CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
CP033538	Acinetobacter pittii strain 2012N21-164 plasmid p2012N21-164-3, complete sequence	0 crisprs	NA	0	0	0
CP033535	Acinetobacter pittii strain 2012N21-164 chromosome, complete genome	3 crisprs	DEDDh,WYL,csa3	2	17	4
CP033536	Acinetobacter pittii strain 2012N21-164 plasmid p2012N21-164-1, complete sequence	0 crisprs	NA	0	0	0
CP033537	Acinetobacter pittii strain 2012N21-164 plasmid p2012N21-164-2, complete sequence	0 crisprs	NA	0	0	4
CP033539	Acinetobacter pittii strain 2012N21-164 plasmid p2012N21-164-4, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033535_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033535_1

1968935-1969048

Orphan

Consensus_repeat	Method
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033535_1

>merge|CP033535|1|1968935-1969048|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTCTTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAACCGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

>CP033535|1|1|1968935-1969048|CRISPRCasFinder
CGCTTCTCAGGACAAAGCGTTGCTTTACTTATCCTC	TTCCACTCGAACATAGTTCTCGTCTTCTTGCGAAGCTTTAAC
CGCTTCTCAGGGCAAAGCGTTGCTTTACTTATCCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP033535.1\|AZB96728.1\|1969920_1970697_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|350353
CP033535.1\|AZB96730.1\|1973895_1974954_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP033535.1\|AZB96737.1\|1990612_1991800_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|226346
CP033535.1\|AZB97642.1\|1953277_1954171_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176148
CP033535.1\|AZB96734.1\|1981107_1982094_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
CP033535.1\|AZB96732.1\|1977176_1978748_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP033535.1\|AZB96723.1\|1949115_1949820_+\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
CP033535.1\|AZB96731.1\|1974984_1975770_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
CP033535.1\|AZB96725.1\|1965992_1966895_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP033535.1\|AZB96733.1\|1979781_1980744_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP033535.1\|AZB96719.1\|1945720_1945996_+\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB96722.1\|1947988_1948870_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176131
CP033535.1\|AZB96720.1\|1946429_1946543_-\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB96729.1\|1970706_1971354_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP033535.1\|AZB96718.1\|1945275_1945704_+\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB96735.1\|1983441_1984194_-\|iron-containing-redox-enzyme-family-protein	unknown	unknown	gnl\|CDD\|379634
CP033535.1\|AZB96721.1\|1947628_1947874_+\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB96724.1\|1956189_1956372_-\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB96726.1\|1968054_1968846_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP033535.1\|AZB96736.1\|1988121_1989129_-\|50S-ribosomal-protein-L3-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236988

Protein	Function_ID	Function_description	E-value
CP033535.1\|AZB96728.1\|1969920_1970697_-\|TIGR01244-family-phosphatase	gnl\|CDD\|350353	cd14503, PTP-bact, bacterial tyrosine-protein phosphataseS similar to Neisseria NMA1982. This subfamily is composed of bacterial tyrosine-protein phosphatases similar to Neisseria meningitidis NMA1982, which displays phosphatase activity but whose biological function is still unknown.	2.07617e-39
CP033535.1\|AZB96737.1\|1990612_1991800_-\|VWA-domain-containing-protein	gnl\|CDD\|226346	COG3825, COG3825, Uncharacterized protein conserved in bacteria [Function unknown].	2.9334e-162
CP033535.1\|AZB97642.1\|1953277_1954171_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176148	cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.95792e-83
CP033535.1\|AZB96734.1\|1981107_1982094_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
CP033535.1\|AZB96732.1\|1977176_1978748_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	7.47686e-113
CP033535.1\|AZB96723.1\|1949115_1949820_+\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	4.45037e-112
CP033535.1\|AZB96726.1\|1968054_1968846_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	7.30352e-23
CP033535.1\|AZB96725.1\|1965992_1966895_+\|DMT-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.67372e-14
CP033535.1\|AZB96735.1\|1983441_1984194_-\|iron-containing-redox-enzyme-family-protein	gnl\|CDD\|379634	pfam14518, Haem_oxygenas_2, Iron-containing redox enzyme. The CADD, Chlamydia protein associating with death domains, crystal structure reveals a dimer of seven-helical bundles. Each bundle contains a di-iron centre adjacent to an internal cavity that forms an active site similar to that of methane mono-oxygenase hydrolase.	7.39311e-18
CP033535.1\|AZB96733.1\|1979781_1980744_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP033535.1\|AZB96722.1\|1947988_1948870_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176131	cd08440, PBP2_LTTR_like_4, TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.41082e-67
CP033535.1\|AZB96729.1\|1970706_1971354_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.49732e-75
CP033535.1\|AZB96730.1\|1973895_1974954_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
CP033535.1\|AZB96731.1\|1974984_1975770_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	2.5012e-113
CP033535.1\|AZB96736.1\|1988121_1989129_-\|50S-ribosomal-protein-L3-N(5)-glutamine-methyltransferase	gnl\|CDD\|236988	PRK11805, PRK11805, 50S ribosomal protein L3 N(5)-glutamine methyltransferase.	1.10784e-175

>CP033535.1|AZB96726.1|1968054_1968846_-|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANAISPVWLMLMFSLVMFTVGYRLISNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLAGIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFHYPVGITSAFALACAVGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>CP033535.1|AZB96725.1|1965992_1966895_+|DMT-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAAILGLIGIVLLFWHDLVNSQFNAQLLMGIGLCAVGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVILSLALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYVWALNAVFGILLILLGNYLMFSKLEIGKKLFNSQKL
>CP033535.1|AZB96724.1|1956189_1956372_-|hypothetical-protein
MLKVTAALIILGSFTYYVLFHGEEKSESKTSRLLKEAEQSIASAETSVNKANSIVPISYK
>CP033535.1|AZB97642.1|1953277_1954171_-|LysR-family-transcriptional-regulator
MFDLDSRLLNIFYHIYRFKSVSMAADAIGLTQPSVSNGLNKIRQHFNDPLFIRVGNEMIPTELAKEIFPLISEVIDKVESINNFSVNFDPLTSDQLFTIAMTDVSHLVLLPQLTNYLKEKAPLIRLNIRPITPETSYQMANGEIDLAIGFLPQLEEGFYQQKFFKQHYVVISSKSHPRLDPNNFTLDDYMREYHIDIDAGIGHYHIKNELQNKGLDRNILIRLPSYLGVGLVVQETDAIATVPYYLSQVLLVRENLQILPAPLDFPTYDVKQHWHMSCHHKSSHKWFRQTCYELFKV
>CP033535.1|AZB96723.1|1949115_1949820_+|CoA-transferase-subunit-A
MNKVYANAEAALKDVIADNQTLAVGGFGLCGIPEKLIVAVKQSGVTGLTCISNNAGVDDFGLGILLQTKQIKKMISSYVGENKEFERQYLNGELDVELTPQGTLAEKLRAGGAGIPAFYTQTGVGTLIAEGKEERTFNGKNYILEESLTADVALVKAYKADKAGNLVFRKTAQNFNPECAMAGKITIAEVEQVVEIGELDPDEIHLAGIYVNRIVLNASPEKRIEHKTLSTEAV
>CP033535.1|AZB96722.1|1947988_1948870_+|LysR-family-transcriptional-regulator
MTLKQLKAFLALARTLNYANASLELHLSQSALSLTIKSLEEELGGKLFNRNTRRVELTQEGKSLIPYAKKLLANWDEMENDVKQRFKLNRGTLSIASMPFVTHAILPEVIHQFLELHPNLNFSIQDIPNETIIEKVQDGIFELGICFEPDLTEGLEFKPLFEEDFLALLPKTHPLAQSSSITWQELCSNPFVTLQKPSIVRYLVEQNCLRNNITLDLKVECHQISSLSSFVAYGIGVSAIPRHFAKHIDKEHNVLIELKDESIHKTVGIVYKKNFEISNISTQFIEALIQYKF
>CP033535.1|AZB96721.1|1947628_1947874_+|hypothetical-protein
MQILIGYKIPQLAPKYKFVASATYIILFTFLLAIYSTTILLEGLKVAPQAIWLGYLFFHVVGMALYFANNTDEFCWENLLK
>CP033535.1|AZB96720.1|1946429_1946543_-|hypothetical-protein
MRVVKSFVVSIVGIDAYQTSHIGSIRSSVYGVGRYMN
>CP033535.1|AZB96719.1|1945720_1945996_+|hypothetical-protein
MKIQILASLTAFSLTSCMVKPTITNHEEVSIQPILITSNTKSNISMMASAHGKLIADKNGCIRLGDEKGPLIIWPYGSKFIKWYLYFFNTF
>CP033535.1|AZB96718.1|1945275_1945704_+|hypothetical-protein
MNKRNILFTLQTGLIILLNGCTDTSLAQNKVIVPKIGYSGNADNESYSEAQIKIEGSCVYLMNTNDRVIPIFATKDAHWNSNKYLLIVDSKEYKDGDTIAYGSGEAYPVNLNNYKWIIKPDTTCDLSKGVIINQFIEPLTKN
>CP033535.1|AZB96728.1|1969920_1970697_-|TIGR01244-family-phosphatase
MELKRVNQDFYVAGQITANDIAKIAGQGIKTLICNRPDGEGADQPNVIEIEEAAQRHGLNVIYQPVISGKITDQQVVEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPQDAALLVEAGNKLGFNLKGLVPRILKRDHEPATIPCYSVVIVGAGAAGISVASSLLCREPHLDIVIIDPADTHYYQPGWTMVGGGIFKPQVTARSMASVVPSKVKWMKAAVAGFDPEHNQVILEGCQPIQYKALVVCPGLKTKLAWH
>CP033535.1|AZB96729.1|1970706_1971354_-|MBL-fold-metallo-hydrolase
MLGCEETRGAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSEVSCGDILITHGCMLKVGNLSIEARYTPGHTNACTSYLVENMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHRQLFSLPDDTIVYPGHDYKGRLSSTIGNERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSISQL
>CP033535.1|AZB96730.1|1973895_1974954_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGKGVDDIEIGQHVVVEPYIVSDDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHEETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP033535.1|AZB96731.1|1974984_1975770_-|acetoin-reductase
MVKGLKNKVVLVTGAAQGIGRGIALRLAQEGAHIALVDMKQDQLNDVQQEIQALGVNASIFIANVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASNDSDYITGQSILTDGGIVYR
>CP033535.1|AZB96732.1|1977176_1978748_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEISDAEIEQFITSLGGSAAKAPETPSEQSKAETFAPVTEKAEQPQPVAASASVPVKTAKGDYAVPESLQGYQASDELFTTPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALIFGVGEPACQKLSLI
>CP033535.1|AZB96733.1|1979781_1980744_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP033535.1|AZB96734.1|1981107_1982094_+|lipoyl-synthase
MDLKRQIETGIKLRGADKVARIPIKILPTEELPTKPDWIRAKITDFEEINRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPKPLDEDEPKHLAETVKNLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRKRCPETLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLELLKRFKAYCPDIKTKSGLMVGLGEIEAEVLALLNDLKDYQVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTRHGKRLGFKNIWSGPMVRSSYFADRQYFGEEVPKPFSRQDVLS
>CP033535.1|AZB96735.1|1983441_1984194_-|iron-containing-redox-enzyme-family-protein
MTALNQYGMNLEITPHNGWSQRFWDDLLPAKERVSKHPFFTEMANGGLSLDSFRYALLNFYPLVAHFPSYMAGALGKATGFSEPGVTEARDWLIQNIKVEERHLKWYRDWAGGFGLTVEELDHVRPPAAMNAVNHFLWNMSHRGNLAECLAATNLAIEWATGDWSIQVYKGIHTYTNHPEVTIDKRSLAWLRAHAHYDDLHPYEAMELIKRLCNDRPDWQQKAFHAAEEGLRYYELALDDCYRVQLQASA
>CP033535.1|AZB96736.1|1988121_1989129_-|50S-ribosomal-protein-L3-N(5)-glutamine-methyltransferase
MERPTISPEHLQEAAENLSTIRDFIRFGVSALRQHDAHLGQGTEDYFAESSALVLQTLSLEWSADSEILDAKLLPSEKAEFLSLLERRINDRIPTSYLLNLAYFFNKPFYVDERVLIPRSPIAELIEQRFAPYCLDENGQMREALNNLPENAKPKTPQRILDMCTGSGCIAVALAYAYPDAEVDATDISKEALEVASINVEHHNKQYQVALLESDLFAKIPAENQYDLIVSNPPYVDAEDMADLPEEFLHEPELALAAGQDGLDLVRKMLAQAADYLTEDGLIVIEVGNSEWAMRQNFNTIDFNWLTFQKGGSGIFALTAEQCRRYRKLFEQQQA
>CP033535.1|AZB96737.1|1990612_1991800_-|VWA-domain-containing-protein
MFVRLFYTLRKYGVPVTTRELIDLNRAVSEGLVFADQEEFYQLAKTILVKDERFFDKFDRAMKDYFDGIETFDIDELLKQVHKLPKDWFDLELLEKHLTPEQRAELQKAGSLEELMKMLEERLREQHKKHQGGNRMVGTGGTSPFGAFGDHPEGVRIGGPGRKRSAVKVWEQRKYQNLDDDQVLGTRQMQIALRRLRKFARQGAAEELDVDGTIRETAKQGILDVQMVPERRNRIKVLMLFDVGGSMDAHIAQCEKLFSAAKSEFKTLEYFYFHNCLYDYVWKDNYRRTATRMNTWDLFHTYGRDYRVIVVGDASMAPYELKSVGGSVEYMNDETGEVWLRRLRQHFDKTAWLNPETEGYWHYTQTIGWIKEIFENHMYPMTLKGIEDLTRYLSR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033535_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033535_2

3115871-3119968

Orphan

Consensus_repeat	Method
CTGTCNNNGTCNGAGTCNNNGTC	CRT

52 spacers

The CRISPR arrays of CP033535_2

>merge|CP033535|2|3115871-3119968|CRT
CTGTCAGAGTCAGAGTCGCTGTCGGAATCAGAGTCGCTATCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCTGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTATCAGAGTCACTGTCGGAGTCAGAGTCAGAGTCGCTGTCGGAGTCAGAGTCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAATCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCAGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAATCAGAGTCACTGTCGCTATCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCAGAGTCTGAGTCGCTGTCGGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCGCTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCGGAATCAGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCGCTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCAGAGTCTGAGTCGCTGTCGGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCGCTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGGAGTCACTGTCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGTTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTATCAGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCTGAGTCAGAGTCGCTATCAGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAATCTGAGTCACTGTCAGAGTCAGAGTCGCTGTCGCTATCAGAATCACTGTCAGAGTCAGAATCCGAGTCACTGTCAGAGTCAGAATCGCTGTCGGAATCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTATCAGAGTCACTGTCGGAGTCAGAGTCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGTTGTCGCTGTCGCTGTCGCTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTATCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCAGAGTCTGAGTCGCTGTCGGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCGCTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAATCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCAGAGTCTGAGTCGCTGTCGGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCGCTGTCGGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCAGAGTCGCTGTC

>CP033535|2|1|3115871-3119968|CRT
CTGTCAGAGTCAGAGTCGCTGTC	GGAATCAGAGTCGCTATCAGAGTCAGAATCG
CTGTCAGAGTCTGAGTCACTGTC	AGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCG
CTGTCAGAGTCTGAGTCACTGTC	AGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCAGAATCG
CTGTCAGAGTCTGAGTCACTGTC	AGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCG
CTGTCAGAGTCTGAGTCGCTGTC	AGAGTCTGAGTCGCTGTCAGAGTCTGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCG
CTGTCAGAGTCTGAGTCGCTGTC	GCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCA
CTGTCGGAATCAGAGTCGCTGTC	AGAGTCAGAATCGCTGTCGCTATCAGAGTCACTGTCGGAGTCAGAGTCAGAGTCGCTGTCGGAGTCAGAGTCAGAGTCGCTGTCGGAATCAGAGTCG
CTGTCAGAATCAGAGTCGCTGTC	AGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAATCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCG
CTGTCAGAATCAGAATCGCTGTC	AGAGTCTGAGTCACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCG
CTGTCAGAGTCAGAGTCGCTGTC	AGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCA
CTGTCAGAGTCTGAGTCACTGTC	AGAGTCTGAGTCGCTGTCGCTATCAGAATCAGAGTCACTGTCGCTATCAGAGTCAGAGTCG
CTGTCAGAGTCTGAGTCACTGTC	GGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCA
CTGTCAGAGTCTGAGTCGCTGTC	GGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCGCTGTCGGAATCAGAGTCG
CTGTCAGAGTCAGAATCGCTGTC	AGAATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCGGAATCAGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAATCAGAGTCG
CTGTCAGAGTCTGAGTCGCTGTC	GGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCGCTATCAGAGTCGCTGTCG
CTATCAGAGTCTGAGTCACTGTC	GGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCG
CTGTCAGAGTCTGAGTCACTGTC	AGAGTCTGAGTCGCTGTCGCTATCAGAATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCAGAGTCG
CTGTCAGAGTCTGAGTCACTGTC	GGAATCAGAGTCGCTGTCAGAATCAGAGTCGCTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCA
CTGTCAGAGTCTGAGTCGCTGTC	GGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCGCTGTCGGAATCAGAGTCG
CTGTCAGAGTCAGAATCGCTGTC	AGAGTCTGGAGTCACTGTCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCG
CTGTCAGAGTCAGAATCGCTATC	AGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCG
CTGTCAGAGTCAGAATCGCTATC	AGAGTCAGAATCGCTGTCGCTGTCGCTGTCAGAGTCTGAGTCGCTGTCGCTATCAGAGTCA
CTGTCGGAATCAGAGTCGCTGTC	GTTATCAGAGTCGCTGTCGCTATCAGAGTCTGAGTCACTGTCGGAATCAGAGTCG
CTGTCAGAGTCAGAATCGCTGTC	AGAGTCAGAGTCGCTGTCAGAGTCTGAGTCG
CTGTCAGAGTCAGAATCGCTGTC	GCTATCAGAGTCTGAGTCACTGTCAGAATCAGAGTCG
CTGTCAGAGTCAGAATCGCTGTC	TGAGTCAGAGTCGCTATCAGAGTCA
CTGTCAGAGTCAGAATCGCTGTC	AGAATCTGAGTCACTGTCAGAGTCAGAGTCGCTGTCGCTATCAGAATCA
CTGTCAGAGTCAGAATCCGAGTC	ACTGTCAGAGTCAGAATCGCTGTCGGAATCAGAGTCG
CTGTCAGAGTCTGAGTCACTGTC	AGAATCAGAGTCGCTGTCGGAATCAGAGTCG
CTGTCAGAGTCTGAGTCACTGTC	AGAGTCTGAGTCACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCAGAATCG
CTGTCAGAGTCTGAGTCACTGTC	AGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCAGAGTCG
CTGTCAGAGTCTGAGTCGCTGTC	AGAGTCAGAATCGCTATCAGAGTCAGAATCG
CTGTCAGAGTCTGAGTCGCTGTC	GCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCGCTGTCG
CTATCAGAGTCTGAGTCACTGTC	GGAATCAGAGTCGCTGTCAGAGTCAGAATCGCTGTCGCTATCAGAGTCA
CTGTCGGAGTCAGAGTCAGAGTC	GCTGTCGGAATCAGAGTCGCTGTCAGAATCA
GAGTCGCTGTCAGAGTCAGAGTC	GCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCG
CTGTCGCTGTCAGAGTCAGAGTC	TGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCT
GAGTCGCTGTCAGAGTCAGAATC	GCTATCAGAGTCAGAATCGTTGTCGCTGTCG
CTGTCGCTGTCAGAGTCTGAGTC	GCTGTCGCTATCAGAGTCACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCG
CTGTCGCTATCAGAGTCTGAGTC	ACTGTCGGAATCAGAGTCGCTGTCAGAGTCA
GAGTCGCTGTCAGAGTCTGAGTC	GCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCGCTATCAGAGTCA
GAGTCGCTGTCAGAGTCTGAGTC	ACTGTCGGAATCAGAGTCGCTGTCAGAATCA
GAGTCGCTGTCGGAATCAGAGTC	GCTGTCGCTATCAGAGTCGCTGTCGGAATCAGAGTCACTGTCAGAGTCT
GAGTCGCTGTCGGAATCAGAGTC	GCTATCAGAGTCAGAGTCGCTGTCA
GAATCGCTGTCGGAATCAGAGTC	GCTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCGCTGTCAGAGTCAGAATCGCTGTCAGAGTCT
GAATCGCTGTCAGAGTCTGAGTC	ACTGTCGGAATCAGAGTCACTGTCGCTGTCAGAATCA
GAATCGCTGTCAGAGTCTGAGTC	ACTGTCAGAATCAGAGTCGCTGTCGGAATCAGAATCGCTGTCAGAATCA
GAGTCGCTGTCAGAGTCTGAGTC	GCTGTCAGAGTCAGAATCGCTATCAGAGTCAGAATCGCTGTCG
CTGTCGCTGTCAGAGTCAGAGTC	TGAGTCACTGTCAGAGTCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCTGAGTCG
CTGTCGCTATCAGAATCAGAGTC	ACTGTCGGAATCAGAGTCGCTGTCGCTATCAGAGTCAGAGTCGCTGTCAGAGTCTGAGTCACTGTCGGAATCAGAGTCG
CTGTCGCTATCAGAGTCGCTGTC	GGAATCAGAGTCACTGTCAGAGTCTGAGTCGCTGTCGGAATCAGAGTCGCTATCAGAGTCAGAGTCGCTGTCAGAATCG
CTGTCGGAATCAGAGTCGCTGTC	AGAGTCAGAATCGCTGTCAGAGTCTGAGTCACTGTCAGAGTCAGAATCGCTGTCA
GAGTCTGAGTCAGAGTCGCTGTC

Protein	Signature genes	Signature genes Name	Protein_function
CP033535.1\|AZB97211.1\|3124141_3125380_-\|RND-transporter	unknown	unknown	gnl\|CDD\|273829
CP033535.1\|AZB97217.1\|3130805_3131849_-\|methionine-synthase	unknown	unknown	gnl\|CDD\|181659
CP033535.1\|AZB97216.1\|3130126_3130618_-\|flavin-reductase	unknown	unknown	gnl\|CDD\|132654
CP033535.1\|AZB97207.1\|3094368_3094560_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|274987
CP033535.1\|AZB97208.1\|3100485_3100779_-\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB97209.1\|3100995_3101580_-\|resolvase	unknown	unknown	gnl\|CDD\|259851
CP033535.1\|AZB97204.1\|3093040_3093280_+\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB97219.1\|3133225_3134098_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
CP033535.1\|AZB97201.1\|3090961_3091456_-\|signal-peptidase-II	unknown	unknown	gnl\|CDD\|173237
CP033535.1\|AZB97202.1\|3091459_3092356_-\|sodium:proton-antiporter	unknown	unknown	gnl\|CDD\|224151
CP033535.1\|AZB97220.1\|3134353_3134962_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
CP033535.1\|AZB97215.1\|3129253_3129460_+\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB97212.1\|3126180_3126780_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP033535.1\|AZB97218.1\|3131870_3132857_-\|DUF1852-domain-containing-protein	unknown	unknown	gnl\|CDD\|370181
CP033535.1\|AZB97205.1\|3093375_3093588_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP033535.1\|AZB97210.1\|3108117_3108849_+\|antibiotic-acetyltransferase	unknown	unknown	gnl\|CDD\|100040
CP033535.1\|AZB97213.1\|3126902_3127232_+\|Darcynin-1	unknown	unknown	gnl\|CDD\|293679
CP033535.1\|AZB97214.1\|3127405_3128008_-\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB97206.1\|3093756_3094239_+\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB97203.1\|3092452_3092860_+\|Cd(II)/Pb(II)-responsive-transcriptional-regulator	unknown	unknown	gnl\|CDD\|131102

Protein	Function_ID	Function_description	E-value
CP033535.1\|AZB97211.1\|3124141_3125380_-\|RND-transporter	gnl\|CDD\|273829	TIGR01844, Proteases_secretion_protein_PrtF, type I secretion outer membrane protein, TolC family. Members of this model are outer membrane proteins from the TolC subfamily within the RND (Resistance-Nodulation-cell Division) efflux systems. These proteins, unlike the NodT subfamily, appear not to be lipoproteins. All are believed to participate in type I protein secretion, an ABC transporter system for protein secretion without cleavage of a signal sequence, although they may, like TolC, participate also in the efflux of smaller molecules as well. This family includes the well-documented examples TolC (E. coli), PrtF (Erwinia), and AprF (Pseudomonas aeruginosa). [Protein fate, Protein and peptide secretion and trafficking, Transport and binding proteins, Porins].	1.08042e-57
CP033535.1\|AZB97216.1\|3130126_3130618_-\|flavin-reductase	gnl\|CDD\|132654	TIGR03615, flavoprotein_oxidoreductase, pyrimidine utilization flavin reductase protein F. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the flavin reductase family defined by pfam01613. Presumably, this protein recycles the flavin of the RutA luciferase-like oxidoreductase.	6.9458e-70
CP033535.1\|AZB97207.1\|3094368_3094560_+\|DNA-binding-protein	gnl\|CDD\|274987	TIGR04111, conserved_hypothetical_protein, phage-associated protein, BcepMu gp16 family. Members of this protein family occur in Burkholderia phage BcepMu, Pseudomonas phage B3, and Burkholderia phage KS10, and many bacterial putative prophage regions. The member from Burkholderia phage BcepMu is named gp16. Homology suggests DNA-binding activity. [Mobile and extrachromosomal element functions, Prophage functions].	3.05379e-18
CP033535.1\|AZB97203.1\|3092452_3092860_+\|Cd(II)/Pb(II)-responsive-transcriptional-regulator	gnl\|CDD\|131102	TIGR02047, putative_regulatory_protein, Cd(II)/Pb(II)-responsive transcriptional regulator. This model represents the cadmium(II) and/or lead(II) responsive transcriptional activator of the proteobacterial metal efflux system. This protein is a member of the MerR family of transcriptional activators (pfam00376) and contains a distinctive pattern of cysteine residues in its metal binding loop, Cys-X(6-9)-Cys, as well as a conserved and critical cysteine at the N-terminal end of the dimerization helix. [Regulatory functions, DNA interactions].	1.5158e-72
CP033535.1\|AZB97209.1\|3100995_3101580_-\|resolvase	gnl\|CDD\|259851	cd00569, HTH_Hin_like, Helix-turn-helix domain of Hin and related proteins. This domain model summarizes a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella. The basic HTH domain is a simple fold comprised of three core helices that form a right-handed helical bundle. The principal DNA-protein interface is formed by the third helix, the recognition helix, inserting itself into the major groove of the DNA. A diverse array of HTH domains participate in a variety of functions that depend on their DNA-binding properties. HTH_Hin represents one of the simplest versions of the HTH domains; the characterization of homologous relationships between various sequence-diverse HTH domain families remains difficult. The Hin recombinase induces the site-specific inversion of a chromosomal DNA segment containing a promoter, which controls the alternate expression of two genes by reversibly switching orientation. The Hin recombinase consists of a single polypeptide chain containing a C-terminal DNA-binding domain (HTH_Hin) and a catalytic domain.	1.37305e-05
CP033535.1\|AZB97218.1\|3131870_3132857_-\|DUF1852-domain-containing-protein	gnl\|CDD\|370181	pfam08908, DUF1852, Domain of unknown function (DUF1852). This family of proteins are functionally uncharacterized.	0
CP033535.1\|AZB97219.1\|3133225_3134098_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	1.21597e-41
CP033535.1\|AZB97201.1\|3090961_3091456_-\|signal-peptidase-II	gnl\|CDD\|173237	PRK14776, PRK14776, lipoprotein signal peptidase; Provisional.	2.78607e-106
CP033535.1\|AZB97202.1\|3091459_3092356_-\|sodium:proton-antiporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	2.22445e-31
CP033535.1\|AZB97220.1\|3134353_3134962_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.06016e-28
CP033535.1\|AZB97212.1\|3126180_3126780_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	6.24857e-11
CP033535.1\|AZB97205.1\|3093375_3093588_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	7.29232e-12
CP033535.1\|AZB97210.1\|3108117_3108849_+\|antibiotic-acetyltransferase	gnl\|CDD\|100040	cd03349, LbH_XAT, Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.	4.28419e-59
CP033535.1\|AZB97213.1\|3126902_3127232_+\|Darcynin-1	gnl\|CDD\|293679	pfam17074, Darcynin, Darcynin, domain of unknown function. Darcynin is a bacterial protein family. Its function is unknown.	1.08015e-13
CP033535.1\|AZB97217.1\|3130805_3131849_-\|methionine-synthase	gnl\|CDD\|181659	PRK09121, PRK09121, methionine synthase.	0

>CP033535.1|AZB97210.1|3108117_3108849_+|antibiotic-acetyltransferase
MNNEIFTLSNETTNVEFFKIEKSLSRLNINMFFLKKNPHKLITLNNDLKLEGHNNFYNSVLSLCTIGAFSYSSSNLNYGVSIGRYCSLASNIKIMGAHHFPEWISTSPHFYSEDYHDTDPALVTHNYRSRRNVIIGNDVWIGADVVLKNNITIGDGAIIASNSVITKNVEPYTIVGGNPAKLIRKRFEDTVIKELMHLKWWRFHKNDLKGLNFTAPSDFINNLAKRIYMEKLNEYHPPIFYKK
>CP033535.1|AZB97209.1|3100995_3101580_-|resolvase
MRIYAYIRVNCSIENIEEEKESFISLLNSFDYKIHPKRVIFELVSVDKPITLRTIFLNLINYSLEEDDFLIVKGIDCLGSSFTEILSSIKLIERKKIKLIILDYFNCEFEDDIKNNFIHFIEICINFEKLFLIDCVGQKKSSLSRKGGRPEKLSNDQKQDVINKFKKGFSVYSLAKDLAVSRTVIQRIIKKSDN
>CP033535.1|AZB97208.1|3100485_3100779_-|hypothetical-protein
MDMSIDLIKWKCSICEGFIVVDHSKIQKEDLVQFVFRRINKNDSFYFIYKVGLVIDRKEELLIIKYKNRTYKVFEKDTYPARAPTHLIYNMFWVCTC
>CP033535.1|AZB97207.1|3094368_3094560_+|DNA-binding-protein
MKTNQQIKDDFEQAGITISDWSLKHNFSRELVYRILNTNRLPKRGESKRIAIALGLITEEKET
>CP033535.1|AZB97206.1|3093756_3094239_+|hypothetical-protein
MIEIKHPLKEQFLVVIENGILLFLFKPKDLWIRFVGAPDSLKWQTYSLIKQLVKFGYLKKVYDQLGNQYYSETDKLSDFRISHCKEKAKTTLTEKLRLLDQEKAEKHFEIQITRELSKQLPEINYCFKNYIKDKNDLLVKIENKKNVINNIIKNIESLIY
>CP033535.1|AZB97205.1|3093375_3093588_-|XRE-family-transcriptional-regulator
MNDLAQKIGHAIRNCRIEQKITQEKLALLCNIDRSYVGRIERGEVNITVLKLYEIAQILKVAPHDLLPKD
>CP033535.1|AZB97204.1|3093040_3093280_+|hypothetical-protein
MTIENPENEREIAKAAALVLQNRFIEVTRTRTVLYVKNDILWSKAPNSEPVLVKKLSGRNPDLAKRFAGRGTYKIKKTW
>CP033535.1|AZB97203.1|3092452_3092860_+|Cd(II)/Pb(II)-responsive-transcriptional-regulator
MRIGQLAQSVGVDTQTIRFYERQGLLPPPGRQENGYRVYTEKHVERLAFIRRCRILDLSLAEIHELKRYQDDPHQSCTAVNALLDDHISHVRSQITALQALEKQLVSLRARCNDDREVKACGVLAGISEGSMHQQ
>CP033535.1|AZB97202.1|3091459_3092356_-|sodium:proton-antiporter
MSKNCGGPCGDHARPAADTDMQASSDASGEWVSVYAVPKMDCPSEERMIRLALNGVEGIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPETIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIARSTGLIGESLDNFADAAVYGLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLIEVVRRFVFGSEPESLVMMAIAFVALIANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITAGALVAWTGSNYPDLIIGTIAGVIVLNGARRILALKD
>CP033535.1|AZB97201.1|3090961_3091456_-|signal-peptidase-II
MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTSFFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSLILGGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKSKHQC
>CP033535.1|AZB97211.1|3124141_3125380_-|RND-transporter
MWNNQVSLVDAVQYAVQRNPNISQAISTLAGQNAGIDVAKAGYYPQISGGITTGDLSSGERGRQLLTLSATQMLFDFGKVKSGVSVEKAKLQVEQANVLVSIDDIALDVAQSIINIQRYLQLNKIAEQQIAGIQRIQEIANLRANAGISSQADPVQAQTYLESAQSTLIAQQSLLRQYQQHLRTLVGVDVFNKSWIIPDDLVKQSGLYSEPEFNTIPKMIAAQAGIEVAKAQKEQTRLSRYPTLAVKGSLSQAINGRNPNNNEDDGLYSSIMLEATSQFYQGGAVSSQVKMASYAEEAAKSKVNSVYLDVLDQIRTSREQIENKQRQMQVLANRQATTVRTRELYQEQYKLGTRSLVDLLNAEQAIHSANSELETARYDIYSSIVQYIAATGRSRQAYDLNNISIQGFEVQP
>CP033535.1|AZB97212.1|3126180_3126780_-|TetR/AcrR-family-transcriptional-regulator
MSETLPDPRKRPRQARSVATFEAILEAAARILESLGFAEFNTNAVAEIAGVSIGSLYQYFPSKDALIVELIRRERAKLSTHIVEAIQQHEAADLKEKLKLIIQAAVQHQLSRPQLARTLEFASELIGKDVEESVLQHELETIISDLFICSGISHEQTAAQDVIALSKGMINAAGIAGESDLNHLQQRVEKAVFGYLDLT
>CP033535.1|AZB97213.1|3126902_3127232_+|Darcynin-1
MSRTYTFFIHLRALPAWLALAREKRAEFSTQKLEPIFEKYPTVKVRWYDVEAFSTKASDIAVFETTSLQDYYFVIDAIRDSEFCTVPYFEFVEIIPAIEDGYVEYESSL
>CP033535.1|AZB97214.1|3127405_3128008_-|hypothetical-protein
MTNFVNVLNEMKDHYQNNINTGVAIPYYPNLVEDSLGLMEATNKYLVADDSELADNSVQSKLNDLQNQAKDLSTNTASTIEEELKKSAKELKDSGNSDSSQSKFKDKLMKIKEDAKKKANDNIEKIFAEAEKIGNTFPVAQNLIIVAAQKISDLINDLFTRLVDYIVKIVSDIIVWIKGAWDSIVSTFNNIKTWILNWFK
>CP033535.1|AZB97215.1|3129253_3129460_+|hypothetical-protein
MVAERKRVDRLNLRISTPEGVPLPSYRNKKRGTNESTLKKQVFSMYLGSGLSKPAGNVGQHAKHNLRV
>CP033535.1|AZB97216.1|3130126_3130618_-|flavin-reductase
MVQATDFRNAMSLLTSAVSVVTTAGMSGRFGFTASAVCSVTDTPPTLLVCMNQSASSHAHFLDNKILTVNVLGAHHEHISKAFSSKLTPEERFKHGAWIELETGSPVLDDALVSFDCEIEQIQQVGTHTIFICPIVAIKQSQHDQSLVYFNRAYHQVGQTEIV
>CP033535.1|AZB97217.1|3130805_3131849_-|methionine-synthase
MKKLLPTSTAGSLPKPSWLAEPEKLWSPWKLENEGLVEGKKDALRLALHEQQLAGIDIVSDGEQTRQHFVTTFIEHLNGVDFEKRETVRIRDRYDASVPSVVGAVSRQKPVFVEDAKFLRQQTNQPIKWALPGPMTMIDTLYDGHYKSREKLAWEFAKILNQEARELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGIKANTDWKKTLGSEWRQYEEAFPKLQTSNIDIISLECHNSHVPIDLLELIRGKKVMVGAIDVASNQIETPEEVANTLRKALQFVDADKLYPCTNCGMAPLSREVARGKLNALSAGAEIVRRELTGYDLTA
>CP033535.1|AZB97218.1|3131870_3132857_-|DUF1852-domain-containing-protein
MSKEFTFTIKSICFDENYRPADNTRITTNFANLARGMSREENLRNTLQMIDNRFNALAHWDNPKGDRYGVELEIISVEMNIDAENRTSGLPLIEILKTNIVDKKTNERIEGIVGNNFSSYVRDYDFSVLLLDHNKNKSTFSTPEKFGELHGNLFKSFINSETYKANFKKAPVICLSVSTTKEYHRTENEHPVLGVEYKQEDYSLTDEYFQKMGLKVRYFMPPNSVAPLAFYFTGDLLSDYTNLELISTISTMETFQKIYRPEIYNANSVAGKSYQPSLKHEDYSLTRIVYDREERSRLAIEQGKFVEEQFIKPYQAILEQWSANYAPN
>CP033535.1|AZB97219.1|3133225_3134098_-|LysR-family-transcriptional-regulator
MIERISLNSLKFFYFVAKYGSVTLAAKKLFVTQSAVSKQIYNLEEALNTALFDRKNKTLVMTEQGEILLSCCHQVFGQLDECLIQLSQPKAENKQLVLSCEPTLSMKWLIPRLSKFKKLGHDFEVVLLTAGGAVDFEKENIDIAIRRNDFDWGEHIYSEKIADEYIALVQATKPSETNDVLISTSRPNFFKSTSRIAELKQSLKGYTKVELEHFYLCLEGCLAGLGATVISIYMIEKELEWNLLQKISPVVQDNSAYFLLSHSAFEEDSRKTIFLEWLKTEMNESQHKLL
>CP033535.1|AZB97220.1|3134353_3134962_+|LysE-family-translocator
MAEFIAVILITILAVVSPGADFAIVTKNSYLYGRKIGVFTSLGISLGVLVHVTYTLVAVAFVMTYTPQILNIVKYIGALYLIYIGYKTFTQKPVLDSAALNSIATLQAIKYGFFTNALNPKTTLFVISTYTQIVSLTTPKTILLAYGFFMSFAHFLWFSLVAVLFSSMLLRQKMLAKQVQINKVIGSILCVLGVILLFSKFQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033535_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033535_3

3466304-3466445

Orphan

Consensus_repeat	Method
TTTTAATCCGTTGGTCCCGCGTTCGAGTCGCGGACGACCCACCA	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of CP033535_3

>merge|CP033535|3|3466304-3466445|CRISPRCasFinder
TTTTAATCCGTTGGTCCCGCGTTCGAGTCGCGGACGACCCACCACTTATCTGTTTTGAACCTATTTGGGTCGTTAGCTCAGTTGGTAGAGCAGCGGACTTTTAATCCGTTGGTCCCGCGTTCGAGTCGCGGACGACCCACCA

>CP033535|3|2|3466304-3466445|CRISPRCasFinder
TTTTAATCCGTTGGTCCCGCGTTCGAGTCGCGGACGACCCACCA	CTTATCTGTTTTGAACCTATTTGGGTCGTTAGCTCAGTTGGTAGAGCAGCGGAC
TTTTAATCCGTTGGTCCCGCGTTCGAGTCGCGGACGACCCACCA

Protein	Signature genes	Signature genes Name	Protein_function
CP033535.1\|AZB97367.1\|3477615_3478026_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
CP033535.1\|AZB97363.1\|3466509_3467406_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176161
CP033535.1\|AZB97712.1\|3469634_3470051_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|377396
CP033535.1\|AZB97358.1\|3456308_3456986_+\|DUF1345-domain-containing-protein	unknown	unknown	gnl\|CDD\|377769
CP033535.1\|AZB97365.1\|3472744_3473998_-\|SfnB-family-sulfur-acquisition-oxidoreductase	unknown	unknown	gnl\|CDD\|274924
CP033535.1\|AZB97357.1\|3447813_3448299_+\|RNA-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|234820
CP033535.1\|AZB97356.1\|3446981_3447632_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP033535.1\|AZB97368.1\|3478112_3479309_-\|TIGR03862-family-flavoprotein	unknown	unknown	gnl\|CDD\|274820
CP033535.1\|AZB97360.1\|3457701_3458397_-\|YafY-family-transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
CP033535.1\|AZB97362.1\|3459142_3460075_-\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|182909
CP033535.1\|AZB97370.1\|3480883_3481900_-\|ferrochelatase	unknown	unknown	gnl\|CDD\|366291
CP033535.1\|AZB97366.1\|3476161_3476494_+\|HopJ-type-III-effector-protein	unknown	unknown	gnl\|CDD\|378082
CP033535.1\|AZB97359.1\|3457046_3457652_-\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
CP033535.1\|AZB97713.1\|3480015_3480219_+\|DNA-gyrase-inhibitor-YacG	unknown	unknown	gnl\|CDD\|367713
CP033535.1\|AZB97355.1\|3444549_3445296_-\|SpoOM-protein	unknown	unknown	gnl\|CDD\|369195
CP033535.1\|AZB97711.1\|3464308_3466150_+\|long-chain-acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236217
CP033535.1\|AZB97361.1\|3458471_3459146_-\|phosphoglycolate-phosphatase	unknown	unknown	gnl\|CDD\|319835
CP033535.1\|AZB97369.1\|3480215_3480860_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293823
CP033535.1\|AZB97354.1\|3444177_3444429_-\|hypothetical-protein	unknown	unknown	unknown
CP033535.1\|AZB97364.1\|3468318_3469473_-\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550

Protein	Function_ID	Function_description	E-value
CP033535.1\|AZB97367.1\|3477615_3478026_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	6.82149e-30
CP033535.1\|AZB97364.1\|3468318_3469473_-\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
CP033535.1\|AZB97712.1\|3469634_3470051_+\|DMT-family-transporter	gnl\|CDD\|377396	pfam04657, DMT_YdcZ, Putative inner membrane exporter, YdcZ. DMT_YdcZ is a family of putative inner membrane exporters from both Gram-positive and Gram-negative bacteria.	1.93559e-35
CP033535.1\|AZB97358.1\|3456308_3456986_+\|DUF1345-domain-containing-protein	gnl\|CDD\|377769	pfam07077, DUF1345, Protein of unknown function (DUF1345). This family consists of several hypothetical bacterial proteins of around 230 residues in length. The function of this family is unknown.	1.07615e-67
CP033535.1\|AZB97365.1\|3472744_3473998_-\|SfnB-family-sulfur-acquisition-oxidoreductase	gnl\|CDD\|274924	TIGR04022, Acyl-CoA_dehydrogenase_type_2_domain, sulfur acquisition oxidoreductase, SfnB family. Members of this protein family belong to the greater family of acyl-CoA dehydrogenases. This family includes the sulfate starvation induced protein SfnB of Pseudomonas putida strain DS1, which is both encoded nearby to and phylogenetically closely correlated with the dimethyl sulphone monooxygenase SfnG. This family shows considerable sequence similarity to the Rhodococcus dibenzothiophene desulfurization enzyme DszC, although that enzyme falls outside of the scope of this family. [Central intermediary metabolism, Sulfur metabolism].	0
CP033535.1\|AZB97357.1\|3447813_3448299_+\|RNA-pyrophosphohydrolase	gnl\|CDD\|234820	PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed.	1.54574e-94
CP033535.1\|AZB97356.1\|3446981_3447632_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	7.04903e-49
CP033535.1\|AZB97368.1\|3478112_3479309_-\|TIGR03862-family-flavoprotein	gnl\|CDD\|274820	TIGR03862, flavo_PP4765, uncharacterized flavoprotein, PP_4765 family. This model describes a sharply distinctive clade of proteins within the larger family of flavoproteins described by pfam03486 and TIGRFAMs model TIGR00275. The function is unknown.	0
CP033535.1\|AZB97713.1\|3480015_3480219_+\|DNA-gyrase-inhibitor-YacG	gnl\|CDD\|367713	pfam03884, YacG, DNA gyrase inhibitor YacG. YacG inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. It acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. YacG has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins. The conserved four cysteine motif in this protein (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.	1.02725e-20
CP033535.1\|AZB97362.1\|3459142_3460075_-\|RluA-family-pseudouridine-synthase	gnl\|CDD\|182909	PRK11025, PRK11025, 23S rRNA pseudouridine(955/2504/2580) synthase RluC.	9.12076e-115
CP033535.1\|AZB97366.1\|3476161_3476494_+\|HopJ-type-III-effector-protein	gnl\|CDD\|378082	pfam08888, HopJ, HopJ type III effector protein. Pathovars of Pseudomonas syringae interact with their plant hosts via the action of Hrp outer protein (Hop) effector proteins, injected into plant cells by the type III secretion system. The proteins in this family are called HopJ after the original member HopPmaJ.	5.51269e-54
CP033535.1\|AZB97359.1\|3457046_3457652_-\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	2.3268e-32
CP033535.1\|AZB97370.1\|3480883_3481900_-\|ferrochelatase	gnl\|CDD\|366291	pfam00762, Ferrochelatase, Ferrochelatase.	6.14133e-135
CP033535.1\|AZB97355.1\|3444549_3445296_-\|SpoOM-protein	gnl\|CDD\|369195	pfam07070, Spo0M, SpoOM protein. This family consists of several bacterial SpoOM proteins which are thought to control sporulation in Bacillus subtilis.Spo0M exerts certain negative effects on sporulation and its gene expression is controlled by sigmaH.	6.41777e-82
CP033535.1\|AZB97711.1\|3464308_3466150_+\|long-chain-acyl-CoA-synthetase	gnl\|CDD\|236217	PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated.	0
CP033535.1\|AZB97361.1\|3458471_3459146_-\|phosphoglycolate-phosphatase	gnl\|CDD\|319835	cd07533, HAD_like, uncharacterized family of the haloacid dehalogenase-like (HAD) hydrolase superfamily, similar to Parvibaculum lavamentivorans HAD-superfamily hydrolase, subfamily IA, variant 1. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.93977e-65
CP033535.1\|AZB97369.1\|3480215_3480860_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293823	cd07737, YcbL-like_MBL-fold, Salmonella enterica serovar typhimurium YcbL and related proteins; MBL-fold metallo hydrolase domain. This subgroup includes Salmonella enterica serovar typhimurium YcbL which has type II hydroxyacylglutathione hydrolase (EC 3.1.2.6, also known as glyoxalase II) activity, and has a single metal ion binding site, and Thermus thermophilus TTHA1623 which does not have GLX2 activity and has two metal ion binding sites with a glyoxalase II-type metal coordination. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.14805e-116
CP033535.1\|AZB97360.1\|3457701_3458397_-\|YafY-family-transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.90814e-54
CP033535.1\|AZB97363.1\|3466509_3467406_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176161	cd08472, PBP2_CrgA_like_3, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 3. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.84721e-89

>CP033535.1|AZB97711.1|3464308_3466150_+|long-chain-acyl-CoA-synthetase
MSQTTQTDIITLGDVATRLPSFIPKVPHILNGLKQAYLRTANTPTGLGVAFEKAVKRNPKGIALLFEDQSYSYEALNEWANQISHYYLSLGARKGDVIAVMVENRSELIATIVGLAKIGVTIALVNTSQVGKVLAHSINLVKPIAVIAGEEVRAAIDEIRQDLNVPKDRFHWFADQATRQDAGTAPQGYANLAIEIDQFPKFNPSTTHSVHGNDGLFYIYTSGTTGLPKAVIFKHSRWTLAYGTYGHILNLGPNDVMYVTLPLYHATGVVVCWCGVIAGSSTLAIRRKYSTSAFWKDVQKFNASAIGYVGELCRYLMDAPTTELDRAHRVTKMIGNGMRPNIWDKFKQRFGVEEVLELYASSEGNVGFSNIFNFDNTVGFSPMPYAVIQFDKEKNEPVRDKNGWCKKVKAGEVGLLVGKITSRSPFDGYTDPEKNKSVILQDVFKKGDSYFNTGDLVRNIGFRHAQFVDRLGDTFRWKGENVSTTEVENMVCEYDKIAEAVVYGVEIPNTNGRAGMAAITLADGAELNDTDLTEMVTVFKKCLPAYAVPVFLRIQAKVETTGTFKYQKNKLKEDAFNPSKTSERLLALLPGESSYCDITTEIFDNIQAYKYRF
>CP033535.1|AZB97362.1|3459142_3460075_-|RluA-family-pseudouridine-synthase
MNSTQQWQSVTWFEVDEHQAGQRIDNFLFSRLKGVPKSRIYRLIREGQVRVNKKRIKAETKLEIGDQIRVAPIRYEQKDETAAPVSDSVAQSLLSRVVYEDEGLLVINKPSGIAVHGGSGVAYGLIEALRAATGKKYLELIHRIDRDTSGLVMISKKRSTLKLLQDMLREHKIRKTYAAIVKGQVSLDKQLIDAPLFRYELANGERRVRVSKEGKPSKTEWVVAERFKNATLVHASPLSGRTHQIRVHGLSIGHPLLGDDKYGHTTEYSGPQARRLCLHAMRLDIPGYPPIEAPLPEDMTQLLKALRVAK
>CP033535.1|AZB97361.1|3458471_3459146_-|phosphoglycolate-phosphatase
MSLKTELVIFDWDGTLYNSVGQIVASLQHAAEQHELPLSDEAAKSIIGLGLPEVMQTLFPEAPELHDSILKVYGDHYIANSTSDAWFEGISELLHDLKAQGLKLAVATGKNRRGLDRVIAKTQSTHLFDVTRAANETRSKPDPLMLQEILTVTGVSVEQAVMIGDSSYDLEMAQRLGMPRIGVGYGVHSVEVLQKFQPLTIAKDVQELHSFLRGYTQLPTVDVA
>CP033535.1|AZB97360.1|3457701_3458397_-|YafY-family-transcriptional-regulator
MSRSIRLLNLLQQLREARYPITAQVLAESLNISVRSVYRDIDSLREQGVRIDASAGLGFQLKEDILLPPVTFNENEAEALFLALEWLKDVPDQAMKSAAVSIYSKLYAVLPEHRKYLIDDMTLGVTHYWHPVDEALVEQVRLAIRKQVKIKVDYCDEQKRLSERSLWPFALGYLHDKVVLAAWCELRQAFRHFRIDRIHDLQMSEEIYPEFKKHLFQRWWKQEMQRTTDKN
>CP033535.1|AZB97359.1|3457046_3457652_-|glutathione-S-transferase-family-protein
MSLKLYTNKESRGVVIDWLLVELGVECERIEVAYKTEMKSPEYLKLNPFGKVPVLVDGDVVIYELGAICAYLADKFSDKGLAPALDDPKRGLYYRWLFVMAGPWEAAGVDKALGIEISPEQKMFVGYGDYNDAYQALVQGLSEANPYVCGEQFTAADISVGAMLLWQLKMNAIESHPAITRYVETIKQREGLKQSTMGQLL
>CP033535.1|AZB97358.1|3456308_3456986_+|DUF1345-domain-containing-protein
MVGVFQHLGRSVQNRPHFFIALFIGIVTAGILTWLTSWKWSTILLVSWNASVSIYLLHVWQLMKSADHSQMQQQAKKQDESKWVIMLIVLLALIMCLVAILIQLSQLPSDSSAKLGHVALALLTIVSAWLFMHTVFALHYAHDFYMALSRNEENGGLDFPGTKQPTYPDFLYFSYIIGTSAQTADVSITTKHMRLLNLFHAVLSFGFNTTILAICINVAAGFLTN
>CP033535.1|AZB97357.1|3447813_3448299_+|RNA-pyrophosphohydrolase
MIDSEGFRPNVGIILANDDGQVLWAKRIGHNAWQFPQGGIQFGETPEQALFRELREEIGLLPEHVQIIAQTKGWLRYRLPHRYIRSDSDPVCIGQKQKWFLLKLTAPAKNIQLNLSDPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMVELCTQLPMQQLP
>CP033535.1|AZB97356.1|3446981_3447632_-|HAD-IB-family-hydrolase
MKLALFDLDHTLLNTDSDHSWGEFLVNEGLVDPVHHRQMNDKFYEDYKAGQLDPYAYNEFVFGFLTQHDNDYLTELHQLFMQKVIRPQMRPKGFDAIKKHQDLGHTIVGITATSDFITAPIFREFGITEILATNAEVADGKYTGKVAGLACYQKGKLARLDAWLEGRNVSESWAYSDSINDRFLLEYATHAIAVNPDDRLEKLAQEHNWDIQDWSI
>CP033535.1|AZB97355.1|3444549_3445296_-|SpoOM-protein
MFSKIMSGLGLQGVTVETVLQNPSLQAGSTLHGEISFKGGSSDKEINGLYLQLVTMAEVESGDHEFNQPLVLQEWLVNSRFLLPAHQAHSFPFSIQLPFETPITEVACRRNGARVWIQTHMDVDWGLDATDRDYLKVLPTPAMQMFLQAMQRCGFVLSTVDVEKGQLTARNFRSTIGCYQELEFVSSHMFSGFNEVEVSFVAEPNQTHVMLEVDRHFRSDQLLTMTIPHHMLDENQMVQQIRSLLKLG
>CP033535.1|AZB97354.1|3444177_3444429_-|hypothetical-protein
MDDQNETEEKKTRKANLLEEFGGQLIDGFITLIGELFIYIIFLLFLGALLGIIFAAIFFGWGILFLLLPFAFLVYILFKKYSR
>CP033535.1|AZB97363.1|3466509_3467406_-|LysR-family-transcriptional-regulator
MDRLQQFFIFTEVAKRQSFIEVANQLDLPRSTVTSAIQQLETHYGVRLFHRTTRKVSLTQDGQRILPECQNLLFDYEQLEQLIQAQKQHYRGTLKISMPSRIVHQVIIPELPDFYSRYPDIHLQLHSSDDITDLIEKGIDCVVRVGQLDNSSLIAKFVGNLIMVNCASADYLEQYGIPEQLEDLSQHKLINYAGAVGEKQGVFSYQDGAVMMDSALSVNNTEAYIAAASAGLGIIQLPYYDVQDKIEQGTLVEVLSAYTAQSLPLNILYPNRSYIPKRLEIFMEWARDVLYKKCIVIF
>CP033535.1|AZB97364.1|3468318_3469473_-|radical-SAM-family-heme-chaperone-HemW
MAVLNPASVPLSLYIHMPWCVRKCPYCDFNSHAVPDGALSAELEQTYLKALVADFETQVEMAQGRSIHSVFIGGGTPSLISAKGYAWLFEQLKSLLKFEDGCEITLEANPGTLEHDPFAGYLEAGINRLSIGVQTFNTEHLQKLGRIHSVNNAMDAIEQARQAGFKRVNVDLMHGLPEQTLEQALYDLKMAVEHGATHISWYQLTIEPNTVFFRTQPVLPQDEVLEDIQEQGEAYLKANGFINYEVSAWRKEQPSAHNLNYWEFGDYLAIGAGAHGKVTRPDGVYRFQKTRLPKDYLAKVPAEHLQMKKIEAEELPFEFMMNALRLNDGVKAELYEQRTGLSLDHLNEVLTSLRARKLLVEDHSRLACTEQGHIFLNSVLEEFL
>CP033535.1|AZB97712.1|3469634_3470051_+|DMT-family-transporter
MGIGVAMAFQTAINAQLREQLHSPLQAALLSFFIGTIVLAVMVFFQSAEKPSLSEISNIPWLLWTGGFLGVYAISMSIYTAPKLGFLTFTGLVVFGQLLISMLLDHFGWLGTEKTPVTWQRFLGGVIIFVGVLLTLQR
>CP033535.1|AZB97365.1|3472744_3473998_-|SfnB-family-sulfur-acquisition-oxidoreductase
MTSLSSAHGRSQAVPLSVFEQSKDAHIIRSDEEAIELAKQLAQEFAQEASERDKERRLPLNEIQQFSQSGLWAITVPKQFGGAQVKYRTLAEVIKTIASVDPSLAQLPQNHLAFIEHLRLDAGPEQQQFFFNLVLRGIRFGNAFSEKHSKTVADLTTTLRKTEHGYEINGKKFFATGALLAHWVPIVAVNEEGQPYAALVPRETSGVNIINDWSGFGQRTTASGTVELNQVPVREEYLIPIYQAFERPTPAGAISQFIQAAVDAGIARGAIEETIHYVKNHSRAWVDSGLEKASDDPYTIANIGDLKIKLRAAEAVLDLAGDAIDQAIADTTEEHVNQATLLVAEAKVLTTEVAILAANKLFELSGTRSTLSELNLDRHWRNARTHTLHDPVRWKYHIVGNYYLNGIHPPSSCMELK
>CP033535.1|AZB97366.1|3476161_3476494_+|HopJ-type-III-effector-protein
MAQELLAQLQAGTAKFSDVLAHIEARYQHTPTAFQNGAQHNAATENQGSAKVFSFAKLQGLDQAQTLSLFAEHYASVLATPEGTDHQNIRQFMQNGWDGVKFEGQALTEK
>CP033535.1|AZB97367.1|3477615_3478026_-|GFA-family-protein
MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAFATNAPVKSTDFKITQGENLVKKFAVNGVYRWFCGECGSPLISSRDAQPELYRIRIGSLDTPLDQKPTMHIFAASKAEWESICDDLPQYDERP
>CP033535.1|AZB97368.1|3478112_3479309_-|TIGR03862-family-flavoprotein
MANKRVAIIGAGPAGLMAAEVLSQYAYDIDVYEQKPSAARKFLMAGKTGLNISHAEPLAQFIERYDRVEWLKPWVEKWDAIWIQNWIKSLGIESYVGTSGRIFPVEMKAAPLLRAWLKRLAEQQVKFFYRHRCINLQGTTVTLENQNNQSAETFTQQYDAVVLACGAVSWSQLGSDGAWQQWVDQSNIEPFQASNAGVLHAWSAFMESCFGEPLKRINAWVEPSQVTHGDIVITHYGLESGVIYKLGRALREQQKQGQSLNLFLDLLPDVELSQLVKKLQASKKQSLTNIWRKAGLDTTKINLIREVVDKALWNQPEAMAQRIKALQIKLEGFRPIEEAISCAGGVKQNALTESLELKQTSGVFCCGEMLDWDAPTGGYLLTACFATGRAAGEGVHSF
>CP033535.1|AZB97713.1|3480015_3480219_+|DNA-gyrase-inhibitor-YacG
MALCHVHSPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLPTQDAPQHNKGSQNEDDYED
>CP033535.1|AZB97369.1|3480215_3480860_-|MBL-fold-metallo-hydrolase
MLQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEALGLKVKALWLTHGHLDHAGAVGELAKEWSVPVIGPHKEDQFWLDMIQEVSARYGFPIPQPVKVDQWLEGGEVLKLGEDEFEVRFAPGHTPGHVVFYNKNHGLLWTGDVLFKGSIGRTDFPRGNHDQLIESIKRECFSLPDDTQFISGHGPMSTIGYEKQFNPFVAGKAG
>CP033535.1|AZB97370.1|3480883_3481900_-|ferrochelatase
MSFEQKPKVTVILANLGTPDEATVPAVRRFLKQFLSDSRVIEIPKFIWWIILNLFVLPFRPKRVAHAYASVWSKDSPMREIVFEQTQRIEAYLQRENNQFDLTVIPAMTYGNPGIDVVLEKLATNPQEHVILLPLFPQYSATSTAPLYDAFAKWIPAQRNLPGLTIIKDYYQHPMFIQALAESVLAYQEQYGKPEKLLMSFHGIPQPYADKGDPYADRCRITAKLVAEALHLKEDEWAISFQSRFGKQEWVKPYTDQLLQDWAKQGVKSVQVLSPAFSADCLETLEELAIQNAELFQELGGGSYSYIPALNSDQAHIDLLAGLVQANLDALTYTLAHR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP033535.1	3115852-3115882	1	0.968
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	CP033535.1	3115858-3115888	2	0.935

1. spacer 2.35|3118679|31|CP033535|CRT matches to position: 3115852-3115882, mismatch: 1, identity: 0.968

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatcagagtcgctgtcagagtca	Protospacer
***************************.***

2. spacer 2.1|3115894|31|CP033535|CRT matches to position: 3115858-3115888, mismatch: 2, identity: 0.935

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
ggaatcagagtcgctgtcagagtcagagtcg	Protospacer
***************.***********.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1342-1372	1	0.968
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1036-1060	1	0.96
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2482-2506	1	0.96
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1798-1828	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2578-2608	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1126	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2206-2236	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151690	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151744	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155989	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157261	2	0.935
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1042-1072	2	0.935
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1798-1822	2	0.92
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16490-16514	2	0.92
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16670-16694	2	0.92
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17168-17192	2	0.92
CP033535_2	2.28\|3118211\|37\|CP033535\|CRT	3118211-3118247	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1846	2	0.946
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19034-19064	2	0.935
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2296-2326	2	0.935
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-37	2	0.935
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-73	2	0.935
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1828-1858	2	0.935
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2734	2	0.935
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1822	2	0.935
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19040-19070	2	0.935
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1822	2	0.935
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3724-3754	2	0.935
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153949-153979	2	0.935
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157315-157345	2	0.935
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157603-157633	2	0.935
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1342-1372	2	0.935
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-31	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1114	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1360-1384	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2986-3010	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-67	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1090-1114	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1696	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1816	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2464	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2728	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151311-151335	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151726-151750	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152989-153013	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153415-153439	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154447-154471	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155953-155977	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157045-157069	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157225-157249	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157243-157267	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157459-157483	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16766-16790	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17762-17786	2	0.92
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19244-19268	2	0.92
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3730-3760	3	0.903
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16796-16826	3	0.903
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17630-17660	3	0.903
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17792-17822	3	0.903
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18878-18908	3	0.903
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19274-19304	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	49-79	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1420-1450	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1678-1708	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1798-1828	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2710-2740	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3262-3292	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3418-3448	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3592-3622	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157051-157081	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157477	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17006-17036	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16664-16694	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16754-16784	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16796-16826	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17630-17660	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17750-17780	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17792-17822	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18590-18620	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18878-18908	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19232-19262	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19274-19304	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	13-43	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21289-21319	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21307-21337	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21361-21391	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15748-15778	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15766-15796	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15910-15940	3	0.903
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9991-10021	3	0.903
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16508-16532	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16802-16826	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17012-17036	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17186-17210	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17528-17552	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17636-17660	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17798-17822	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17912-17936	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18140-18164	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18884-18908	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19022-19046	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19280-19304	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19394-19418	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19622-19646	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151257-151281	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157051-157075	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21055-21079	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15442-15466	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15550-15574	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15676-15700	3	0.88
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9613-9637	3	0.88
CP033535_2	2.28\|3118211\|37\|CP033535\|CRT	3118211-3118247	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2116	3	0.919
CP033535_2	2.28\|3118211\|37\|CP033535\|CRT	3118211-3118247	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155845-155881	3	0.919
CP033535_2	2.28\|3118211\|37\|CP033535\|CRT	3118211-3118247	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156787-156823	3	0.919
CP033535_2	2.28\|3118211\|37\|CP033535\|CRT	3118211-3118247	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157261-157297	3	0.919
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16598-16628	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16910-16940	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17024-17054	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18266-18296	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20054-20084	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154687-154717	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154705-154735	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154903-154933	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155101-155131	3	0.903
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155335-155365	3	0.903
CP033535_2	2.32\|3118475\|31\|CP033535\|CRT	3118475-3118505	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1798-1828	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1036-1066	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1120	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1342-1372	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1702	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2470	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2590-2620	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2722-2752	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2872-2902	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2938	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2926-2956	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16760-16790	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16802-16832	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17636-17666	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17756-17786	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17798-17828	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18884-18914	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19238-19268	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19280-19310	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151858-151888	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151948-151978	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151984-152014	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153187-153217	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153379-153409	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153505-153535	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153541-153571	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154681-154711	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154699-154729	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154717-154747	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154771-154801	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154897-154927	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154915-154945	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154969-154999	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155095-155125	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155113-155143	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155167-155197	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155221-155251	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155329-155359	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155347-155377	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155401-155431	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155863-155893	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156535-156565	3	0.903
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156919-156949	3	0.903
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157075-157111	3	0.919
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2074-2110	3	0.919
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1036-1066	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1576-1606	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3112-3142	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3148-3178	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3256-3286	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3430-3460	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154771-154801	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155167-155197	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155221-155251	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155401-155431	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151251-151281	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153343-153373	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154057-154087	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156619-156649	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157207-157237	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157441-157471	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16760-16790	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16802-16832	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17636-17666	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17756-17786	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17798-17828	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18884-18914	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19238-19268	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19280-19310	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17030-17060	3	0.903
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1000-1030	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-37	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-73	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1828-1858	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2734	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1198-1228	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1270-1300	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1792-1822	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3442	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3466-3496	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19040-19070	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153949-153979	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155917-155947	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157315-157345	3	0.903
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157603-157633	3	0.903
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1108-1132	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1306-1330	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1414-1438	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1468-1492	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1522-1546	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1834	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1918-1942	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1990-2014	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2104	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2572-2596	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2932	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3274-3298	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3436	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3448-3472	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3742-3766	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3778-3802	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151654-151678	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151672-151696	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151708-151732	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152056-152080	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153361-153385	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154303-154327	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154339-154363	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155437-155461	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155683-155707	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155971-155995	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157063-157087	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157099-157123	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157333-157357	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157531-157555	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16148-16172	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16280-16304	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16412-16436	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16478-16502	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16676-16700	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16724-16748	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17018-17042	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17090-17114	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17156-17180	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17534-17558	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17558-17582	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17600-17624	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17720-17744	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18020-18044	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18218-18242	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18260-18284	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18482-18506	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18530-18554	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18848-18872	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18962-18986	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19202-19226	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19502-19526	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19700-19724	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19742-19766	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20048-20072	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15616-15640	3	0.88
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15742-15766	3	0.88
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16754-16784	4	0.871
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17750-17780	4	0.871
CP033535_2	2.1\|3115894\|31\|CP033535\|CRT	3115894-3115924	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19232-19262	4	0.871
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151257-151287	4	0.871
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156625-156655	4	0.871
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154291-154321	4	0.871
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17522-17552	4	0.871
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18572-18602	4	0.871
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	49-73	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1096-1120	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1420-1444	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1528-1552	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1606	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1678-1702	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1966	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2578-2602	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2710-2734	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2992-3016	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3118-3142	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3262-3286	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3418-3442	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3592-3616	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3784-3808	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16760-16784	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17756-17780	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19238-19262	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151281-151305	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151660-151684	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151714-151738	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152995-153019	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154345-154369	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154453-154477	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155443-155467	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155959-155983	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156223-156247	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156625-156649	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156775-156799	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157069-157093	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157231-157255	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157249-157273	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157447-157471	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157465-157489	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	13-37	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-994	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1042-1066	4	0.84
CP033535_2	2.26\|3118091\|25\|CP033535\|CRT	3118091-3118115	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1096-1120	4	0.84
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19838-19868	4	0.871
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1312-1342	4	0.871
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2170-2200	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1198-1228	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1270-1300	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3412-3442	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3466-3496	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153949-153979	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155917-155947	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157315-157345	4	0.871
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157603-157633	4	0.871
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154177-154213	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154333-154369	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154585-154621	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155737-155773	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157057-157093	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157111-157147	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1390-1426	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1894-1930	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2794-2830	4	0.892
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3736-3772	4	0.892
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	43-73	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1690-1720	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1828-1858	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2182-2212	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2704-2734	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3640-3670	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151546-151576	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151582-151612	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153115-153145	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153397-153427	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153433-153463	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154165-154195	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154321-154351	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154573-154603	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154609-154639	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154843-154873	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154987-155017	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155593-155623	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155629-155659	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155665-155695	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156217-156247	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156769-156799	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156805-156835	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156973-157003	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157279-157309	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16088-16118	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16220-16250	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16352-16382	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16628-16658	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16940-16970	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17378-17408	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17594-17624	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18296-18326	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18596-18626	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18692-18722	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18842-18872	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19796-19826	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	7-37	4	0.871
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	964-994	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1036-1066	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1090-1120	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1672-1702	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2470	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2590-2620	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2722-2752	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2872-2902	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2908-2938	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2926-2956	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16760-16790	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16802-16832	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17636-17666	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17756-17786	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17798-17828	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18884-18914	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19238-19268	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19280-19310	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151858-151888	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151948-151978	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151984-152014	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153187-153217	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153379-153409	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153505-153535	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153541-153571	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154681-154711	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154699-154729	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154717-154747	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154771-154801	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154897-154927	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154915-154945	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154969-154999	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155095-155125	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155113-155143	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155167-155197	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155221-155251	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155329-155359	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155347-155377	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155401-155431	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155863-155893	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156535-156565	4	0.871
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156919-156949	4	0.871
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	946-970	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	982-1006	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2116-2140	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2200-2224	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2554-2578	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2854-2878	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151299	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151366-151390	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155203-155227	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156145-156169	4	0.84
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157405-157429	4	0.84
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3784-3814	5	0.839
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17906-17936	5	0.839
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19388-19418	5	0.839
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	67-97	5	0.839
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	31-61	5	0.839
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19970-20000	5	0.839
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2020-2056	5	0.865
CP033535_2	2.38\|3118877\|31\|CP033535\|CRT	3118877-3118907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1810-1840	5	0.839
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2440-2470	5	0.839
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2872-2902	5	0.839
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2164-2194	5	0.839
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151305	5	0.839
CP033535_2	2.44\|3119267\|25\|CP033535\|CRT	3119267-3119291	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3610	5	0.8
CP033535_2	2.20\|3117634\|50\|CP033535\|CRT	3117634-3117683	50	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2187-2236	6	0.88
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18644-18674	6	0.806
CP033535_2	2.32\|3118475\|31\|CP033535\|CRT	3118475-3118505	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154189-154219	6	0.806
CP033535_2	2.32\|3118475\|31\|CP033535\|CRT	3118475-3118505	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155749-155779	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2164-2194	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17432-17462	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18746-18776	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18398-18428	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18524-18554	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19118-19148	6	0.806
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151275-151305	6	0.806
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154213-154249	6	0.838
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1432-1462	6	0.806
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2482-2512	6	0.806
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3232	6	0.806
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17432-17462	6	0.806
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18746-18776	6	0.806
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19970-20000	6	0.806
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152020-152050	6	0.806
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156169-156199	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16580-16610	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16832-16862	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16892-16922	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17258-17288	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18062-18092	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19544-19574	7	0.774
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3784-3814	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16142-16172	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16274-16304	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16406-16436	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16718-16748	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17084-17114	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17552-17582	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17714-17744	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18014-18044	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18212-18242	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18476-18506	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18908-18938	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18956-18986	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19196-19226	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19496-19526	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19694-19724	7	0.774
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152020-152050	7	0.774
CP033535_2	2.38\|3118877\|31\|CP033535\|CRT	3118877-3118907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2554-2584	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3586-3616	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152020-152050	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19970-20000	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16142-16172	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16274-16304	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16406-16436	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16718-16748	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17084-17114	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17552-17582	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17714-17744	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18014-18044	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18212-18242	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18476-18506	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18908-18938	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18956-18986	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19196-19226	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19496-19526	7	0.774
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19694-19724	7	0.774
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3232	7	0.774
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17432-17462	7	0.774
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18746-18776	7	0.774
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18398-18428	7	0.774
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18524-18554	7	0.774
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19118-19148	7	0.774
CP033535_2	2.24\|3117977\|31\|CP033535\|CRT	3117977-3118007	31	MK448814	Streptococcus phage Javan583, complete genome	20664-20694	8	0.742
CP033535_2	2.28\|3118211\|37\|CP033535\|CRT	3118211-3118247	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1180-1216	8	0.784
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP030188	Salmonella enterica strain SA20094620 plasmid pSA20094620.3, complete sequence	25762-25792	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_LT985263	Escherichia coli strain 511 plasmid RCS54_p, complete sequence	74117-74147	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	AF083977	Bacteriophage Mu, complete genome	32102-32132	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	AF466696	Enterobacteria phage Mu invertible G-segment, complete sequence	148-178	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NC_000929	Enterobacteria phage Mu, complete genome	32102-32132	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_KX880944	Escherichia coli strain pMCR-1-P3 plasmid pMCR-1-P3, complete sequence	29077-29107	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP034790	Escherichia coli strain ECCNB20-2 plasmid pTB423, complete sequence	15562-15592	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_CP019054	Escherichia coli strain CRE1540 plasmid p1540-3, complete sequence	106898-106928	8	0.742
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	NZ_MG196293	Escherichia coli strain SDX5C133 plasmid pHNSD133T1, complete sequence	85738-85768	8	0.742
CP033535_2	2.32\|3118475\|31\|CP033535\|CRT	3118475-3118505	31	MH319741	Marine virus AG-345-E15 Ga0172270_11 genomic sequence	64398-64428	8	0.742
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3202-3232	8	0.742
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154531-154567	8	0.784
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154801-154837	8	0.784
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155767-155803	8	0.784
CP033535_2	2.37\|3118817\|37\|CP033535\|CRT	3118817-3118853	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2476-2512	8	0.784
CP033535_2	2.38\|3118877\|31\|CP033535\|CRT	3118877-3118907	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2080-2110	8	0.742
CP033535_2	2.38\|3118877\|31\|CP033535\|CRT	3118877-3118907	31	AP013523	Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S37-C8	31861-31891	8	0.742
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18398-18428	8	0.742
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19118-19148	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16142-16172	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16274-16304	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16406-16436	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16718-16748	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17084-17114	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17552-17582	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17714-17744	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18014-18044	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18212-18242	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18476-18506	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18908-18938	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18956-18986	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19196-19226	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19496-19526	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19694-19724	8	0.742
CP033535_2	2.42\|3119141\|31\|CP033535\|CRT	3119141-3119171	31	NC_018859	Escherichia phage ECBP2, complete genome	6929-6959	8	0.742
CP033535_2	2.2\|3115948\|37\|CP033535\|CRT	3115948-3115984	37	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1186-1222	9	0.757
CP033535_2	2.29\|3118271\|31\|CP033535\|CRT	3118271-3118301	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	9	0.71
CP033535_2	2.35\|3118679\|31\|CP033535\|CRT	3118679-3118709	31	NC_018859	Escherichia phage ECBP2, complete genome	6929-6959	9	0.71
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151233-151263	9	0.71
CP033535_2	2.27\|3118139\|49\|CP033535\|CRT	3118139-3118187	49	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2104-2152	10	0.796
CP033535_2	2.40\|3119009\|31\|CP033535\|CRT	3119009-3119039	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-25	10	0.677
CP033535_2	2.46\|3119405\|37\|CP033535\|CRT	3119405-3119441	37	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155755-155791	10	0.73
CP033535_2	2.46\|3119405\|37\|CP033535\|CRT	3119405-3119441	37	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1030-1066	10	0.73
CP033535_3	3.1\|3466348\|54\|CP033535\|CRISPRCasFinder	3466348-3466401	54	NC_003315	Haemophilus phage HP2, complete genome	402-455	11	0.796
CP033535_3	3.1\|3466348\|54\|CP033535\|CRISPRCasFinder	3466348-3466401	54	AY027935	Haemophilus influenzae phage HP2, complete genome	402-455	11	0.796
CP033535_3	3.1\|3466348\|54\|CP033535\|CRISPRCasFinder	3466348-3466401	54	Z71579	Bacteriophage S2 type A 5.6 kb DNA fragment	402-455	12	0.778
CP033535_3	3.1\|3466348\|54\|CP033535\|CRISPRCasFinder	3466348-3466401	54	U24159	Bacteriophage HP1 strain HP1c1, complete genome	400-453	12	0.778
CP033535_3	3.1\|3466348\|54\|CP033535\|CRISPRCasFinder	3466348-3466401	54	NC_001697	Haemophilus phage HP1, complete genome	400-453	12	0.778

1. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.968

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtca	Protospacer
************.******************

2. spacer 2.44|3119267|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.96

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcgctgtca	Protospacer
***.*********************

3. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcgctgtca	Protospacer
***.*********************

4. spacer 2.1|3115894|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
ggagtcagagtcgctgtcagagtcagaatcg	Protospacer
***.***********.***************

5. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtctgagtcg	Protospacer
 *****************.************

6. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgagtcgctgtcagagtccgagtcg	Protospacer
****** *****************.******

7. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgagtcgctgtcggagtctgagtcg	Protospacer
****** ***********.************

8. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgagtcgctgtcagagtccgagtcg	Protospacer
****** *****************.******

9. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgagtcgctgtcagagtccgagtcg	Protospacer
****** *****************.******

10. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgagtcgctgtcagagtccgagtcg	Protospacer
****** *****************.******

11. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgagtcgctgtcagagtccgagtcg	Protospacer
****** *****************.******

12. spacer 2.24|3117977|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtcagagtcgctgtcagaatccgagtcg	Protospacer
*********************.**.******

13. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcagagtcgctgtcagagtca	Protospacer
 **************.*********

14. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtca	Protospacer
****** *********** ******

15. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtcagagtcgctgtctgagtca	Protospacer
***************.** ******

16. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtca	Protospacer
****** *********** ******

17. spacer 2.28|3118211|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.946

actgtcagagtcagaatcgctgtcggaatcagagtcg	CRISPR spacer
gctgtcagagtcagaatcgctgtcggaatcggagtcg	Protospacer
.*****************************.******

18. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctgtctgaatcagagtcg	Protospacer
 ***************** ************

19. spacer 2.29|3118271|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
agaatccgagtcgctgtcggaatcggagtcg	Protospacer
****** *****************.******

20. spacer 2.35|3118679|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
*********.********************.

21. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
*********.********************.

22. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatcggagtcgctgtcagaatcc	Protospacer
************.*****************

23. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
*********.********************.

24. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagagtca	Protospacer
*********.*****************.***

25. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.935

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgaatca	Protospacer
****** ***************** ******

26. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagagtca	Protospacer
.********.*********************

27. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtccgaatcggagtcgctgtcagagtca	Protospacer
****** *****.******************

28. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatccgagtcgctgtcagagtcc	Protospacer
************ *****************

29. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcc	Protospacer
************.*****************

30. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcg	Protospacer
************.*****************.

31. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtca	Protospacer
************.**************.***

32. spacer 2.44|3119267|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcggagtcagagtcgctgtca	Protospacer
***.**.******************

33. spacer 2.44|3119267|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtca	Protospacer
***.** ******************

34. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcgctgtcc	Protospacer
***.********************

35. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcgctgtcg	Protospacer
***.********************.

36. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcggagtcagagtcgctgtca	Protospacer
***.**.******************

37. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

38. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtca	Protospacer
***.** ******************

39. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcggagtcagagtcgctgtca	Protospacer
***.**.******************

40. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcggagtcagagtcgctgtca	Protospacer
***.**.******************

41. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcggagtcagagtcgctgtca	Protospacer
***.**.******************

42. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatccgagtcagagtcactgtca	Protospacer
****** ***********.******

43. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

44. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatcggagtccgagtcgctgtca	Protospacer
******.***** ************

45. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

46. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcactgtca	Protospacer
***.**************.******

47. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

48. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcactgtca	Protospacer
***.**************.******

49. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

50. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

51. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtca	Protospacer
***.******** ************

52. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagaatcagagtcgctgtca	Protospacer
***.*****.***************

53. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagaatcagagtcgctgtca	Protospacer
***.*****.***************

54. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.92

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagaatcagagtcgctgtca	Protospacer
***.*****.***************

55. spacer 2.1|3115894|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
cgaatcggagtcgctgtcagagtcagaatcg	Protospacer
 *****.********.***************

56. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **************.******** ******

57. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **************.******** ******

58. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **************.******** ******

59. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **************.******** ******

60. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **************.******** ******

61. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtcagagtcgctgtcagaatcggagtcg	Protospacer
.********************.** ******

62. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtcggagtcg	Protospacer
 *****************.***** ******

63. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
cgagtcagagtcgctgtcagaatccgagtcg	Protospacer
 ********************.**.******

64. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtcagagtcgctgtcagagtcagaatcg	Protospacer
.*********************** **.***

65. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtcagagtcgctgtcagaatcggagtcg	Protospacer
.********************.** ******

66. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtcggagtcgctgtcagagtccgagtcg	Protospacer
.*****.*****************.******

67. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
cgagtcagagtcgctgtcagaatcggagtcg	Protospacer
 ********************.** ******

68. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtcagagtcgctgtccgagtcggagtcg	Protospacer
.***************** ***** ******

69. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtcagagtcactgtcagagtcagagtca	Protospacer
************.*********** *****.

70. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtccgagtcgctgtcagagtccgagtcg	Protospacer
.***** *****************.******

71. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtcagagtcgctgtctgagtctgagtct	Protospacer
 ***************** ***********

72. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtcagagtcgctgtctgagtcagagtcg	Protospacer
 ***************** ***** ******

73. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatca	Protospacer
***.***********************.**.

74. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **.***********************.***

75. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **.***********************.***

76. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatca	Protospacer
***.***********************.**.

77. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **.***********************.***

78. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcagagtcgctgtctgagtctgagtcg	Protospacer
 **.************** ************

79. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **.***********************.***

80. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatca	Protospacer
***.***********************.**.

81. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcagagtcgctgtcagagtctgaatcg	Protospacer
 **.***********************.***

82. spacer 2.24|3117977|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtcagagtcgctgtcagaatcggagtcg	Protospacer
.********************.** ******

83. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

84. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

85. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

86. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

87. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

88. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

89. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.903

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtcg	Protospacer
 ***** *********** ************

90. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

91. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgaatcagagtcgctgtcagagtct	Protospacer
***.***********.********

92. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtcagagtcgctgtctgagtct	Protospacer
***************.** *****

93. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

94. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtcagagtcgctgtctgagtct	Protospacer
***************.** *****

95. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgaatcagagtcgctgtcagagtct	Protospacer
***.***********.********

96. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgaatcagagtcgctgtcagagtct	Protospacer
***.***********.********

97. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgcgtcagagtcgctatctgagtct	Protospacer
** *************** *****

98. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

99. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgaatcagagtcgctgtcagagtct	Protospacer
***.***********.********

100. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgaatcagagtcgctatctgagtct	Protospacer
***.************** *****

101. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgaatcagagtcgctgtcagagtct	Protospacer
***.***********.********

102. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgcgtcagagtcgctatctgagtct	Protospacer
** *************** *****

103. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

104. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtca	Protospacer
 ***** ********.*********

105. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtcagagtcactgtcagagtca	Protospacer
 ***********.**.*********

106. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

107. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

108. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

109. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

110. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.88

tgagtcagagtcgctatcagagtca	CRISPR spacer
tgagtctgagtcgctatctgagtct	Protospacer
****** *********** *****

111. spacer 2.28|3118211|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

actgtcagagtcagaatcgctgtcggaatcagagtcg	CRISPR spacer
actgtcagagtcagaatcgctgtcagaatccgagtca	Protospacer
************************.***** *****.

112. spacer 2.28|3118211|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

actgtcagagtcagaatcgctgtcggaatcagagtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcggaatccgagtcg	Protospacer
.***********.***************** ******

113. spacer 2.28|3118211|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

actgtcagagtcagaatcgctgtcggaatcagagtcg	CRISPR spacer
gctgtcagagtcggaatcgctgtcggaatccgagtcg	Protospacer
.***********.***************** ******

114. spacer 2.28|3118211|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

actgtcagagtcagaatcgctgtcggaatcagagtcg	CRISPR spacer
gctgtcagagtccgaatcgctgtcggaatcggagtcg	Protospacer
.*********** *****************.******

115. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcagagtcg	Protospacer
 **************.** ************

116. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcagagtcg	Protospacer
 **************.** ************

117. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctgtctgagtcagagtcg	Protospacer
 ***************** **.*********

118. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcagagtcg	Protospacer
 **************.** ************

119. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcagagtcg	Protospacer
 **************.** ************

120. spacer 2.29|3118271|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcg	Protospacer
.***** ***************** ******

121. spacer 2.29|3118271|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcg	Protospacer
.***** ***************** ******

122. spacer 2.29|3118271|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcg	Protospacer
.***** ***************** ******

123. spacer 2.29|3118271|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcg	Protospacer
.***** ***************** ******

124. spacer 2.29|3118271|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtcg	Protospacer
.***** ***************** ******

125. spacer 2.32|3118475|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

agagtcagaatcgctatcagagtcagaatcg	CRISPR spacer
ggagtcagagtcgctgtcagagtcagaatcg	Protospacer
.********.*****.***************

126. spacer 2.35|3118679|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagagtcagagtcgctgtcagaatcc	Protospacer
******.**.********************

127. spacer 2.35|3118679|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgagtcagagtcgctgtcagaatcc	Protospacer
****** **.********************

128. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtca	Protospacer
.***********.**************.***

129. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgagtcagagtcgctgtcagaatcc	Protospacer
****** **.********************

130. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagcatcc	Protospacer
*********.**************** ***

131. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtctgagtcgctgtcagaatcc	Protospacer
*********.** *****************

132. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcggagtcgctgtcagaatcc	Protospacer
******.*****.*****************

133. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagcatcc	Protospacer
************ ************* ***

134. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtccgaatcg	Protospacer
*********.************** *****.

135. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatcggagtcgctgtcagaatcc	Protospacer
****** *****.*****************

136. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
******.********************.**

137. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
****** ********************.**

138. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
****** ********************.**

139. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
******.********************.**

140. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
****** ********************.**

141. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
****** ********************.**

142. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
******.********************.**

143. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
****** ********************.**

144. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

145. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
****** ***** *****************

146. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

147. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcc	Protospacer
************ *********** *****

148. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
****** ***** *****************

149. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
****** ***** *****************

150. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcggagtcgctgtcagaatcc	Protospacer
*********.**.*****************

151. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
************ ***********.*****

152. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
************ ***********.*****

153. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

154. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
************ **************.**.

155. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
************ ***********.*****

156. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

157. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
****** ***** *****************

158. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
************ ***********.*****

159. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

160. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
************ **************.**.

161. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
************ **************.**.

162. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
************ ***********.*****

163. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

164. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
************ **************.**.

165. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
************ *********** *****.

166. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcactgtcagaatcc	Protospacer
************ *****.***********

167. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtccgagtcgctgtcagaatcc	Protospacer
*********.** *****************

168. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.919

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
agagtcactgtcagagtccgaatcgctgtcagagtca	Protospacer
 ***************** *****************

169. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.919

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
cgagtcactgtcagagtcagaatcgctgtcagaatcc	Protospacer
.********************************.**.

170. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcagaatccgagtcgctgtcagagtcc	Protospacer
******.***** *****************

171. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggagtcggagtcgctgtcagagtcc	Protospacer
*********.**.*****************

172. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggagtccgagtcgctgtcagagtcg	Protospacer
*********.** *****************.

173. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatccgaatcgctgtcagagtcc	Protospacer
************ **.**************

174. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggagtcggagtcgctgtcagagtcc	Protospacer
*********.**.*****************

175. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcggagtcgctgtcagagtca	Protospacer
.*****.*****.******************

176. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** *****************.

177. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** *****************.

178. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** *****************.

179. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** *****************.

180. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtccgagtcgctgtcagagtca	Protospacer
.********.** ******************

181. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtccgaatccgagtcgctgtcagagtcc	Protospacer
****** ***** *****************

182. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatccgagtcgctgtcggagtcg	Protospacer
************ ***********.*****.

183. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggagtccgagtcgctgtcagagtcg	Protospacer
*********.** *****************.

184. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcagaatccgagtcgctgtcagagtcc	Protospacer
******.***** *****************

185. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggagtccgagtcgctgtcagagtcc	Protospacer
*********.** *****************

186. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
.*****.***********************

187. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ***********************

188. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ***********************

189. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
.*****.***********************

190. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ***********************

191. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ***********************

192. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
.*****.***********************

193. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ***********************

194. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtca	Protospacer
.***** ***************** ******

195. spacer 2.40|3119009|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatcggaatcgctgtcagagtcc	Protospacer
************.**.**************

196. spacer 2.42|3119141|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
.********.********************.

197. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
.********.********************.

198. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatcggagtcgctgtcagaatcc	Protospacer
.***********.*****************

199. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
.********.********************.

200. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcagagtcggagtcagaatcc	Protospacer
*******************  *********

201. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggagtccgagtcgctgtcagaatcc	Protospacer
*********.** *****************

202. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagagtca	Protospacer
.********.*****************.***

203. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtccgagtcagagtcgctgtcagaatcg	Protospacer
****** **.********************.

204. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgaatcgctgtcagaatcc	Protospacer
************ **.**************

205. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgaatca	Protospacer
.***** ***************** ******

206. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgagtcgctgtcagagtcc	Protospacer
************ **************.**

207. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgagtcgctgtccgaatcc	Protospacer
************ *********** *****

208. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcc	Protospacer
************.**************.**

209. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcg	Protospacer
************.**************.**.

210. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
***.******** ***********.

211. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
***.** *****************.

212. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
***.** *****************.

213. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcc	Protospacer
***.** *****************

214. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcc	Protospacer
***.** *****************

215. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagaatcgctgtcg	Protospacer
***.***********.********.

216. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcc	Protospacer
***.******** ***********

217. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcc	Protospacer
***.** *****************

218. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtcagaatcgctgtca	Protospacer
.**.***********.*********

219. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
***.** *****************.

220. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcggagtcagagtcgctgtcc	Protospacer
***.**.*****************

221. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
***.******** ***********.

222. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtccgagtcagagtcgctgtca	Protospacer
.**.** ******************

223. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcactgtcg	Protospacer
***.**************.*****.

224. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagaatcgctgtcc	Protospacer
***.***********.********

225. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtccgagtcagagtcgctgtcg	Protospacer
***.** *****************.

226. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.**.******** ************

227. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
***.******** ***********.

228. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.**.******** ************

229. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcc	Protospacer
***.******** ***********

230. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcc	Protospacer
***.******** ***********

231. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
***.******** ***********.

232. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.**.******** ************

233. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.**.******** ************

234. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
***.******** ***********.

235. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtct	Protospacer
***.******** ***********

236. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtcagagtcactgtca	Protospacer
.**.**************.******

237. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtcagagtcactgtcg	Protospacer
***.**************.*****.

238. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagagtccgagtcgctgtcg	Protospacer
***.******** ***********.

239. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtca	Protospacer
.**.******** ************

240. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

241. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

242. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

243. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgagtcagagtcgctatcg	Protospacer
****** **************.**.

244. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtctgagtcagagtcgctgtct	Protospacer
***.** *****************

245. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

246. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtctgagtcagagtcgctgtct	Protospacer
***.** *****************

247. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

248. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgagtcagagtcgctatcg	Protospacer
****** **************.**.

249. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtctgagtcagagtcgctgtct	Protospacer
***.** *****************

250. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

251. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagaatcagagtcgctgtct	Protospacer
***.*****.**************

252. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

253. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

254. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

255. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtct	Protospacer
****** **.**************

256. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

257. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

258. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctgtcagaatcagagtcgctgtct	Protospacer
***.*****.**************

259. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

260. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

261. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

262. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtcg	Protospacer
****** **.**************.

263. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtct	Protospacer
****** **.**************

264. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgaatcagagtcgctgtct	Protospacer
****** **.**************

265. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgagtctgagtcgctgtct	Protospacer
****** ***** ***********

266. spacer 2.44|3119267|25|CP033535|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

gctatcagagtcagagtcgctgtca	CRISPR spacer
gctatctgagtctgagtcgctgtct	Protospacer
****** ***** ***********

267. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatca	Protospacer
.**************.******** *****.

268. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatca	Protospacer
.**************.******** *****.

269. spacer 2.1|3115894|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

ggaatcagagtcgctatcagagtcagaatcg	CRISPR spacer
agaatcagagtcgctgtcagagtctgaatca	Protospacer
.**************.******** *****.

270. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtccgagtcgctgtcagagtcagagtca	Protospacer
.***** ***************** *****.

271. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
ggagtccgagtcgctgtcagagtcggagtca	Protospacer
.***** ***************** *****.

272. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
actgtcggagtcgctgtcagagtccgagtcg	Protospacer
*  ***.*****************.******

273. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtcagagtcgctgtctgagtctgaatca	Protospacer
 ***************** ********.**.

274. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgagtctgagtcgctgtctgagtctgagtca	Protospacer
 ***** *********** ***********.

275. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcagagtcgctgtcagaatcg	Protospacer
 **************.*****.**.

276. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

277. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtcggagtcg	Protospacer
.**************.**.*****.

278. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtccgagtcc	Protospacer
.**************.** *****

279. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcggagtcgctgtcagagtcc	Protospacer
 *****.********.********

280. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtcagaatcc	Protospacer
.**************.*****.**

281. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcggagtcgctgtcagagtcc	Protospacer
.*****.********.********

282. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtcggagtct	Protospacer
.**************.**.*****

283. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcagagtcgctgtcagaatcg	Protospacer
 **************.*****.**.

284. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtcagagtcgctgtcggagtcc	Protospacer
 **************.**.*****

285. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtcg	Protospacer
 ***** ********.********.

286. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcggagtcgctgtcagagtcc	Protospacer
 *****.********.********

287. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtcagaatcg	Protospacer
.**************.*****.**.

288. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcagagtcgctgtccgagtcg	Protospacer
 **************.** *****.

289. spacer 2.26|3118091|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtcggagtct	Protospacer
.**************.**.*****

290. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agaatcagagtcgctgtcagagtct	Protospacer
 **.***********.********

291. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agaatcagagtcgctgtcagagtct	Protospacer
 **.***********.********

292. spacer 2.26|3118091|25|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agaatcagagtcgctgtcagagtct	Protospacer
 **.***********.********

293. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtcagagtcgctgtcagaatcc	Protospacer
 **************.*****.**

294. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

295. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

296. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

297. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcg	Protospacer
 ***** ********.********.

298. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtcagagtcactgtcagagtcc	Protospacer
 ***********.**.********

299. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcg	Protospacer
 ***** ********.********.

300. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

301. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtcg	Protospacer
 ***** ********.********.

302. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtcg	Protospacer
 ***** ********.********.

303. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtcg	Protospacer
 ***** ********.********.

304. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtcagagtcactgtcagagtcc	Protospacer
 ***********.**.********

305. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

306. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

307. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

308. spacer 2.26|3118091|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtccgagtcgctgtcagagtcc	Protospacer
 ***** ********.********

309. spacer 2.26|3118091|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcagagtcgctgtcagaatcg	Protospacer
 **************.*****.**.

310. spacer 2.26|3118091|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
ggagtcggagtcgctgtcagagtcc	Protospacer
 *****.********.********

311. spacer 2.26|3118091|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
agagtcagagtcgctgtcagaatcc	Protospacer
 **************.*****.**

312. spacer 2.26|3118091|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

tgagtcagagtcgctatcagagtca	CRISPR spacer
cgagtcagagtcgctgtcagaatcc	Protospacer
.**************.*****.**

313. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcagagtct	Protospacer
 **************.** ***********

314. spacer 2.29|3118271|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
cgagtcagagtcgctgtcggaatccgagtca	Protospacer
 **.******************** *****.

315. spacer 2.29|3118271|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
ggaatccgagtcgctgtcggaatccgagtca	Protospacer
.***** ***************** *****.

316. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcagagtcggagtcagaatcc	Protospacer
.******************  *********

317. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggagtccgagtcgctgtcagaatcc	Protospacer
.********.** *****************

318. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtccgagtcagagtcgctgtcagaatcg	Protospacer
.***** **.********************.

319. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgaatcgctgtcagaatcc	Protospacer
.*********** **.**************

320. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgagtcgctgtcagagtcc	Protospacer
.*********** **************.**

321. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgagtcgctgtccgaatcc	Protospacer
.*********** *********** *****

322. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcc	Protospacer
.***********.**************.**

323. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatcggagtcgctgtcagagtcg	Protospacer
.***********.**************.**.

324. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
cgagtcgctgtcagagtccgaatcgctgtcagagtca	Protospacer
.*****.*********** *****************

325. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
cgagtcactgtcagagtccgagtcgctgtcagagtcg	Protospacer
.***************** **.**************

326. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
agagtcactgtcagagtccgaatcgctgtcagaatcc	Protospacer
 ***************** **************.**.

327. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggagtcactgtcggagtccgaatcgctgtcagagtca	Protospacer
 ***********.***** *****************

328. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
agagtcactgtcagagtcagagtcactgtcagagtcc	Protospacer
 ********************.**.***********.

329. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
agagtcactgtcggagtccgaatcgctgtcagagtcc	Protospacer
 ***********.***** *****************.

330. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggagtcactgtcagagtccgaatcgctgtccgagtca	Protospacer
 ***************** *********** *****

331. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
cgagtcactgtcagaatccgaatcgctgtcagagtcc	Protospacer
.**************.** *****************.

332. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggagtcactgtcagagtcggaatcgctgtcggagtcc	Protospacer
 *****************.***********.*****.

333. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.892

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggagtcgctgtcagagtcagaatcgctgtccgagtcg	Protospacer
 *****.*********************** *****

334. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
.********.*****************.**.

335. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

336. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatcggagtcgctgtcagaatcc	Protospacer
.***********.**************.**

337. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcactgtcagagtcc	Protospacer
.*********** *****.***********

338. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
.********.*****************.**.

339. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcg	Protospacer
.*****.***** *****************.

340. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggagtcg	Protospacer
.*********** ***********.*****.

341. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggagtcg	Protospacer
.*********** ***********.*****.

342. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcggagtcgctgtcagagtcc	Protospacer
.*****.*****.*****************

343. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

344. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

345. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagagtcc	Protospacer
.***** ***** *****************

346. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcactgtcagagtcc	Protospacer
.*********** *****.***********

347. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtccgaatcagagtcactgtcagagtcc	Protospacer
.***** ***********.***********

348. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

349. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

350. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcg	Protospacer
.*****.***** *****************.

351. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

352. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

353. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatccgagtcgctgtcagagtcc	Protospacer
.*****.***** *****************

354. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtccgagtcgctgtcagagtcg	Protospacer
.********.** *****************.

355. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtccgagtcgctgtcagagtcg	Protospacer
.********.** *****************.

356. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggagtcc	Protospacer
.*********** ***********.*****

357. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggagtcc	Protospacer
.*********** ***********.*****

358. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatcggagtcgctgtccgagtcc	Protospacer
.***********.*********** *****

359. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

360. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

361. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

362. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

363. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

364. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

365. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcagagtcgctgtctgagtct	Protospacer
.*****.***************** *****

366. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

367. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

368. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

369. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagaatcagagtcgctgtctgagtct	Protospacer
.*****.***************** *****

370. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtctgagtct	Protospacer
.***** ***************** *****

371. spacer 2.40|3119009|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagaatcg	Protospacer
.********.*****************.**.

372. spacer 2.40|3119009|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcggagtcgctgtcagagtcc	Protospacer
.********.**.*****************

373. spacer 2.42|3119141|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagagtcagagtcgctgtcagaatcc	Protospacer
.*****.**.********************

374. spacer 2.42|3119141|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgagtcagagtcgctgtcagaatcc	Protospacer
.***** **.********************

375. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgagtcagagtcgctgtcagaatcc	Protospacer
.***** **.********************

376. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagcatcc	Protospacer
.********.**************** ***

377. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtctgagtcgctgtcagaatcc	Protospacer
.********.** *****************

378. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcggagtcgctgtcagaatcc	Protospacer
.*****.*****.*****************

379. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagcatcc	Protospacer
.*********** ************* ***

380. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcagagtcgctgtccgaatcg	Protospacer
.********.************** *****.

381. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatcggagtcgctgtcagaatcc	Protospacer
.***** *****.*****************

382. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
.*****.********************.**

383. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ********************.**

384. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ********************.**

385. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
.*****.********************.**

386. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ********************.**

387. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ********************.**

388. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcagaatcagagtcgctgtcagagtct	Protospacer
.*****.********************.**

389. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcagagtct	Protospacer
.***** ********************.**

390. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

391. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
.***** ***** *****************

392. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

393. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcc	Protospacer
.*********** *********** *****

394. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
.***** ***** *****************

395. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
.***** ***** *****************

396. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtcggagtcgctgtcagaatcc	Protospacer
.********.**.*****************

397. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
.*********** ***********.*****

398. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
.*********** ***********.*****

399. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

400. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** **************.**.

401. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
.*********** ***********.*****

402. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

403. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtccgaatccgagtcgctgtcagaatcc	Protospacer
.***** ***** *****************

404. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
.*********** ***********.*****

405. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

406. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** **************.**.

407. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** **************.**.

408. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcggaatcc	Protospacer
.*********** ***********.*****

409. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

410. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagagtcg	Protospacer
.*********** **************.**.

411. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcgctgtccgaatcg	Protospacer
.*********** *********** *****.

412. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggaatccgagtcactgtcagaatcc	Protospacer
.*********** *****.***********

413. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtcggagtccgagtcgctgtcagaatcc	Protospacer
.********.** *****************

414. spacer 2.44|3119267|25|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
ggaatcagagtccgagtcgctgtcg	Protospacer
*  ********* ***********.

415. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
ggaatcagagtccgagtcgctgtcg	Protospacer
*  ********* ***********.

416. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtcggagtcgctgtcc	Protospacer
.**.********.***********

417. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.**.******** ***********.

418. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actatcagagtccgaatcgctgtcc	Protospacer
.*********** **.********

419. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.**.******** ***********.

420. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
agagtcagagtcagagtcgctgtca	Protospacer
.  .*********************

421. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.**.******** ***********.

422. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.**.******** ***********.

423. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtcg	Protospacer
.**.******** ***********.

424. spacer 2.44|3119267|25|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gctatcagagtcagagtcgctgtca	CRISPR spacer
actgtcagagtccgagtcgctgtcc	Protospacer
.**.******** ***********

425. spacer 2.24|3117977|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtctgcatcc	Protospacer
 *****************.******* .**

426. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgcgtcagagtcgctatctgagtctgagtct	Protospacer
 * ************.** ***********

427. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgcgtcagagtcgctatctgagtctgagtct	Protospacer
 * ************.** ***********

428. spacer 2.29|3118271|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
agaatcggagtcgctgtcggaatctgcatca	Protospacer
******.***************** * .**.

429. spacer 2.29|3118271|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.839

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
agaatcggagtcgctgtcggaatctgcatca	Protospacer
******.***************** * .**.

430. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.839

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctatct	Protospacer
****** *****************.  ***

431. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.865

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggagtcactgtcagagtccgaatcgctgtcagcatcc	Protospacer
 ***************** ************* .**.

432. spacer 2.38|3118877|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

gctatcagagtcagaatcgttgtcgctgtcg	CRISPR spacer
gctgtcagagtcagaatcgctgtcggaatcg	Protospacer
***.***************.*****  .***

433. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcagagtcgctgtcagcatcc	Protospacer
.********.**************** .**

434. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggaatccgagtcgctgtcagcatcc	Protospacer
.*********** ************* .**

435. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
agagtcggaatccgagtcgctgtcggaatcc	Protospacer
*  ********* ***********.*****

436. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
agagtcagagtcagagtcgctgtcagaatcc	Protospacer
*  ***.**.********************

437. spacer 2.44|3119267|25|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.8

gctatcagagtcagagtcgctgtca	CRISPR spacer
cgaatcggagtcagagtcgctgtcc	Protospacer
   ***.*****************

438. spacer 2.20|3117634|50|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.88

-agagtctggagtcactgtcagagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
cggaatcc-gagtcactgtcagagtccgagtcgctgtcggagtctgagtcg	Protospacer
 .**.**. ***************** ***********.************

439. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
agagtccgaatcgctgtcagagtcactgtca	Protospacer
****** **.**************   ***.

440. spacer 2.24|3117977|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
tgaatcgctgtcgctgtctgagtctgagtcg	Protospacer
 **.**.  ********* ************

441. spacer 2.32|3118475|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

agagtcagaatcgctatcagagtcagaatcg	CRISPR spacer
agagtccgaatcgctgtcagagtcactgtca	Protospacer
****** ********.*********  .**.

442. spacer 2.32|3118475|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

agagtcagaatcgctatcagagtcagaatcg	CRISPR spacer
ggagtccgaatcgctgtcagagtcactgtcg	Protospacer
.***** ********.*********  .***

443. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
agagtcggaatccgagtcgctgtcggaatcc	Protospacer
.  ********* ***********.*****

444. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctgtct	Protospacer
****** *****************.  .**

445. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctgtct	Protospacer
****** *****************.  .**

446. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctatct	Protospacer
****** **************.**.  ***

447. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtca	Protospacer
***.** *****************.  .***

448. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctatct	Protospacer
****** **************.**.  ***

449. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
agagtcagagtcagagtcgctgtcagaatcc	Protospacer
.  ***.**.********************

450. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.838

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
actgtcactgtcggagtccgaatcgctgtcagagtcc	Protospacer
   *********.***** *****************.

451. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcggagtcggagtcgctgtcagcatcc	Protospacer
.********.**.************* .**

452. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtcagagtcagagtcgctgtcagcatcc	Protospacer
.*****.**.**************** .**

453. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtcggaatccgaatcgctgtcgctgtcg	Protospacer
************ **.********.  ***.

454. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctgtct	Protospacer
.***** *****************.  ***

455. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctgtct	Protospacer
.***** *****************.  ***

456. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctatct	Protospacer
.***** *****************.  ***

457. spacer 2.42|3119141|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtccgaatccgagtcgctgtcgctatcc	Protospacer
****** ***** ***********.  ***

458. spacer 2.24|3117977|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
gctatccgagtcgctgtcagagtcggagtca	Protospacer
.  .** ***************** *****.

459. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcgctatcg	Protospacer
 **************.** *****.  .***

460. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcgctatcg	Protospacer
 **************.** *****.  .***

461. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcgctatcg	Protospacer
 **************.** *****.  .***

462. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcgctatcg	Protospacer
 **************.** *****.  .***

463. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcgctatcg	Protospacer
 **************.** *****.  .***

464. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagagtcgctatctgaatcgctatcg	Protospacer
 **************.** *****.  .***

465. spacer 2.29|3118271|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
cgagtcagagtcgctgtcggagtctgcatcc	Protospacer
 **.*****************.** * .**

466. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

467. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

468. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

469. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

470. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

471. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

472. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

473. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

474. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

475. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

476. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctgtct	Protospacer
****** **************.**.  .**

477. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

478. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

479. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

480. spacer 2.35|3118679|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
***.** *****************.  .**

481. spacer 2.35|3118679|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtccgaatccgagtcgctgtcgctatcc	Protospacer
.***** ***** ***********.  ***

482. spacer 2.38|3118877|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

gctatcagagtcagaatcgttgtcgctgtcg	CRISPR spacer
actatcagagtccgaatcgctgtccgagtca	Protospacer
.*********** ******.****   ***.

483. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
cgaatcggagtcagagtcgctgtccgagtcg	Protospacer
   .*****.************** *****.

484. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
actgtccgaatccgagtcgctgtcgctatcc	Protospacer
****** ***** ***********.  .**

485. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctatct	Protospacer
.***** *****************.  .**

486. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

487. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

488. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

489. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

490. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

491. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

492. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

493. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

494. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

495. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

496. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctgtct	Protospacer
.***** **************.**.  ***

497. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

498. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

499. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

500. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  ***

501. spacer 2.42|3119141|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgaatcgctgtcgctgtcg	Protospacer
************ **.********.  .**.

502. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctgtct	Protospacer
.***** *****************.  .**

503. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctgtcgctgtct	Protospacer
.***** *****************.  .**

504. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctatct	Protospacer
.***** **************.**.  ***

505. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtca	Protospacer
.**.** *****************.  .***

506. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctatct	Protospacer
.***** **************.**.  ***

507. spacer 2.24|3117977|31|CP033535|CRT matches to MK448814 (Streptococcus phage Javan583, complete genome) position: , mismatch: 8, identity: 0.742

agagtcagagtcgctgtcagagtctgagtcg	CRISPR spacer
gcattttgagtcgctgttacagtctgagtca	Protospacer
. * *. **********.* **********.

508. spacer 2.28|3118211|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.784

actgtcagagtcagaatcgctgtcggaatcagagtcg	CRISPR spacer
ggagtcgctgtccgaatcactgtcggaatcagagtcg	Protospacer
.  ***.  *** *****.******************

509. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP030188 (Salmonella enterica strain SA20094620 plasmid pSA20094620.3, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

510. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_LT985263 (Escherichia coli strain 511 plasmid RCS54_p, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

511. spacer 2.29|3118271|31|CP033535|CRT matches to AF083977 (Bacteriophage Mu, complete genome) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

512. spacer 2.29|3118271|31|CP033535|CRT matches to AF466696 (Enterobacteria phage Mu invertible G-segment, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

513. spacer 2.29|3118271|31|CP033535|CRT matches to NC_000929 (Enterobacteria phage Mu, complete genome) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

514. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_KX880944 (Escherichia coli strain pMCR-1-P3 plasmid pMCR-1-P3, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

515. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP034790 (Escherichia coli strain ECCNB20-2 plasmid pTB423, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

516. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_CP019054 (Escherichia coli strain CRE1540 plasmid p1540-3, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

517. spacer 2.29|3118271|31|CP033535|CRT matches to NZ_MG196293 (Escherichia coli strain SDX5C133 plasmid pHNSD133T1, complete sequence) position: , mismatch: 8, identity: 0.742

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
tgaatcagtgtcgctgtcggcatcattttta	Protospacer
 ******* *********** ****   *..

518. spacer 2.32|3118475|31|CP033535|CRT matches to MH319741 (Marine virus AG-345-E15 Ga0172270_11 genomic sequence) position: , mismatch: 8, identity: 0.742

agagtcagaatcgctatcagagtcagaatcg	CRISPR spacer
caaaggagcatcgctatcagagtcagaaagg	Protospacer
 .*.  ** *******************  *

519. spacer 2.35|3118679|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
actgtcggaatccgaatcgctgtcgctgtcg	Protospacer
.*********** **.********.  .**.

520. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.784

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggaatcactgtcagagtccgaatcgctgtcgctatcc	Protospacer
 **.************** ***********.  .**.

521. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.784

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
ggaatcactgtcagagtccgaatcgctgtcgctatcc	Protospacer
 **.************** ***********.  .**.

522. spacer 2.37|3118817|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.784

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
agagtcactgtcggcgtcagaatcgctgtcgctatcc	Protospacer
 ***********.* ***************.  .**.

523. spacer 2.37|3118817|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.784

tgagtcactgtcagagtcagaatcgctgtcagagtct	CRISPR spacer
actgtcgctgtcagagtcagagtcgctgtcagcatcc	Protospacer
   ***.**************.********** .**.

524. spacer 2.38|3118877|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

gctatcagagtcagaatcgttgtcgctgtcg	CRISPR spacer
actgtcagagtcagaatcgctgtcagaatcc	Protospacer
.**.***************.****.  .**

525. spacer 2.38|3118877|31|CP033535|CRT matches to AP013523 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S37-C8) position: , mismatch: 8, identity: 0.742

gctatcagagtcagaatcgttgtcgctgtcg	CRISPR spacer
gctatcagagtctgcatcgttgttcgttcca	Protospacer
************ * ********.  * .*.

526. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctatct	Protospacer
.***** **************.**.  .**

527. spacer 2.40|3119009|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctatct	Protospacer
.***** **************.**.  .**

528. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

529. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

530. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

531. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

532. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

533. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

534. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

535. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

536. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

537. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

538. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctgtctgaatcagagtcgctatcgctgtct	Protospacer
.***** **************.**.  .**

539. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

540. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

541. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

542. spacer 2.42|3119141|31|CP033535|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
gctatctgaatcagagtcgctgtcgctgtct	Protospacer
.**.** *****************.  .**

543. spacer 2.42|3119141|31|CP033535|CRT matches to NC_018859 (Escherichia phage ECBP2, complete genome) position: , mismatch: 8, identity: 0.742

actgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
atccacttcatcagcgtcgctgtcagaatca	Protospacer
*..  *   ***** ****************

544. spacer 2.2|3115948|37|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.757

agagtctgagtcactgtcggaatcagagtcactgtcg	CRISPR spacer
gctgtccgaatcactgtcggaatcagagtcggagtca	Protospacer
.  ***.**.********************.  ***.

545. spacer 2.29|3118271|31|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.71

agaatcagagtcgctgtcggaatcagagtcg	CRISPR spacer
------cgaatcgctgtcggagtcagagtcg	Protospacer
       **.***********.*********

546. spacer 2.35|3118679|31|CP033535|CRT matches to NC_018859 (Escherichia phage ECBP2, complete genome) position: , mismatch: 9, identity: 0.71

gctgtcggaatcagagtcgctgtcagaatca	CRISPR spacer
atccacttcatcagcgtcgctgtcagaatca	Protospacer
...  *   ***** ****************

547. spacer 2.40|3119009|31|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.71

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
ctcaacagaatccgagtcgctgtcggagtcc	Protospacer
 ... *.***** ***********.*****

548. spacer 2.27|3118139|49|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 10, identity: 0.796

agaatctgagtcactgtcagagtcagagtcgctgtcgctatcagaatca	CRISPR spacer
agaatccgagtcactgtcagagtcggagtcgctgtccgagtcactgtcg	Protospacer
******.*****************.***********   .***  .**.

549. spacer 2.40|3119009|31|CP033535|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 10, identity: 0.677

actgtcggaatcagagtcgctgtcagagtca	CRISPR spacer
------agaatcggagtcactgtcagagtcg	Protospacer
      .*****.*****.***********.

550. spacer 2.46|3119405|37|CP033535|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.73

actgtcggaatcagagtcactgtcgctgtcagaatca	CRISPR spacer
cgaatcgctgtcagagtcactgtcggcgtcagaatcg	Protospacer
   .***  .*************** .*********.

551. spacer 2.46|3119405|37|CP033535|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 10, identity: 0.73

actgtcggaatcagagtcactgtcgctgtcagaatca	CRISPR spacer
cgaatcgctgtcagagtcagagtcgctgtcagaatcc	Protospacer
   .***  .*********  ***************

552. spacer 3.1|3466348|54|CP033535|CRISPRCasFinder matches to NC_003315 (Haemophilus phage HP2, complete genome) position: , mismatch: 11, identity: 0.796

cttatctgttttga----acctatttgggtcgttagctcagttggtagagcagcggac	CRISPR spacer
----tttactttaaaatcatctaattgggtcgttagctcagtcggtagagcagcggac	Protospacer
    *.*..***.*    *.*** ******************.***************

553. spacer 3.1|3466348|54|CP033535|CRISPRCasFinder matches to AY027935 (Haemophilus influenzae phage HP2, complete genome) position: , mismatch: 11, identity: 0.796

cttatctgttttga----acctatttgggtcgttagctcagttggtagagcagcggac	CRISPR spacer
----tttactttaaaatcatctaattgggtcgttagctcagtcggtagagcagcggac	Protospacer
    *.*..***.*    *.*** ******************.***************

554. spacer 3.1|3466348|54|CP033535|CRISPRCasFinder matches to Z71579 (Bacteriophage S2 type A 5.6 kb DNA fragment) position: , mismatch: 12, identity: 0.778

cttatctgttttga----acctatttgggtcgttagctcagttggtagagcagcggac	CRISPR spacer
----ttcactttaaaatcatctaattgggtcgttagctcagtcggtagagcagcggac	Protospacer
    *....***.*    *.*** ******************.***************

555. spacer 3.1|3466348|54|CP033535|CRISPRCasFinder matches to U24159 (Bacteriophage HP1 strain HP1c1, complete genome) position: , mismatch: 12, identity: 0.778

cttatctgttttga----acctatttgggtcgttagctcagttggtagagcagcggac	CRISPR spacer
----ttcactttaaaatcatctaattgggtcgttagctcagtcggtagagcagcggac	Protospacer
    *....***.*    *.*** ******************.***************

556. spacer 3.1|3466348|54|CP033535|CRISPRCasFinder matches to NC_001697 (Haemophilus phage HP1, complete genome) position: , mismatch: 12, identity: 0.778

cttatctgttttga----acctatttgggtcgttagctcagttggtagagcagcggac	CRISPR spacer
----ttcactttaaaatcatctaattgggtcgttagctcagtcggtagagcagcggac	Protospacer
    *....***.*    *.*** ******************.***************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1232599 : 1244113

Acinetobacter_phage(66.67%)

integrase

attL 1211890:1211906|attR 1259001:1259017

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1211890:1211906	attL	NA	NA	NA	NA
AZB96415.1\|1232599_1233586_+\|integrase	site-specific integrase	A0A1B1P9F9	Acinetobacter_phage	2.9e-183	97.9
AZB96416.1\|1233582_1233852_-	hypothetical protein	A0A1B1P9G0	Acinetobacter_phage	4.7e-48	100.0
AZB96417.1\|1233853_1234189_-	hypothetical protein	A0A0P0HSE1	Acinetobacter_phage	4.6e-32	59.1
AZB96418.1\|1234185_1234488_-	hypothetical protein	NA	NA	NA	NA
AZB96419.1\|1234484_1234859_-	hypothetical protein	A0A1B1P9F6	Acinetobacter_phage	6.4e-35	94.7
AZB96420.1\|1234855_1235515_-	hypothetical protein	A0A2H4JDC0	uncultured_Caudovirales_phage	1.3e-78	58.2
AZB96421.1\|1235511_1236450_-	hypothetical protein	A0A2H4JAZ0	uncultured_Caudovirales_phage	5.8e-141	82.3
AZB96422.1\|1236459_1236660_-	DUF551 domain-containing protein	NA	NA	NA	NA
AZB96423.1\|1236659_1236926_-	hypothetical protein	NA	NA	NA	NA
AZB96424.1\|1236945_1237323_-	hypothetical protein	NA	NA	NA	NA
AZB96425.1\|1237521_1238025_-	hypothetical protein	A0A0P0I896	Acinetobacter_phage	1.2e-65	82.6
AZB96426.1\|1239075_1239369_-	hypothetical protein	A0A0D4DCB9	Acinetobacter_phage	1.0e-35	76.3
AZB96427.1\|1239754_1240453_-	peptidase	A0A2H4JAJ5	uncultured_Caudovirales_phage	5.6e-32	41.5
AZB96428.1\|1240569_1240818_+	hypothetical protein	A0A0M3LQ90	Mannheimia_phage	2.1e-05	39.7
AZB96429.1\|1240828_1241203_+	XRE family transcriptional regulator	A0A0N7IRF8	Acinetobacter_phage	2.3e-32	60.8
AZB96430.1\|1242706_1244113_+	DUF4055 domain-containing protein	A0A1B1P9C6	Acinetobacter_phage	3.5e-259	94.4
1259001:1259017	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1247172 : 1252157

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB96431.1\|1247172_1247358_+	hypothetical protein	A0A1B1P9F4	Acinetobacter_phage	3.9e-25	90.0
AZB96432.1\|1247414_1247801_+	hypothetical protein	A0A1B1P9F2	Acinetobacter_phage	9.5e-66	96.9
AZB96433.1\|1247804_1248197_+	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	1.5e-58	86.2
AZB96434.1\|1248196_1248487_+	hypothetical protein	NA	NA	NA	NA
AZB96435.1\|1248452_1248878_+	hypothetical protein	A0A1B1P9D5	Acinetobacter_phage	8.9e-33	54.3
AZB96436.1\|1249990_1250386_+	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	4.4e-34	55.3
AZB96437.1\|1251387_1251891_+	hypothetical protein	A0A1B1P9G4	Acinetobacter_phage	1.6e-73	95.8
AZB97610.1\|1251950_1252157_+	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	3.8e-29	91.2

DBSCAN-SWA_3

2587369 : 2600137

Acinetobacter_phage(93.75%)

terminase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB96988.1\|2587369_2587774_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
AZB96989.1\|2587866_2588049_-	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
AZB96990.1\|2588095_2588275_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	1.4e-11	61.5
AZB96991.1\|2588959_2589877_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	3.9e-166	97.7
AZB96992.1\|2591258_2591612_-	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	1.5e-57	94.0
AZB96993.1\|2591681_2592080_-	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	7.7e-71	97.7
AZB96994.1\|2592081_2592450_-	HK97 gp10 family phage protein	A0A0D4DBN1	Acinetobacter_phage	3.9e-53	84.4
AZB96995.1\|2592421_2592832_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	8.6e-49	71.9
AZB96996.1\|2593761_2594130_-	glutamate 5-kinase	A0A0P0I456	Acinetobacter_phage	7.2e-63	95.9
AZB96997.1\|2594116_2594509_-	hypothetical protein	A0A0P0IVQ3	Acinetobacter_phage	1.3e-51	82.4
AZB96998.1\|2595084_2596056_-\|coat	phage coat protein	A0A2H4JIE6	uncultured_Caudovirales_phage	4.4e-136	72.7
AZB96999.1\|2596751_2597993_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.2e-204	85.7
AZB97000.1\|2598002_2598518_-	DUF2280 domain-containing protein	A0A1B1P9C2	Acinetobacter_phage	3.2e-45	61.3
AZB97001.1\|2598576_2599116_-	hypothetical protein	J7I4N9	Acinetobacter_phage	1.6e-103	96.6
AZB97002.1\|2599187_2599622_-	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	1.4e-78	97.9
AZB97003.1\|2599681_2600137_-	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7

DBSCAN-SWA_4

2604094 : 2617938

Acinetobacter_phage(58.82%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB97008.1\|2604094_2604571_-	hypothetical protein	A0A2H4J548	uncultured_Caudovirales_phage	1.2e-25	40.3
AZB97009.1\|2604567_2604969_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	2.0e-66	96.2
AZB97010.1\|2605177_2605579_-	HNH endonuclease	A7XFH9	Enterobacteria_phage	8.4e-25	43.3
AZB97011.1\|2605575_2605983_-	hypothetical protein	A0A1B1P9I4	Acinetobacter_phage	2.5e-08	30.8
AZB97012.1\|2605979_2606729_-	hypothetical protein	A0A0N7IRF0	Acinetobacter_phage	2.0e-136	98.4
AZB97013.1\|2606721_2607672_-	DUF1376 domain-containing protein	A0A0P0I481	Acinetobacter_phage	3.1e-94	61.4
AZB97014.1\|2607668_2608715_-	site-specific DNA-methyltransferase	A0A1B0VM49	Pseudomonas_phage	2.3e-106	57.1
AZB97015.1\|2609306_2609483_-	hypothetical protein	NA	NA	NA	NA
AZB97016.1\|2609610_2610300_+	helix-turn-helix domain-containing protein	A0A2H4JAJ5	uncultured_Caudovirales_phage	7.6e-58	73.1
AZB97017.1\|2610360_2610591_+	hypothetical protein	NA	NA	NA	NA
AZB97018.1\|2610587_2611388_+	hypothetical protein	A0A0R6PIZ6	Moraxella_phage	9.8e-41	36.3
AZB97019.1\|2611586_2612027_+	hypothetical protein	A0A0N7IRE9	Acinetobacter_phage	1.6e-72	95.2
AZB97020.1\|2612029_2612353_+	hypothetical protein	A0A0P0IVW1	Acinetobacter_phage	9.4e-43	80.4
AZB97668.1\|2614656_2614902_+	hypothetical protein	A0A0P0IVN4	Acinetobacter_phage	1.5e-40	100.0
AZB97669.1\|2615060_2615312_+	hypothetical protein	A0A0P0I8H3	Acinetobacter_phage	5.4e-30	74.1
AZB97021.1\|2615308_2615518_+	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	3.1e-31	92.8
AZB97022.1\|2615514_2615730_+	hypothetical protein	I2GUB6	Acinetobacter_phage	3.8e-32	91.5
AZB97023.1\|2615731_2615962_+	hypothetical protein	A0A0R6PG25	Moraxella_phage	4.0e-11	55.9
AZB97024.1\|2617683_2617938_+	carbon storage regulator	A0A2I7RT00	Vibrio_phage	8.8e-12	66.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033537

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 5576

Sodalis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB97764.1\|665_1550_-	DUF3363 domain-containing protein	NA	NA	NA	NA
AZB97765.1\|3950_4202_-	hypothetical protein	NA	NA	NA	NA
AZB97766.1\|4898_5576_-	chromosome partitioning protein ParA	Q2A085	Sodalis_phage	3.3e-45	46.0

DBSCAN-SWA_2

20180 : 20462

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB97770.1\|20180_20462_+	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	5.7e-12	43.3

DBSCAN-SWA_3

23663 : 25127

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB97773.1\|23663_25127_+	Msr family ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	3.0e-160	59.0

DBSCAN-SWA_4

41654 : 44344

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZB97779.1\|41654_42296_+	DUF159 family protein	A0A218MNF5	uncultured_virus	4.9e-51	52.8
AZB97780.1\|42407_43034_+	LexA family transcriptional regulator	A0A2H4J538	uncultured_Caudovirales_phage	4.1e-26	41.6
AZB97781.1\|43048_44344_+	Y-family DNA polymerase	A0A2H4JBL5	uncultured_Caudovirales_phage	5.3e-129	51.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033535

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033537

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection