CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
CP033555	Acinetobacter nosocomialis strain 2014S01-097 plasmid p2014S01-097-5, complete sequence	0 crisprs	NA	0	0	0
CP033554	Acinetobacter nosocomialis strain 2014S01-097 plasmid p2014S01-097-4, complete sequence	0 crisprs	NA	0	0	0
CP033551	Acinetobacter nosocomialis strain 2014S01-097 plasmid p2014S01-097-1, complete sequence	0 crisprs	NA	0	0	0
CP033556	Acinetobacter nosocomialis strain 2014S01-097 plasmid p2014S01-097-6, complete sequence	0 crisprs	NA	0	0	0
CP033550	Acinetobacter nosocomialis strain 2014S01-097 chromosome, complete genome	2 crisprs	PD-DExK,DEDDh,csa3,WYL	2	6	4
CP033553	Acinetobacter nosocomialis strain 2014S01-097 plasmid p2014S01-097-3, complete sequence	0 crisprs	NA	0	0	0
CP033552	Acinetobacter nosocomialis strain 2014S01-097 plasmid p2014S01-097-2, complete sequence	0 crisprs	NA	0	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033550_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033550_1

101683-101826

Orphan

Consensus_repeat	Method
AGTAATAAAGTTTCATACTAAAC	PILER-CR

2 spacers

The CRISPR arrays of CP033550_1

>merge|CP033550|1|101683-101826|PILER-CR
AGTAATAAAGTTTCATACTAAGCCAGCTCTATCTAATTGATATTTATAAACTGTAAATAATTGAAGAAAAATAAAGTTTCATACTAAACATCATTTTTTCTTCAATTTCTACTACCAGTTGAGTAATAAAGTTTCATACTAAAA

>CP033550|1|1|101683-101826|PILER-CR
AGTAATAAAGTTTCATACTAAGC	CAGCTCTATCTAATTGATATTTATAAACTGTAAATAATTGAAG
AAAAATAAAGTTTCATACTAAAC	ATCATTTTTTCTTCAATTTCTACTACCAGTTG
AGTAATAAAGTTTCATACTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP033550.1\|AZC06937.1\|91760_92399_+\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319799
CP033550.1\|AZC05493.1\|128354_128798_-\|D-tyrosyl-tRNA(Tyr)-deacylase	unknown	unknown	gnl\|CDD\|235383
CP033550.1\|AZC05484.1\|92422_93232_+\|glutamate-racemase	unknown	unknown	gnl\|CDD\|234851
CP033550.1\|AZC05482.1\|84388_85927_+\|histidine-ammonia-lyase	unknown	unknown	gnl\|CDD\|236484
CP033550.1\|AZC05494.1\|128966_130181_+\|nicotinate-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|235406
CP033550.1\|AZC05488.1\|102644_103304_-\|hypothetical-protein	unknown	unknown	unknown
CP033550.1\|AZC05485.1\|93223_93421_-\|hypothetical-protein	unknown	unknown	unknown
CP033550.1\|AZC05483.1\|85991_87404_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182566
CP033550.1\|AZC06939.1\|130331_131180_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|225450
CP033550.1\|AZC05491.1\|121075_121525_-\|transcription-antitermination-factor-NusB	unknown	unknown	gnl\|CDD\|234686
CP033550.1\|AZC06936.1\|80975_81515_+\|HutD-family-protein	unknown	unknown	gnl\|CDD\|377578
CP033550.1\|AZC05487.1\|102429_102648_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP033550.1\|AZC05489.1\|103978_104143_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|214643
CP033550.1\|AZC05492.1\|121528_121999_-\|6,7-dimethyl-8-ribityllumazine-synthase	unknown	unknown	gnl\|CDD\|234606
CP033550.1\|AZC06938.1\|127246_127582_+\|hypothetical-protein	unknown	unknown	unknown
CP033550.1\|AZC05480.1\|77426_78692_+\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|223597
CP033550.1\|AZC05486.1\|101200_101494_+\|hypothetical-protein	unknown	unknown	unknown
CP033550.1\|AZC05479.1\|71134_71896_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
CP033550.1\|AZC05490.1\|120142_121060_-\|thiamine-phosphate-kinase	unknown	unknown	gnl\|CDD\|235583
CP033550.1\|AZC05481.1\|81652_82399_-\|IS5-like-element-ISAba31-family-transposase	unknown	unknown	gnl\|CDD\|379129

Protein	Function_ID	Function_description	E-value
CP033550.1\|AZC06937.1\|91760_92399_+\|HAD-family-hydrolase	gnl\|CDD\|319799	cd04303, HAD_PGPase, phosphoglycolate phosphatase, similar to Synechococcus elongates phosphoglycolate phosphatase PGP/CbbZ. Phosphoglycolate phosphatase catalyzes the dephosphorylation of phosphoglycolate; its activity requires divalent cations, especially Mg++. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	6.85625e-107
CP033550.1\|AZC05494.1\|128966_130181_+\|nicotinate-phosphoribosyltransferase	gnl\|CDD\|235406	PRK05321, PRK05321, nicotinate phosphoribosyltransferase; Provisional.	0
CP033550.1\|AZC05484.1\|92422_93232_+\|glutamate-racemase	gnl\|CDD\|234851	PRK00865, PRK00865, glutamate racemase; Provisional.	3.55993e-97
CP033550.1\|AZC05482.1\|84388_85927_+\|histidine-ammonia-lyase	gnl\|CDD\|236484	PRK09367, PRK09367, histidine ammonia-lyase; Provisional.	0
CP033550.1\|AZC05490.1\|120142_121060_-\|thiamine-phosphate-kinase	gnl\|CDD\|235583	PRK05731, PRK05731, thiamine monophosphate kinase; Provisional.	1.73491e-137
CP033550.1\|AZC05483.1\|85991_87404_+\|amino-acid-permease	gnl\|CDD\|182566	PRK10580, proY, putative proline-specific permease; Provisional.	0
CP033550.1\|AZC06939.1\|130331_131180_+\|sulfurtransferase	gnl\|CDD\|225450	COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism].	2.49227e-59
CP033550.1\|AZC05491.1\|121075_121525_-\|transcription-antitermination-factor-NusB	gnl\|CDD\|234686	PRK00202, nusB, transcription antitermination factor NusB.	3.16858e-52
CP033550.1\|AZC05489.1\|103978_104143_-\|ATP-binding-protein	gnl\|CDD\|214643	smart00387, HATPase_c, Histidine kinase-like ATPases. Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.	0.00220252
CP033550.1\|AZC05487.1\|102429_102648_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.70165e-14
CP033550.1\|AZC06936.1\|80975_81515_+\|HutD-family-protein	gnl\|CDD\|377578	pfam05962, HutD, HutD. HutD from Pseudomonas fluorescens SBW25 is a component of the histidine uptake and utilisation operon. HutD is operonic with the well characterized repressor protein HutC. Genetic analysis using transcriptional fusions (lacZ) and deletion mutants shows that hutD is necessary to maintain fitness in environments replete with histidine. Evidence outlined by Zhang & Rainey (2007) suggests that HutD functions as a governor that sets an upper bound on the level of hut operon transcription. The mechanistic basis is unknown, but in silico molecular docking studies based on the crystal structure of PA5104 (HutD from Pseudomonas aeruginosa) show that urocanate (the first breakdown product of histidine) docks with the active site of HutD.	7.04855e-48
CP033550.1\|AZC05492.1\|121528_121999_-\|6,7-dimethyl-8-ribityllumazine-synthase	gnl\|CDD\|234606	PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional.	1.01016e-78
CP033550.1\|AZC05480.1\|77426_78692_+\|GTP-binding-protein	gnl\|CDD\|223597	COG0523, COG0523, Putative GTPases (G3E family) [General function prediction only].	1.57503e-120
CP033550.1\|AZC05479.1\|71134_71896_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.92863e-36
CP033550.1\|AZC05493.1\|128354_128798_-\|D-tyrosyl-tRNA(Tyr)-deacylase	gnl\|CDD\|235383	PRK05273, PRK05273, D-tyrosyl-tRNA(Tyr) deacylase; Provisional.	5.73285e-89
CP033550.1\|AZC05481.1\|81652_82399_-\|IS5-like-element-ISAba31-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	6.1536e-22

>CP033550.1|AZC05486.1|101200_101494_+|hypothetical-protein
MKLHKFILILNLVVGAYSITNDDANAQQEFKRICLSGERMQASCDCICQQLAQMYSPQTVQRLKHTSLQSPVLPQDFAPNCLAAFNTATKLKWAKFA
>CP033550.1|AZC05485.1|93223_93421_-|hypothetical-protein
MLSSANIEHGIMLALIALVSIILLIIAGITALFRLKSKNKSETKDMIIISFALIGVTGLLFSCSG
>CP033550.1|AZC05484.1|92422_93232_+|glutamate-racemase
MNNNNNPIGMIDSGLGGLSLFKHIRQALPNEDIIYFADSKYVPYGDRESDWIVSRTTHLISNLVAQGKCKAIVIACNTMTAVAVETIRAQINVPLIAIEPAVKPAVGMTMSKHIAVLATATTVKGKNLKSLIETYAQDIKVSLVPCIGLAEKIETGKAHTAEVKDYLKNILAPLVEQKVDTIILGCTHYPFVSDTIQEIVGRDIQIIEPSEAVTAQLIRQLNQYHLSSESPNEGNHIIWTSSDPLEVADVTFSLLGKHLPVKSMSLLLT
>CP033550.1|AZC06937.1|91760_92399_+|HAD-family-hydrolase
MEKTLKQYQAIIFDLDGTLVDSFHFFLNVLNQLSAKYKFKTVSLHEVEYYKQLTPREIMKEMNVSRWKLPWIAKDFIRLMKERDEEIHLFEGMRDHLIELHKQGYTLAIITSNSKENCQNVLGEELCELFSHIDGGSSIFGKAKRIKRVLNILDVSKNHAIYVGDQTTDGEAAHKAGIDFAAVGWGYTSAEKLKTIQPKVVLTDLATMKEFF
>CP033550.1|AZC05483.1|85991_87404_+|amino-acid-permease
MSQNSTLQRGLNTRHIRFLALGSAIGTGLFYGSATAIKMAGPSVLLAYIVAGIAIYIVMRALGEMAVHNPVSGSFSHYASQYIGPLAGFTTGWTYVFEMVIVAIADVTAFGIYMGFWYPDVPRWIWILSLIMFLGAINLIHVKVFGELEFWLSIVKVSAIVAMILGGLGLMFYGFHVDHSNVVPGLQNLWIYDGFMPHGIAGLVACLSVVVFAFGGIEIIGLTAGESQDPKTTLPKAINAVPVRILLFYVLTIFVLMSIFPWNQIGSQGSPFVQIFENLGIKSAANILNIVVVTAAISAINSDVFGAGRMLYGMANRGQAPQVFKKLSRNGVPWMTVVVMAGVLLIGVVLNYLIPENVFVIIASIATFATVWVWLMILLSQVAMRRKLSTAEIKALDFPVFGWPYAPAFAIGFMVFILVMMGYFPDSRPAIYVGITWLALLTIAYRIWVKPEQSLGKESEPVQQNIEMES
>CP033550.1|AZC05482.1|84388_85927_+|histidine-ammonia-lyase
MELLIQPGKLTLADLRQAYLNPIKVKLDESASSAIDASVACVEKIVNEGRTAYGINTGFGLLASTKIAPEDLEKLQRSLVLSHAAGVGEALDDAMVRLIILLKANSLARGFSGIRRKVIDALLALINAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKASYKGEWLPAVEALKVAGLEPISLAAKEGLALLNGTQVSTAYALRGLFEAEDLFAAATVCGGLSVEAMLGSRAPFDARIHEVRGQRGQIDVAAAYRDLLTDSSEIAHSHEDCSKVQDPYSLRCQPQVMGACLTQIRQAAEVLEIEANAVSDNPLVFAEQGDVISGGNFHAEPVAMAADNLALAIAEIGSLSERRISMMMDRHMSQLPPFLVANGGVNSGFMIAQVTAAALASDNKALAHPASVDSLPTSANQEDHVSMAPNAGKRLWYMADNVRGILAVEWLGACQGLDFREGLKSSPKLEQARKILRDQVPYYSEDRFFAPDIEQASELLASGCLNKLLIPKLLPSLSEV
>CP033550.1|AZC05481.1|81652_82399_-|IS5-like-element-ISAba31-family-transposase
MPRTMLTDQHWQKLKVILRNLSIHHNSNLRNFIEAILYRIRTGCPWRDIPCCFGHSNSIFKRFNRWSSSGKFLRLFKLLASCPDMEWIFIDGSHVRAHQHSAGIANQSISKSVGGNSSKIHLIVDAHGNPIDFMITDGTTHDVKVAPDLISTLDLKETKVVCADKGYDSEPLREQIRKTGTKANIPKKTNSQSNNDHMDWYLYKIRHLVENMFCRLKQFRGIATRYDKLKRNYQSSVALACIFLWLPL
>CP033550.1|AZC06936.1|80975_81515_+|HutD-family-protein
MLWNNGAGFTLEIARSQGEADFDWRISMADVTTSGPFSFFPNKQRIISVLDGQGIVLHVDELPAKMLNQGDIFAFHGESQVQSELLEGAIRDLNLIYDPAKFHARFQWLNDAAEQAFISSADLIFIFNQGSETQVNVHDHSVQIAAHETLKIEKKSGVTSINFPKKQLKSCYVIELIQL
>CP033550.1|AZC05480.1|77426_78692_+|GTP-binding-protein
MISLNIIQRDQAMHTAIANSFAKLPVTVLSGFLGAGKTTLLNHILNNREGRRIAVIVNDMSEVNIDAALVREGGAELSRTDEKLVEMSNGCICCTLREDLLVEVRRLADEGRFDQLVIESTGISEPLPVAETFTFEDEDGNSLNEFARLDTMVTVVDAFNFLKDYSSVDSLQQRGESLGEQDERTVVDLLIDQIEFCDVIVLNKIDLIDQAQQDQLIAILKTLNPRARIEIAQFGKIALDKILNTQLFDFDEAAQAPGWLKELRGEHTPETEEYGISSFVYRARRPFHPERFYDLVQSEWPGVVRSKGFFWLAADPTLAYSWSQAGAMARHSLAGYWWAAVSEEDWPSDLNSIEQIKKNWDARTGDARQELVLIGMQMDEQALIQRLERCLLNDEEMALGPQAWQNWSNPFKQDDETMLIA
>CP033550.1|AZC05479.1|71134_71896_-|IclR-family-transcriptional-regulator
MWGVQSLEVGLSVLNALLEHNQPIILKDLSSKLEMHPAKVHRYLVSLIRMDYAKQLEDGQYALGDQAWRLGLNCIQHSDTLQLVQHLIYDLQSKIGCGIQISKWSPKGPVVVQSIESNHPISIVTKVGSIMPLVNSAAGRLFASYLPEHFIRPLLEAEWQKHQELGLNIAPHNWEAFLELKEKIRQQQMSAAKGDLLTGINAVGLPVFNSNQGIEFCIVALDSEMFLPVDPQSKIIETLKNEINLINQYIKSR
>CP033550.1|AZC05487.1|102429_102648_+|XRE-family-transcriptional-regulator
MFMSELTIQFGQLVRKYRKERNMSQEQLALLCNMDRSYLGRIERGEVNPTLEKIYDLANRLAIDPQKLLPKF
>CP033550.1|AZC05488.1|102644_103304_-|hypothetical-protein
MNNKYYLIYPDDPTVYFMNIILKNLKDHIEDGKITLITCDASNEGYVHSLNLIKQIPEHARVIFIGHSTPIMLYGGQNSCFNRKPLLNLSEMSIFKNIELFLISCFSEKLLKSSRPFRNYSKCLGFGLILSELSEVSAHSGMRKLDLNQNDVDIFKLHVSEIFARVLSFMVNNNASLEQAFNMFQIIANKKAYDIIIKDKNEKIAELLYYLVQESLLDN
>CP033550.1|AZC05489.1|103978_104143_-|ATP-binding-protein
MFDLGSRDIPPEEISGSGIGLFYSRQLLNEMNAEIMFLDNNYILSGACFEVTFK
>CP033550.1|AZC05490.1|120142_121060_-|thiamine-phosphate-kinase
MAEFSIIDQYFNRQSNSDVALGIGDDSALITPPPNQQLVICADTLVAGRHFPLETSPHAIGWKSVAVNLSDIAAMGAKPHSILLAISLPQVDHEWLKGFSQGIYDCCNQFGVALIGGDTTQGPHLTITVTAMGWIETGKAVLRSGAKVGDYVCVSGQVGDAAYGLQHLGHPLQQRLDYPTPRCQLGQELKGLASSMIDVSDGLAQDLGHILKASKVGARLVLEKLPVDPVLQQLEEQQRWQYALAGGDDYELCFTITPQNYEKLLQKQLDVKITMIGQIVEQTKLTFEHLGSDYPLQIHGYQHFA
>CP033550.1|AZC05491.1|121075_121525_-|transcription-antitermination-factor-NusB
MSQTLQAAYAAKRKARRFAVQGIYEWQMSHNPVHEIEARTRAENAMHKVDLSYYHELLTQVIAQHEDLDALLIPVLDREIDALDGVELATLRLGAYELRDHLEIPYRVVLDEAIELAKHFGGADSHKYINGVLDRLSSTLRSAEKQQAN
>CP033550.1|AZC05492.1|121528_121999_-|6,7-dimethyl-8-ribityllumazine-synthase
MAIRRIEGLLHLASEGRYAILVGRFNSFVVEHLLEGAIDTLKRHGVNEDNITVIHAPGAWELPIVAKKLATSNQFDAIIALGAVIRGSTPHFDFVAGECAKGLGVVALESSLPVINGVLTTDSIEQAIERSGTKAGNKGSEAALTAIEMVNLLKAI
>CP033550.1|AZC06938.1|127246_127582_+|hypothetical-protein
MVTANFAAIAGLSLIAVALVAVFFSPYRRWLGFMLAGMFFWGLLEVVRFGVQVTFEMPVTYSYLTALSLAMVMVTFILLREDKQAQKALANRQYIEHTPVYEDDQQQCSSR
>CP033550.1|AZC05493.1|128354_128798_-|D-tyrosyl-tRNA(Tyr)-deacylase
MRALIQRVLEAKVVVDGETTGEIQNGLLVFLGISRDDTLATGQKLIDKILKYRIFDDEQGKMGWNVSQANGGVLLVSQFTLMAQTQKGLRPDFGPAMPPSDAKALYEQLVEYTRSQFENVQTGIFAADMKVHLINDGPVTFNLEVEA
>CP033550.1|AZC05494.1|128966_130181_+|nicotinate-phosphoribosyltransferase
MSPIIHSLLDTDLYKFTMLQVVLHKFPQTHSVYHFRCRNLEDTVYPLVDILDDLNEQLDHLCNLKYKEDELQYLRKLRFIKSDFVDYLELFQLKRRFIQASIDNEGRLDIRIEGPMVQAMMFEIFVLAIVNELYFSRIKTDEVWAEGERRLQAKLELIQQYEKSQQPNDPPFLVSDFGTRRRYSFEWQKHVVAAFHKTVPNVFRGTSNVLLAKELNITPIGTMAHEFLQAFQALDVRLRDFQKAALETWVQEYRGDLGIALTDVVGMDAFLRDFDLYFAKLFDGLRHDSGDPYEWGDKAYAHYRKLKIDTKTKMLTFSDGLNLPKAWELHQYFKDRFQVSFGIGTNLTNDMGQTPLNIVLKLVECNGQSVAKISDSPGKTMTDNDTFLAYLRQVFQIEELDEAV
>CP033550.1|AZC06939.1|130331_131180_+|sulfurtransferase
MTLPDFKLDLLIEAEELVPYLGNEYIRIVDLSRASVYEQLHIPHAIHLQPKWLVAQHEEATGILPDEAGLQALIEKLNISPNHHVVVYDDEGGAWAGRLIWNLHCLGFTRTSLINGGIHAWLGAGLPTTAEVEELPRVNDLIQIDLSHAAQFRVNYEELRKQVEQESIQLWDCRTIDEYSGVRLAARRGGHIPNALHFEWSTALNRQNHLKLHPLERTRQRLEQLGFDLKQPVVVYCQSHHRSGLAYILARLLGWEAKAYDGAWSEWGNRLDSPIITGESPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033550_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033550_3

1957927-1958027

Orphan

Consensus_repeat	Method
TGCGAAGCTTCAGTCGCTTCTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033550_3

>merge|CP033550|3|1957927-1958027|CRISPRCasFinder
TGCGAAGCTTCAGTCGCTTCTCAGAACAAAGCGTTGCTTTGATTCACCCTCTTAACTCGAGCATAGTTCTCGTCTTCTTGCGAAGCTTTAGTCGCTTCTCA

>CP033550|3|1|1957927-1958027|CRISPRCasFinder
TGCGAAGCTTCAGTCGCTTCTCA	GAACAAAGCGTTGCTTTGATTCACCCTCTTAACTCGAGCATAGTTCTCGTCTTCT
TGCGAAGCTTTAGTCGCTTCTCA

Protein	Signature genes	Signature genes Name	Protein_function
CP033550.1\|AZC06147.1\|1962898_1963957_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP033550.1\|AZC06144.1\|1958272_1958593_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224172
CP033550.1\|AZC07002.1\|1930114_1930504_+\|hypothetical-protein	unknown	unknown	unknown
CP033550.1\|AZC06152.1\|1973489_1974719_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
CP033550.1\|AZC06146.1\|1958740_1959634_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|350353
CP033550.1\|AZC06138.1\|1947271_1948126_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
CP033550.1\|AZC06143.1\|1958046_1958241_-\|hypothetical-protein	unknown	unknown	unknown
CP033550.1\|AZC06149.1\|1964798_1966202_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
CP033550.1\|AZC06150.1\|1966212_1967739_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001
CP033550.1\|AZC06136.1\|1935944_1936841_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176148
CP033550.1\|AZC06135.1\|1931777_1932482_+\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
CP033550.1\|AZC06151.1\|1968770_1969733_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP033550.1\|AZC06142.1\|1951636_1952380_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
CP033550.1\|AZC06140.1\|1949609_1949855_-\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|224069
CP033550.1\|AZC06139.1\|1948160_1949534_-\|nitrate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270277
CP033550.1\|AZC07003.1\|1939655_1941074_+\|aspartate-ammonia-lyase	unknown	unknown	gnl\|CDD\|237031
CP033550.1\|AZC06141.1\|1949883_1951608_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|181346
CP033550.1\|AZC06148.1\|1963986_1964772_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
CP033550.1\|AZC06137.1\|1945436_1946435_-\|HEAT-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|224331
CP033550.1\|AZC06145.1\|1958564_1958768_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP033550.1\|AZC06144.1\|1958272_1958593_-\|hypothetical-protein	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	4.34463e-09
CP033550.1\|AZC06146.1\|1958740_1959634_-\|TIGR01244-family-phosphatase	gnl\|CDD\|350353	cd14503, PTP-bact, bacterial tyrosine-protein phosphataseS similar to Neisseria NMA1982. This subfamily is composed of bacterial tyrosine-protein phosphatases similar to Neisseria meningitidis NMA1982, which displays phosphatase activity but whose biological function is still unknown.	9.21247e-30
CP033550.1\|AZC06152.1\|1973489_1974719_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.11854e-61
CP033550.1\|AZC06138.1\|1947271_1948126_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	4.69013e-62
CP033550.1\|AZC06147.1\|1962898_1963957_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	2.81892e-179
CP033550.1\|AZC06149.1\|1964798_1966202_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
CP033550.1\|AZC06150.1\|1966212_1967739_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	1.31786e-112
CP033550.1\|AZC06136.1\|1935944_1936841_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176148	cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.53592e-83
CP033550.1\|AZC06135.1\|1931777_1932482_+\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	5.82965e-113
CP033550.1\|AZC06151.1\|1968770_1969733_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP033550.1\|AZC06142.1\|1951636_1952380_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	6.68632e-76
CP033550.1\|AZC06140.1\|1949609_1949855_-\|ferredoxin-family-protein	gnl\|CDD\|224069	COG1146, COG1146, Ferredoxin [Energy production and conversion].	7.37382e-10
CP033550.1\|AZC06139.1\|1948160_1949534_-\|nitrate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270277	cd13559, PBP2_SsuA_like_3, Putative substrate binding domain of sulfonate binding protein-like, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.29387e-135
CP033550.1\|AZC07003.1\|1939655_1941074_+\|aspartate-ammonia-lyase	gnl\|CDD\|237031	PRK12273, aspA, aspartate ammonia-lyase; Provisional.	0
CP033550.1\|AZC06141.1\|1949883_1951608_-\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|181346	PRK08275, PRK08275, putative oxidoreductase; Provisional.	0
CP033550.1\|AZC06148.1\|1963986_1964772_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	9.15145e-115
CP033550.1\|AZC06137.1\|1945436_1946435_-\|HEAT-repeat-domain-containing-protein	gnl\|CDD\|224331	COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion].	7.12268e-19

>CP033550.1|AZC06142.1|1951636_1952380_-|GntR-family-transcriptional-regulator
MSQLPPDAKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELRQVPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLPEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>CP033550.1|AZC06141.1|1949883_1951608_-|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit
METKYLEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAVIPGYATPEQYTKEITIANDGVVNQSTVYAYAKHSFTTIQQLDQWGIKFEKDETGEFAVKKVHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSGDFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQINPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKVDHLAEETIQTIEEILHTNERPSRGRFHEGRGTNYRQDMVEMHISEIGFCSGHSASGVWVNEKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVSAVQDSKLNQSEIEVEKARIFAPLNCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNPHELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEQGNMVSFKRPIEPYVVPINQDEAVSYDRLRIQKMLL
>CP033550.1|AZC06140.1|1949609_1949855_-|ferredoxin-family-protein
MTFIFKEVQHRTVAPVIIDEDKCIADKGCTVCVDVCPMDLLAIDPTTQKAYMQFDECWYCMPCEKDCPTDAVKVNIPYLLK
>CP033550.1|AZC06139.1|1948160_1949534_-|nitrate-ABC-transporter-substrate-binding-protein
MVLGTLGCGSKTETVRVAIGTQDTTINCATGGLLIRELNLLPKYLPKDGKYKHVKYDIQWKNFTSGAPLTSEMVAGRLDLGAMADFPAVNNLAAFKKAGKESIFLAPLSGSINGSGNAIVVPIDSKVTSLKELKGQTISVPFASTAHGLLLRAIQAEGWQLDKDIKVIAQAPEVAGPALKSHKIAAHADFVPFGELFAYQGFAKKIYDGSQAKSPTFHGSLASKDYAQQHPEVIKAYLQAAIEANRLIREQPEKYSELIAEKTGIPAEVVYLFHGPLDLQTRDLTWKPEYRKATQIAIDTLKVLGKNDGTLDVNKFIDNQYIKDAFQASGLNYSQQLADYAKSPLVANDALTGQPIKTFDRVTQIWVKGEEKVRSYETPEHAFSDLKKIQANGKTVRVVYSQDHQSDIKLLANLAWYATDKAGKIQAFLLKDDAEKWAKQQGGKVYDFKAIQLVTQS
>CP033550.1|AZC06138.1|1947271_1948126_-|ABC-transporter-permease
MSSLAQTKPNNQITFLIKFFRQLRSYPARLKSYVIAFTSIAFWIAIWQGLAQFKVNLGFVNFSNVPTPLDVIHALWAFFQLSAAFEHVESSVFRVVIGFVLAALIGVGIGLLAGRYQKLAAFLMPPLEVLRPIPAVAWIPLAILIFPSSEASMIFITFIGALFPILLNTVHGVGAVDPRLVASAKSLGASDLAIIHEVIIPGALPNIITGLSIGMGTCWFCLVTAEMISGQHGIGYFTWESFTLQNYSNIVVGMVLIGALGMFSSTLVRVIGNRFTPWYQLRKS
>CP033550.1|AZC06137.1|1945436_1946435_-|HEAT-repeat-domain-containing-protein
MSFYYQALDDLDEYNQEFLAQLNDPDEKIRFVALMNIGDEENPDLLPWLHAALQHDSSALVRQEAAKKLESWEDPTSLQVLAQALFDTDVNVKQTASQSLSEVKNAASAPILAPYLKHTDTFALSAILRALKPLRPQQLFDEISALEHHKNAFVRREAVSALSWLQQDQAITILAKIAETDTDDEVRRIATGGLAYSQSISTEVIQALQHSLTSESWQLRVEAALTIGKLRIVQLEAPLIHTVSDLYWQVRIAAVRSLGLLKSHLAVAHLSDNFKHEISNLRKEVALALGEIGTSEAQTLLEQHQNDPDPEVRKAIRIGLNQIGEVKYANQT
>CP033550.1|AZC07003.1|1939655_1941074_+|aspartate-ammonia-lyase
MMNADITTRIEKDLIGHREINNDHYYGVQTLRALENFNLTNSKVGNFPNLIKALAMVKLACAEANYNLKNLDQTKFEAIEYSCNQLIRGNFHDQFPIDMMQGGAGTSTNMNANEVLANVALEYMGHSKGQYQYLHPNNDINMSQSTNDVYPTAIRLGLLLSLDELNLPFNNLILSFLNKSQEFAHILKMGRTQLQDAVPMTLGQEFGAFAVTLQKDLEQINTLIPNVLAYMNLGGTAIGTGITTEYSYRELAIQALGKISGKKIKSAPDLIEATSDMGDFVLLSGLLKRTATKLSKIANDLRLLSSGPRTGINEINLEARQPGSSIMPGKVNPVIPEAMNLTCFQIIANDLAVTLAAEAGQLQLNAMEPLIAFKLFESMDLLGKAMAMFQSKCIDTITANPEHCKALVENSIGIVTALNPYLGYETTTRIAKTANETGQSVLALVQNEGLLSAQVLDDILSINNMVKPKMSA
>CP033550.1|AZC06136.1|1935944_1936841_-|LysR-family-transcriptional-regulator
MFDLDSRLLNIFYHIYRFKSVSMAADAIGLTQPSVSNGLNKIRQHFNDPLFIRVGNEMIPTELAKQIFPLISEVIDKVESINNFNVNFDPLTSDQLFTIAMTDVSHLVLLPQLTNYLKEKAPLIRLNIRPITPETSYQMANGEIDLAIGFLPQLEEGFYQQKFFRQHYVVISSKSHPRLDPNNFTLEDYMREYHIDIDAGIGHYHIKNELQNKGLDRNILIRLPSYLGVGLVVQETDAIATVPYYLSQVLLVRENLQILPAPLDFPTYDVKQHWHMSCHHKSSHKWFRQTCYELFKTA
>CP033550.1|AZC06135.1|1931777_1932482_+|CoA-transferase-subunit-A
MNKVYANAEAALKDVIADNQTLAVGGFGLCGIPEKLIIAVKQSGVTGLTCISNNAGVDDFGLGILLQTKQIKKMISSYVGENKEFERQYLNGELEVELTPQGTLAEKLRAGGAGIPAFYTQTGVGTLIAEGKEERTFHGKNYILEESLTADVALVKAYKADKAGNLVFRKTAQNFNPECAMAGKITIAEVEQVVEIGELDPDEIHLPGIYVNRIVLNASPEKRIEHKTLSTEAV
>CP033550.1|AZC07002.1|1930114_1930504_+|hypothetical-protein
MMWIKFILYPLGMFVLWQTIFLIEQVSLESLNAPKLLMTIITLIINWGMQILIGYKIAQLAPKHKLIVSTTYIIFFTFMITIYSITILLEGLKVAPQKIWMCYLFFHLIGMFIYFANNKDEFCWNDLLK
>CP033550.1|AZC06143.1|1958046_1958241_-|hypothetical-protein
MERGKIVLAEFGYGGKLLPSFPKWVIDGQKPSRLAWLLKEQILPPIYWQGMLKGREWMVKPERG
>CP033550.1|AZC06144.1|1958272_1958593_-|hypothetical-protein
MGLQKKAWFKVVNDENAALIETNFDMLHVVPPQQAPDFIRASILTDEAGWVSVNPQTLQHTQHANIFALGDVMNAPNAKTAAAARAQAPIVAVNVIAQLKGGAGLL
>CP033550.1|AZC06145.1|1958564_1958768_-|hypothetical-protein
MYLSADYWLKQGKLKDISIHFYNTGAVLFGVKEYVPALMQYVEKYGSELHFNHQLVKVDGPAKKSMV
>CP033550.1|AZC06146.1|1958740_1959634_-|TIGR01244-family-phosphatase
MADQGIKTLICNRPDGEGADQPNVIEIEEAAQRHSLKVIYQPVTSGKITDQQVTEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPQDAALLVETGNKLGFNLKGLVPRILKHDYEPATIPCYSVVIVGAGAAGISVASSLLSREPHLDIVIIDPADTHYYQPGWTMVGGGIFKPQVTARSMASVIPSKVKWMKAAVAGFDPEHNQVILEGCQPIQYKALVVCPGLKLNWHGIEGLVETLGKNGVTSNYRYDLAPYTWELVQQLNGGKAILPSHLCRLSVQVLLKKRCTFQRITG
>CP033550.1|AZC06147.1|1962898_1963957_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEDVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTCVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP033550.1|AZC06148.1|1963986_1964772_-|acetoin-reductase
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALDVNASTFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADVTPDEFQKIVDINIGGVLWGIQAAATKFKQRQHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>CP033550.1|AZC06149.1|1964798_1966202_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFNGRAQLTAKEKLEVTDAQGNSQDLSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIENGQVHCVVETANDVQTLVFERVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICVEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENVAKAQNLPVRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP033550.1|AZC06150.1|1966212_1967739_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCAESQVSDAEIEKFIASLGGSAAQAPSEQNKAETSAPVAEKAEQPQTVAASASAPAKVAKDDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISIQDIQKAVQAAGGQWPDVKQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTSVNEQPVQCVAQPQSTITTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP033550.1|AZC06151.1|1968770_1969733_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP033550.1|AZC06152.1|1973489_1974719_+|GGDEF-domain-containing-protein
MKLQGSNILGQEQIDLLTTRGLNFVWFPKQLETIYRFQYQNGAAYEFRYRAPIILILYLFLSFGIYQVLPTDQVLSWLSYYSWVGIIVLIAWILSFIKKLNQWFDYYVGIGSASAVAITFILINVLENGQDNVLFHAAMMYAIVIIYGAVGMRFYTAIIAGWVGGLVGILVSTYVKGDIDWTFLNRTYTFSSFLGMTLAYATDRQHRENYLQNCMIELNRIELMQQAQQLSLLSQQDALTGLANRRYLDETLDNEWRRALRHETPLTIMMVDIDFFKPYNDTLGHLKGDQCLKDIATAISSIAARSGDLVARYGGEEFLLLFPMTNAQQAQIQVERLMNAIKKIAIVHPCSSVSPYVTISVGVATTIPRLNDSISAFVSRADHALYQAKTNGRNQYQIAVNQEQIVDLT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP033550_2	2.4\|519604\|18\|CP033550\|CRT	519604-519621	18	CP033550.1	520285-520302	0	1.0
CP033550_2	2.6\|519712\|18\|CP033550\|CRT	519712-519729	18	CP033550.1	520285-520302	0	1.0
CP033550_2	2.4\|519604\|18\|CP033550\|CRT	519604-519621	18	CP033550.1	519376-519393	1	0.944
CP033550_2	2.4\|519604\|18\|CP033550\|CRT	519604-519621	18	CP033550.1	520366-520383	1	0.944
CP033550_2	2.4\|519604\|18\|CP033550\|CRT	519604-519621	18	CP033550.1	520447-520464	1	0.944
CP033550_2	2.6\|519712\|18\|CP033550\|CRT	519712-519729	18	CP033550.1	519376-519393	1	0.944
CP033550_2	2.6\|519712\|18\|CP033550\|CRT	519712-519729	18	CP033550.1	520366-520383	1	0.944
CP033550_2	2.6\|519712\|18\|CP033550\|CRT	519712-519729	18	CP033550.1	520447-520464	1	0.944

1. spacer 2.4|519604|18|CP033550|CRT matches to position: 520285-520302, mismatch: 0, identity: 1.0

accaccgataatgtcagt	CRISPR spacer
accaccgataatgtcagt	Protospacer
******************

2. spacer 2.6|519712|18|CP033550|CRT matches to position: 520285-520302, mismatch: 0, identity: 1.0

accaccgataatgtcagt	CRISPR spacer
accaccgataatgtcagt	Protospacer
******************

3. spacer 2.4|519604|18|CP033550|CRT matches to position: 519376-519393, mismatch: 1, identity: 0.944

accaccgataatgtcagt	CRISPR spacer
accaccgatgatgtcagt	Protospacer
*********.********

4. spacer 2.4|519604|18|CP033550|CRT matches to position: 520366-520383, mismatch: 1, identity: 0.944

accaccgataatgtcagt	CRISPR spacer
accaccaataatgtcagt	Protospacer
******.***********

5. spacer 2.4|519604|18|CP033550|CRT matches to position: 520447-520464, mismatch: 1, identity: 0.944

accaccgataatgtcagt	CRISPR spacer
accaccgatgatgtcagt	Protospacer
*********.********

6. spacer 2.6|519712|18|CP033550|CRT matches to position: 519376-519393, mismatch: 1, identity: 0.944

accaccgataatgtcagt	CRISPR spacer
accaccgatgatgtcagt	Protospacer
*********.********

7. spacer 2.6|519712|18|CP033550|CRT matches to position: 520366-520383, mismatch: 1, identity: 0.944

accaccgataatgtcagt	CRISPR spacer
accaccaataatgtcagt	Protospacer
******.***********

8. spacer 2.6|519712|18|CP033550|CRT matches to position: 520447-520464, mismatch: 1, identity: 0.944

accaccgataatgtcagt	CRISPR spacer
accaccgatgatgtcagt	Protospacer
*********.********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	299561-299592	6	0.812
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	205975-206006	6	0.812
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	340909-340940	6	0.812
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NC_019358	Clostridium perfringens plasmid pCP8533S12 DNA, complete sequence	5865-5896	8	0.75
CP033550_2	2.1\|519424\|30\|CP033550\|CRT	519424-519453	30	AP013864	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C15J-MedDCM-OCT-S26-C75, * SEQUENCING IN PROGRESS *	10902-10931	8	0.733
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	14787-14818	9	0.719
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NZ_CP031267	Staphylococcus warneri strain 16A plasmid unnamed3	3551-3582	10	0.688
CP033550_1	1.2\|101772\|32\|CP033550\|PILER-CR	101772-101803	32	NC_010371	Finegoldia magna ATCC 29328 plasmid pFMC, complete sequence	43411-43442	10	0.688
CP033550_2	2.3\|519544\|30\|CP033550\|CRT	519544-519573	30	MN692983	Marine virus AFVG_117M11, complete genome	25850-25879	10	0.667
CP033550_2	2.5\|519652\|30\|CP033550\|CRT	519652-519681	30	MN692983	Marine virus AFVG_117M11, complete genome	25850-25879	10	0.667
CP033550_2	2.7\|519760\|30\|CP033550\|CRT	519760-519789	30	MN692983	Marine virus AFVG_117M11, complete genome	25850-25879	10	0.667
CP033550_2	2.8\|519820\|30\|CP033550\|CRT	519820-519849	30	MN692983	Marine virus AFVG_117M11, complete genome	25850-25879	10	0.667

1. spacer 1.2|101772|32|CP033550|PILER-CR matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 6, identity: 0.812

atcattttttcttcaatttctactaccagttg	CRISPR spacer
atcattttttcttttatttctactagtagctc	Protospacer
*************. ********** .**.*

2. spacer 1.2|101772|32|CP033550|PILER-CR matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 6, identity: 0.812

atcattttttcttcaatttctactaccagttg	CRISPR spacer
atcattttttcttttatttctactagtagctc	Protospacer
*************. ********** .**.*

3. spacer 1.2|101772|32|CP033550|PILER-CR matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 6, identity: 0.812

atcattttttcttcaatttctactaccagttg	CRISPR spacer
atcattttttcttttatttctactagtagctc	Protospacer
*************. ********** .**.*

4. spacer 1.2|101772|32|CP033550|PILER-CR matches to NC_019358 (Clostridium perfringens plasmid pCP8533S12 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

atcattttttcttcaatttctactaccagttg	CRISPR spacer
ttcattttttcttcaatttgtgctaatattgt	Protospacer
 ****************** *.*** .* *

5. spacer 2.1|519424|30|CP033550|CRT matches to AP013864 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C15J-MedDCM-OCT-S26-C75, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.733

gccaccagttaaaccaccgataatgtcagt	CRISPR spacer
gccactaattaaaccaccgataaaagtctt	Protospacer
*****.*.*************** . .  *

6. spacer 1.2|101772|32|CP033550|PILER-CR matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 9, identity: 0.719

atcattttttcttcaatttctactaccagttg--	CRISPR spacer
ttctttttttcttcaatttttactttt--tcggc	Protospacer
 ** ***************.**** ..  *.*

7. spacer 1.2|101772|32|CP033550|PILER-CR matches to NZ_CP031267 (Staphylococcus warneri strain 16A plasmid unnamed3) position: , mismatch: 10, identity: 0.688

atcattttttcttcaatttctactaccagttg	CRISPR spacer
ctctttttttcttcaatttctactgaacaaca	Protospacer
 ** ********************.   . ..

8. spacer 1.2|101772|32|CP033550|PILER-CR matches to NC_010371 (Finegoldia magna ATCC 29328 plasmid pFMC, complete sequence) position: , mismatch: 10, identity: 0.688

atcattttttcttcaatttctactaccagttg	CRISPR spacer
tcagtttttgcttcaatttctacaacctttct	Protospacer
 . .***** ************* ***  *.

9. spacer 2.3|519544|30|CP033550|CRT matches to MN692983 (Marine virus AFVG_117M11, complete genome) position: , mismatch: 10, identity: 0.667

accaccagttaaaccaccgatgatatcagt	CRISPR spacer
accaccatttaaaccaccgattgcggagag	Protospacer
******* ************* ...  ..

10. spacer 2.5|519652|30|CP033550|CRT matches to MN692983 (Marine virus AFVG_117M11, complete genome) position: , mismatch: 10, identity: 0.667

accaccagttaaaccaccgatgatatcagt	CRISPR spacer
accaccatttaaaccaccgattgcggagag	Protospacer
******* ************* ...  ..

11. spacer 2.7|519760|30|CP033550|CRT matches to MN692983 (Marine virus AFVG_117M11, complete genome) position: , mismatch: 10, identity: 0.667

accaccagttaaaccaccgatgatatcagt	CRISPR spacer
accaccatttaaaccaccgattgcggagag	Protospacer
******* ************* ...  ..

12. spacer 2.8|519820|30|CP033550|CRT matches to MN692983 (Marine virus AFVG_117M11, complete genome) position: , mismatch: 10, identity: 0.667

accaccagttaaaccaccgatgatatcagt	CRISPR spacer
accaccatttaaaccaccgattgcggagag	Protospacer
******* ************* ...  ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1191102 : 1197989

Acinetobacter_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC05862.1\|1191102_1191996_+	hypothetical protein	A0A0D4DBT2	Acinetobacter_phage	9.2e-88	63.1
AZC05863.1\|1192770_1193283_+	hypothetical protein	NA	NA	NA	NA
AZC06979.1\|1193317_1193569_+	hypothetical protein	NA	NA	NA	NA
AZC05864.1\|1193565_1194342_+	hypothetical protein	NA	NA	NA	NA
AZC05865.1\|1194335_1194830_+	RusA family crossover junction endodeoxyribonuclease	A0A2H4J351	uncultured_Caudovirales_phage	1.1e-39	52.5
AZC05866.1\|1194835_1195294_+	hypothetical protein	A0A2H4J353	uncultured_Caudovirales_phage	6.2e-48	61.2
AZC06980.1\|1195425_1195779_+	hypothetical protein	A0A1W6DXZ5	Salmonella_phage	9.7e-25	54.5
AZC05867.1\|1195884_1196079_+	hypothetical protein	A0A0D4DCM7	Acinetobacter_phage	1.1e-09	53.6
AZC06981.1\|1196215_1196422_+	hypothetical protein	NA	NA	NA	NA
AZC05868.1\|1196384_1196588_+	hypothetical protein	NA	NA	NA	NA
AZC05869.1\|1196580_1196943_+	hypothetical protein	NA	NA	NA	NA
AZC05870.1\|1197469_1197760_+	hypothetical protein	NA	NA	NA	NA
AZC05871.1\|1197689_1197989_+	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	5.5e-21	55.3

DBSCAN-SWA_2

2076618 : 2163040

uncultured_Caudovirales_phage(35.29%)

holin,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC06186.1\|2076618_2077374_-\|tail	phage tail protein	A0A0R6PIM4	Moraxella_phage	2.7e-80	55.0
AZC06187.1\|2077380_2078187_-\|tail	phage minor tail protein L	A0A0R6PGU8	Moraxella_phage	1.5e-92	62.7
AZC06188.1\|2079651_2079990_-	negative regulator GrlR	NA	NA	NA	NA
AZC06189.1\|2080050_2080392_-\|tail	phage tail protein	A0A1B0VMG7	Pseudomonas_phage	9.4e-17	39.8
AZC06190.1\|2083858_2084041_-	hypothetical protein	NA	NA	NA	NA
AZC06191.1\|2084598_2085072_-	structural protein 3 family protein	A0A2H4JBZ0	uncultured_Caudovirales_phage	2.4e-55	64.1
AZC06192.1\|2086191_2086677_-	hypothetical protein	A0A2H4J6A2	uncultured_Caudovirales_phage	4.9e-27	44.7
AZC06193.1\|2086680_2087037_-\|head,tail	head-tail adaptor protein	A0A1J0GUY4	Halomonas_phage	4.1e-23	52.8
AZC06194.1\|2087183_2087477_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JAM4	uncultured_Caudovirales_phage	7.5e-23	55.1
AZC06195.1\|2090541_2091135_-	peptidase U35	A0A2H4J367	uncultured_Caudovirales_phage	6.5e-82	75.6
AZC06196.1\|2093630_2093930_-	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	7.2e-21	52.7
AZC06197.1\|2093859_2094150_-	hypothetical protein	NA	NA	NA	NA
AZC06198.1\|2094127_2094391_-	hypothetical protein	NA	NA	NA	NA
AZC06199.1\|2094383_2094608_-	hypothetical protein	NA	NA	NA	NA
AZC06200.1\|2094597_2095128_-	hypothetical protein	A0A2H4JB76	uncultured_Caudovirales_phage	1.3e-36	43.4
AZC06201.1\|2096123_2097020_-	hypothetical protein	NA	NA	NA	NA
AZC06202.1\|2097085_2097580_-	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	2.6e-15	31.0
AZC06203.1\|2102512_2103256_+	hypothetical protein	NA	NA	NA	NA
AZC06204.1\|2103644_2103881_+	hypothetical protein	A0A2H4J515	uncultured_Caudovirales_phage	1.6e-07	44.1
AZC06205.1\|2103883_2104300_+	hypothetical protein	NA	NA	NA	NA
AZC06206.1\|2104876_2105266_+	hypothetical protein	A0A1B1P9F6	Acinetobacter_phage	3.0e-27	83.1
AZC06207.1\|2106031_2106283_+	hypothetical protein	NA	NA	NA	NA
AZC06208.1\|2113499_2113802_-	integration host factor subunit beta	B5TA87	Burkholderia_phage	5.6e-13	42.9
AZC06209.1\|2113958_2115632_-	30S ribosomal protein S1	NA	NA	NA	NA
AZC06210.1\|2116432_2116873_-	SRPBCC family protein	NA	NA	NA	NA
AZC06211.1\|2121115_2121931_-	type II secretion system protein GspJ	NA	NA	NA	NA
AZC06212.1\|2121930_2122311_-	type II secretion system protein GspI	NA	NA	NA	NA
AZC06213.1\|2122300_2122846_-	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
AZC06214.1\|2123504_2124278_-	YchF/TatD family DNA exonuclease	NA	NA	NA	NA
AZC06215.1\|2125638_2126400_-	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZC06216.1\|2126409_2127420_-	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZC06217.1\|2127422_2129150_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	1.7e-58	30.8
AZC06218.1\|2129146_2129575_-	biopolymer transporter ExbD	NA	NA	NA	NA
AZC06219.1\|2132678_2133368_-	nucleotidyltransferase family protein	H9NC64	Sphingomonas_phage	7.2e-08	34.6
AZC06220.1\|2134500_2136954_+	LPS-assembly protein LptD	NA	NA	NA	NA
AZC06221.1\|2138378_2139416_-	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
AZC06222.1\|2139900_2141088_-	phosphoglycerate kinase	NA	NA	NA	NA
AZC06223.1\|2143733_2144315_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZC06224.1\|2144787_2145096_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AZC06225.1\|2150152_2150593_+	MaoC family dehydratase	NA	NA	NA	NA
AZC06226.1\|2151764_2152139_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
AZC06227.1\|2152236_2152944_+	NAD-dependent deacylase	R9TG77	Vibrio_phage	3.7e-31	41.2
AZC06228.1\|2162443_2163040_+\|holin	phosphatidylcholine--retinol O-acyltransferase	NA	NA	NA	NA

DBSCAN-SWA_3

2781447 : 2904662

Acinetobacter_phage(15.38%)

holin,tail,head,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC06473.1\|2781447_2782257_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AZC06474.1\|2784719_2785412_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-32	38.0
AZC06475.1\|2785456_2786080_+	arylesterase	NA	NA	NA	NA
AZC06476.1\|2789091_2791356_-	TonB-dependent siderophore receptor	A0A0P0I887	Acinetobacter_phage	3.1e-07	31.9
AZC07042.1\|2795903_2796068_+	hypothetical protein	NA	NA	NA	NA
AZC06477.1\|2798189_2799524_-	D-serine ammonia-lyase	NA	NA	NA	NA
AZC06478.1\|2801484_2801715_-	hypothetical protein	NA	NA	NA	NA
AZC06479.1\|2801780_2805467_+	methionine synthase	A0A140XBC7	Dickeya_phage	9.5e-14	58.3
AZC06480.1\|2806312_2806786_-	hypothetical protein	NA	NA	NA	NA
AZC06481.1\|2810316_2811105_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZC06482.1\|2811071_2812394_-	glutaminase	NA	NA	NA	NA
AZC06483.1\|2812572_2813055_-	peptide deformylase	E3SLL2	Synechococcus_phage	2.9e-19	45.2
AZC06484.1\|2815994_2817635_-	thiamine pyrophosphate-binding protein	E5EQ70	Micromonas_sp._RCC1109_virus	4.1e-25	23.8
AZC06485.1\|2817673_2819140_-	aldehyde dehydrogenase	NA	NA	NA	NA
AZC06486.1\|2819959_2820754_-	SDR family oxidoreductase	NA	NA	NA	NA
AZC06487.1\|2821631_2822153_-	cupin domain-containing protein	NA	NA	NA	NA
AZC06488.1\|2824682_2825612_-	glyoxalase	NA	NA	NA	NA
AZC06489.1\|2827462_2827762_-	hypothetical protein	NA	NA	NA	NA
AZC06490.1\|2829226_2829526_-	hypothetical protein	NA	NA	NA	NA
AZC06491.1\|2830098_2830635_-	hypothetical protein	NA	NA	NA	NA
AZC06492.1\|2830674_2831271_-	nicotinamide riboside transporter PnuC	A0A2C9CZ93	Yersinia_phage	6.5e-13	29.0
AZC06493.1\|2831518_2832307_+	crotonase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
AZC07043.1\|2832411_2832816_-	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
AZC06494.1\|2836413_2836755_-	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
AZC06495.1\|2836842_2837373_-	YaeQ family protein	NA	NA	NA	NA
AZC06496.1\|2838863_2839826_-	GTP-binding protein	NA	NA	NA	NA
AZC06497.1\|2840361_2840559_+	hypothetical protein	NA	NA	NA	NA
AZC06498.1\|2840672_2841203_-	acyl-CoA thioesterase	NA	NA	NA	NA
AZC06499.1\|2841462_2842077_-	MarC family protein	NA	NA	NA	NA
AZC06500.1\|2842088_2844155_-\|holin	high-affinity choline transporter BetT	A0A2I7QNT1	Vibrio_phage	2.0e-16	25.1
AZC06501.1\|2844272_2845895_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.5e-19	24.5
AZC07044.1\|2846146_2846782_+	transcriptional regulator BetI	NA	NA	NA	NA
AZC06502.1\|2850510_2852172_+	malate dehydrogenase (quinone)	NA	NA	NA	NA
AZC06503.1\|2852242_2852674_+	hypothetical protein	NA	NA	NA	NA
AZC06504.1\|2852928_2853807_+	homocysteine S-methyltransferase family protein	NA	NA	NA	NA
AZC06505.1\|2857260_2857968_-	DUF1275 domain-containing protein	NA	NA	NA	NA
AZC06506.1\|2859650_2859833_-	hypothetical protein	NA	NA	NA	NA
AZC06507.1\|2860905_2861334_-	hypothetical protein	NA	NA	NA	NA
AZC06508.1\|2885611_2885800_-	hypothetical protein	NA	NA	NA	NA
AZC06509.1\|2886337_2886700_-	hypothetical protein	NA	NA	NA	NA
AZC06510.1\|2887538_2887718_-	hypothetical protein	NA	NA	NA	NA
AZC06511.1\|2892751_2893408_-\|tail	tail assembly protein	A0A0R6PIF0	Moraxella_phage	6.8e-40	45.4
AZC06512.1\|2893391_2894147_-\|tail	phage tail protein	A0A0R6PIM4	Moraxella_phage	2.8e-85	57.4
AZC06513.1\|2896531_2897398_-	hypothetical protein	A0A1B1P9E6	Acinetobacter_phage	1.2e-31	41.7
AZC06514.1\|2897357_2899781_-	hypothetical protein	A0A2H4JDA4	uncultured_Caudovirales_phage	5.8e-28	26.7
AZC06515.1\|2900019_2900304_-	hypothetical protein	NA	NA	NA	NA
AZC06516.1\|2900364_2900709_-	hypothetical protein	NA	NA	NA	NA
AZC06517.1\|2900779_2901529_-	hypothetical protein	Q7Y5X0	Haemophilus_phage	1.3e-23	37.6
AZC06518.1\|2901848_2902076_-	hypothetical protein	NA	NA	NA	NA
AZC06519.1\|2902570_2903002_-	hypothetical protein	NA	NA	NA	NA
AZC06520.1\|2903005_2903371_-	hypothetical protein	NA	NA	NA	NA
AZC06521.1\|2903873_2904203_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
AZC06522.1\|2904362_2904662_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA

DBSCAN-SWA_4

3008135 : 3026154

Acinetobacter_phage(78.95%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC06575.1\|3008135_3008312_-	hypothetical protein	A0A0R6PI25	Moraxella_phage	4.8e-09	59.6
AZC06576.1\|3008406_3008628_-	hypothetical protein	NA	NA	NA	NA
AZC06577.1\|3009413_3009575_-	Arc family DNA-binding protein	NA	NA	NA	NA
AZC06578.1\|3010091_3010562_-	DUF2335 domain-containing protein	A0A2H4J330	uncultured_Caudovirales_phage	8.0e-59	80.0
AZC06579.1\|3010573_3010795_-	hypothetical protein	NA	NA	NA	NA
AZC07048.1\|3011023_3011230_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	3.8e-29	91.2
AZC06580.1\|3011289_3011823_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	3.5e-42	57.1
AZC06581.1\|3011869_3012790_-	hypothetical protein	A0A059VG08	Pseudomonas_phage	2.7e-58	41.4
AZC06582.1\|3013121_3013649_-	Rha family transcriptional regulator	A0A1B1P9D9	Acinetobacter_phage	3.9e-54	63.7
AZC06583.1\|3014284_3014707_-	hypothetical protein	A0A1B1P9D5	Acinetobacter_phage	3.9e-57	78.6
AZC06584.1\|3014711_3015104_-	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	2.3e-59	86.9
AZC06585.1\|3015107_3015494_-	hypothetical protein	A0A1B1P9F2	Acinetobacter_phage	8.0e-65	96.9
AZC06586.1\|3015550_3015736_-	hypothetical protein	A0A1B1P9F4	Acinetobacter_phage	2.5e-24	88.3
AZC06587.1\|3015747_3016764_-	hypothetical protein	A0A1B1P9D0	Acinetobacter_phage	1.6e-168	88.2
AZC06588.1\|3017592_3017805_-	hypothetical protein	NA	NA	NA	NA
AZC06589.1\|3018901_3020308_-	DUF4055 domain-containing protein	A0A1B1P9C6	Acinetobacter_phage	3.9e-266	96.2
AZC07049.1\|3020307_3021618_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	4.3e-243	98.8
AZC06590.1\|3021916_3022174_-	hypothetical protein	A0A2H4J6Z3	uncultured_Caudovirales_phage	7.3e-22	61.5
AZC06591.1\|3024312_3024534_-	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	2.1e-17	94.2
AZC06592.1\|3024511_3024886_-	XRE family transcriptional regulator	A0A0N7IRF8	Acinetobacter_phage	6.0e-33	61.7
AZC06593.1\|3024896_3025082_-	hypothetical protein	J7HXD2	Acinetobacter_phage	8.6e-25	90.2
AZC06594.1\|3025159_3025924_+	helix-turn-helix domain-containing protein	J7I4M9	Acinetobacter_phage	1.2e-136	94.4
AZC06595.1\|3025938_3026154_+	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	1.2e-30	98.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033552

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4235 : 14595

Acinetobacter_phage(84.62%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC07129.1\|4235_4535_-	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	1.1e-21	62.5
AZC07130.1\|4464_4755_-	hypothetical protein	NA	NA	NA	NA
AZC07131.1\|4732_5290_-	hypothetical protein	NA	NA	NA	NA
AZC07132.1\|5331_5514_-	hypothetical protein	NA	NA	NA	NA
AZC07133.1\|6099_6282_-	hypothetical protein	NA	NA	NA	NA
AZC07134.1\|6275_6503_-	hypothetical protein	NA	NA	NA	NA
AZC07135.1\|6540_6816_-	DUF968 domain-containing protein	A0A0D4DC07	Acinetobacter_phage	5.4e-23	59.3
AZC07136.1\|6808_7075_-	hypothetical protein	NA	NA	NA	NA
AZC07137.1\|7783_8320_-	hypothetical protein	A0A0D4DCD6	Acinetobacter_phage	1.9e-96	98.3
AZC07138.1\|8330_8600_-	hypothetical protein	A0A0D4DC03	Acinetobacter_phage	2.7e-43	97.8
AZC07139.1\|8609_8903_-	hypothetical protein	A0A1B1P9I9	Acinetobacter_phage	2.7e-49	99.0
AZC07140.1\|8902_9355_-	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	4.8e-77	97.3
AZC07141.1\|9351_9654_-	hypothetical protein	NA	NA	NA	NA
AZC07142.1\|9650_9938_-	hypothetical protein	A0A0P0J0G5	Acinetobacter_phage	6.9e-05	50.8
AZC07187.1\|9937_10201_-	hypothetical protein	A0A1X9SFB0	Acinetobacter_phage	1.0e-31	97.0
AZC07143.1\|10394_10646_-	hypothetical protein	A0A0P0IE39	Acinetobacter_phage	1.5e-40	98.8
AZC07144.1\|10642_12004_-	replicative DNA helicase	A0A1B1P9I0	Acinetobacter_phage	2.9e-226	87.2
AZC07145.1\|12003_12822_-	hypothetical protein	A0A2I7RQ47	Vibrio_phage	5.6e-07	35.6
AZC07146.1\|13278_13455_-	hypothetical protein	NA	NA	NA	NA
AZC07147.1\|13582_14365_+	helix-turn-helix domain-containing protein	J7I4M9	Acinetobacter_phage	2.3e-98	74.6
AZC07148.1\|14379_14595_+	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	6.1e-30	97.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033550

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033552

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection