domain-containing protein	NA	NA	NA	NA
AZB94385.1\|946808_948125_+	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	6.9e-209	98.2
AZB94386.1\|949706_950219_+	hypothetical protein	A0A0P0IYA6	Acinetobacter_phage	5.5e-37	100.0
AZB94387.1\|950208_950595_+	DUF4054 domain-containing protein	A0A0P0IKR4	Acinetobacter_phage	7.3e-66	97.7
AZB94388.1\|951139_951508_+	hypothetical protein	A0A0P0HSK8	Acinetobacter_phage	7.2e-63	96.7
AZB94389.1\|951510_952041_+	hypothetical protein	A0A0P0IVT9	Acinetobacter_phage	7.3e-93	97.7
AZB94390.1\|952051_953527_+	DUF3383 domain-containing protein	A0A0P0I492	Acinetobacter_phage	9.3e-271	98.4
AZB94391.1\|953541_953985_+	DUF3277 family protein	A0A0P0IKY2	Acinetobacter_phage	4.3e-78	99.3
AZB95584.1\|954420_954633_+	hypothetical protein	A0A2H4J1A2	uncultured_Caudovirales_phage	1.8e-05	46.9

DBSCAN-SWA_2

959034 : 964315

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB94394.1\|959034_959646_+	hypothetical protein	A0A0P0IKS1	Acinetobacter_phage	2.7e-83	91.5
AZB94395.1\|959647_959941_+	hypothetical protein	A0A0P0J0D9	Acinetobacter_phage	2.6e-47	94.8
AZB94396.1\|959941_960901_+	hypothetical protein	A0A0P0HSL6	Acinetobacter_phage	2.7e-170	92.8
AZB94397.1\|960902_961565_+	hypothetical protein	A0A0N7IRF4	Acinetobacter_phage	1.8e-117	91.4
AZB94398.1\|961599_961953_+	hypothetical protein	A0A0P0IVU6	Acinetobacter_phage	4.6e-59	94.0
AZB94399.1\|963141_963732_+	DUF2612 domain-containing protein	A0A0P0IKZ0	Acinetobacter_phage	5.1e-103	90.8
AZB94400.1\|963724_964315_+	TetR family transcriptional regulator	A0A0P0IE19	Acinetobacter_phage	9.8e-22	96.1

DBSCAN-SWA_3

2639666 : 2645122

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB95058.1\|2639666_2640071_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
AZB95059.1\|2640163_2640346_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
AZB95060.1\|2640392_2640572_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	1.4e-11	61.5
AZB95651.1\|2640670_2641186_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	2.8e-73	96.4
AZB95061.1\|2641256_2642174_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.9e-166	97.7
AZB95062.1\|2642226_2643555_-	hypothetical protein	A0A0D4DCQ4	Acinetobacter_phage	1.2e-86	49.1
AZB95063.1\|2643554_2643908_-	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	1.5e-57	94.0
AZB95064.1\|2643977_2644376_-	hypothetical protein	A0A0P0IRA6	Acinetobacter_phage	1.2e-68	94.7
AZB95065.1\|2644377_2644746_-	HK97 gp10 family phage protein	A0A0P0IDX0	Acinetobacter_phage	1.1e-55	98.1
AZB95066.1\|2644717_2645122_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.9e-61	88.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033531

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

36252 : 164643

Escherichia_phage(10.53%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB95735.1\|36252_37416_+\|transposase	IS3-like element ISAba22 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.6e-164	99.3
AZB95736.1\|37495_38848_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-37	25.8
AZB95737.1\|39043_39976_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.4e-62	42.9
AZB95738.1\|42507_42945_-	hypothetical protein	NA	NA	NA	NA
AZB95739.1\|43345_43582_+	hypothetical protein	NA	NA	NA	NA
AZB95740.1\|43952_44471_+	hypothetical protein	A0A2H4J538	uncultured_Caudovirales_phage	1.7e-30	45.7
AZB95741.1\|45893_46142_-	hypothetical protein	NA	NA	NA	NA
AZB95742.1\|46344_46551_+	hypothetical protein	NA	NA	NA	NA
AZB95743.1\|47995_48736_+	subclass B1 metallo-beta-lactamase IMP-1	NA	NA	NA	NA
AZB95834.1\|48919_49438_+	AacA4 family aminoglycoside N(6')-acetyltransferase	NA	NA	NA	NA
AZB95744.1\|51606_51786_-	hypothetical protein	NA	NA	NA	NA
AZB95745.1\|53766_53973_+	hypothetical protein	NA	NA	NA	NA
AZB95746.1\|56638_57787_-	hypothetical protein	I6XKU1	Burkholderia_virus	1.8e-27	27.2
AZB95747.1\|59253_60033_+	APH(3')-VI family aminoglycoside O-phosphotransferase	E4ZFP6	Streptococcus_phage	5.8e-30	34.3
AZB95748.1\|60422_61448_+\|transposase	IS30-like element ISAba125 family transposase	W5R8L2	Staphylococcus_phage	1.2e-51	38.1
AZB95749.1\|61480_62089_-	hypothetical protein	NA	NA	NA	NA
AZB95750.1\|65125_65560_-	hypothetical protein	NA	NA	NA	NA
AZB95751.1\|66278_66617_-	hypothetical protein	NA	NA	NA	NA
AZB95752.1\|66774_67872_-	phosphohydrolase	H7BVI4	unidentified_phage	1.6e-41	28.3
AZB95835.1\|68048_68525_-	hypothetical protein	NA	NA	NA	NA
AZB95753.1\|68595_68910_-	hypothetical protein	NA	NA	NA	NA
AZB95754.1\|70015_70546_-	hypothetical protein	NA	NA	NA	NA
AZB95755.1\|70589_71153_-	hypothetical protein	NA	NA	NA	NA
AZB95756.1\|73097_73634_-	hypothetical protein	NA	NA	NA	NA
AZB95757.1\|73993_74221_+	hypothetical protein	NA	NA	NA	NA
AZB95758.1\|74244_74718_-	hypothetical protein	NA	NA	NA	NA
AZB95759.1\|76854_77679_-	hypothetical protein	NA	NA	NA	NA
AZB95760.1\|77865_78192_+	H-NS histone family protein	NA	NA	NA	NA
AZB95761.1\|78271_78541_-	hypothetical protein	NA	NA	NA	NA
AZB95762.1\|78540_78885_-	hypothetical protein	A0A1L2CU84	Pectobacterium_phage	1.3e-05	51.3
AZB95763.1\|79045_79234_+	hypothetical protein	NA	NA	NA	NA
AZB95764.1\|82766_83135_+	hypothetical protein	A0A0A7HAZ6	Arthrobacter_phage	4.7e-06	36.1
AZB95765.1\|83134_84802_+	DEAD/DEAH box helicase	A0A0U1UNQ7	Pseudomonas_phage	4.1e-158	48.4
AZB95766.1\|84947_85832_-	hypothetical protein	NA	NA	NA	NA
AZB95767.1\|85988_86639_+	hypothetical protein	NA	NA	NA	NA
AZB95768.1\|86614_87406_+	hypothetical protein	NA	NA	NA	NA
AZB95769.1\|89114_89654_-	hypothetical protein	NA	NA	NA	NA
AZB95770.1\|90218_91025_+	hypothetical protein	NA	NA	NA	NA
AZB95771.1\|91026_91881_+	hypothetical protein	NA	NA	NA	NA
AZB95772.1\|91966_92473_+	hypothetical protein	A0A0R6PHV6	Moraxella_phage	6.2e-25	41.4
AZB95836.1\|92477_92786_+	hypothetical protein	NA	NA	NA	NA
AZB95773.1\|100444_100669_+	hypothetical protein	NA	NA	NA	NA
AZB95774.1\|105017_105926_-	hypothetical protein	NA	NA	NA	NA
AZB95775.1\|108745_109777_+	alcohol dehydrogenase AdhP	M1PHA2	Moumouvirus	2.2e-37	29.5
AZB95776.1\|111538_111769_+	hypothetical protein	NA	NA	NA	NA
AZB95777.1\|111971_112493_-	hypothetical protein	NA	NA	NA	NA
AZB95778.1\|116726_116960_+	hypothetical protein	NA	NA	NA	NA
AZB95779.1\|120340_120670_-	hypothetical protein	NA	NA	NA	NA
AZB95780.1\|122224_122914_+	hypothetical protein	NA	NA	NA	NA
AZB95781.1\|127359_127680_+	hypothetical protein	NA	NA	NA	NA
AZB95782.1\|132147_132681_+	hypothetical protein	NA	NA	NA	NA
AZB95783.1\|132719_133361_-	hypothetical protein	NA	NA	NA	NA
AZB95784.1\|137663_138524_+	aminoglycoside N-acetyltransferase AAC(3)-IId	NA	NA	NA	NA
AZB95785.1\|147762_148491_+	efflux system DNA-binding response regulator AdeR	B5LWA6	Feldmannia_species_virus	7.2e-06	29.7
AZB95786.1\|157711_158275_-	recombinase family protein	Q2A092	Sodalis_phage	4.1e-25	37.8
AZB95787.1\|158333_159038_+\|transposase	IS6 family transposase IS1008	A0A077SL39	Escherichia_phage	5.1e-118	84.5
AZB95788.1\|160588_161404_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
AZB95789.1\|162502_163180_+\|transposase	IS6-like element IS1006 family transposase	A0A077SL39	Escherichia_phage	2.5e-114	86.0
AZB95790.1\|163499_164643_+\|transposase	IS3-like element ISAba14 family transposase	S5WIU1	Leptospira_phage	2.3e-14	28.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033530

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033531

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection