CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP033564	Acinetobacter nosocomialis strain 2010S01-197 plasmid p2010S01-197-3, complete sequence	0 crisprs	NA	0
CP033567	Acinetobacter nosocomialis strain 2010S01-197 plasmid p2010S01-197-6, complete sequence	0 crisprs	NA	0
CP033565	Acinetobacter nosocomialis strain 2010S01-197 plasmid p2010S01-197-4, complete sequence	0 crisprs	NA	0
CP033566	Acinetobacter nosocomialis strain 2010S01-197 plasmid p2010S01-197-5, complete sequence	0 crisprs	NA	0
CP033562	Acinetobacter nosocomialis strain 2010S01-197 plasmid p2010S01-197-1, complete sequence	0 crisprs	NA	0
CP033563	Acinetobacter nosocomialis strain 2010S01-197 plasmid p2010S01-197-2, complete sequence	0 crisprs	NA	0
CP033561	Acinetobacter nosocomialis strain 2010S01-197 chromosome, complete genome	2 crisprs	DEDDh,csa3,WYL	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033561_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033561_1

1549627-1549722

Orphan

Consensus_repeat	Method
CCACCTAAAAGCACCACCAATTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033561_1

>merge|CP033561|1|1549627-1549722|CRISPRCasFinder
CCACCTAAAAGCACCACCAATTGCCGCTTCTGTACGGTTACGACGGTCACTTGCAGCTGCCGCACCACCAGCACCACCTAAAAGCAGCACCAATTG

>CP033561|1|1|1549627-1549722|CRISPRCasFinder
CCACCTAAAAGCACCACCAATTG	CCGCTTCTGTACGGTTACGACGGTCACTTGCAGCTGCCGCACCACCAGCA
CCACCTAAAAGCAGCACCAATTG

Protein	Signature genes	Signature genes Name	Protein_function
CP033561.1\|AZC09565.1\|1564769_1565150_+\|dihydroneopterin-aldolase	unknown	unknown	gnl\|CDD\|224456
CP033561.1\|AZC09560.1\|1554786_1555626_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
CP033561.1\|AZC09563.1\|1562621_1563398_+\|HesA/MoeB/ThiF-family-protein	unknown	unknown	gnl\|CDD\|238386
CP033561.1\|AZC09567.1\|1569574_1570180_+\|potassium-transporting-ATPase-subunit-KdpC	unknown	unknown	gnl\|CDD\|376890
CP033561.1\|AZC09554.1\|1540286_1541123_+\|phosphoenolpyruvate-synthase-regulatory-protein	unknown	unknown	gnl\|CDD\|235419
CP033561.1\|AZC09559.1\|1553968_1554784_+\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236467
CP033561.1\|AZC09551.1\|1531157_1531541_-\|30S-ribosomal-protein-S6	unknown	unknown	gnl\|CDD\|179034
CP033561.1\|AZC09553.1\|1532610_1532940_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|182568
CP033561.1\|AZC09549.1\|1530400_1530910_-\|50S-ribosomal-protein-L9	unknown	unknown	gnl\|CDD\|234659
CP033561.1\|AZC09552.1\|1531722_1532580_-\|protoheme-IX-farnesyltransferase	unknown	unknown	gnl\|CDD\|235293
CP033561.1\|AZC09558.1\|1550116_1550536_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274783
CP033561.1\|AZC09561.1\|1555629_1556604_-\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270274
CP033561.1\|AZC09550.1\|1530918_1531146_-\|30S-ribosomal-protein-S18	unknown	unknown	gnl\|CDD\|178997
CP033561.1\|AZC09556.1\|1547021_1547486_+\|poly-beta-1,6-N-acetyl-D-glucosamine-biosynthesis-protein-PgaD	unknown	unknown	gnl\|CDD\|188455
CP033561.1\|AZC09555.1\|1545777_1547025_+\|poly-beta-1,6-N-acetyl-D-glucosamine-synthase	unknown	unknown	gnl\|CDD\|236882
CP033561.1\|AZC09566.1\|1567623_1569561_+\|K(+)-transporting-ATPase-subunit-B	unknown	unknown	gnl\|CDD\|234905
CP033561.1\|AZC09562.1\|1561873_1562452_-\|flavin-reductase	unknown	unknown	gnl\|CDD\|214900
CP033561.1\|AZC09557.1\|1548244_1549249_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274646
CP033561.1\|AZC09548.1\|1526923_1527658_+\|peptidase	unknown	unknown	gnl\|CDD\|239734
CP033561.1\|AZC09564.1\|1563440_1564754_+\|AarF/ABC1/UbiB-kinase-family-protein	unknown	unknown	gnl\|CDD\|223733

Protein	Function_ID	Function_description	E-value
CP033561.1\|AZC09565.1\|1564769_1565150_+\|dihydroneopterin-aldolase	gnl\|CDD\|224456	COG1539, FolB, Dihydroneopterin aldolase [Coenzyme metabolism].	1.7993e-34
CP033561.1\|AZC09560.1\|1554786_1555626_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	2.84783e-74
CP033561.1\|AZC09563.1\|1562621_1563398_+\|HesA/MoeB/ThiF-family-protein	gnl\|CDD\|238386	cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1). .	8.31646e-100
CP033561.1\|AZC09567.1\|1569574_1570180_+\|potassium-transporting-ATPase-subunit-KdpC	gnl\|CDD\|376890	pfam02669, KdpC, K+-transporting ATPase, c chain. This family consists of K+-transporting ATPase, c chain, KdpC. KdpC forms strong interactions with the KdpA subunit, serving to assemble and stabilize the Kdp complex. It has been suggested that KdpC could be one of the connecting links between the energy providing subunit KdpB and the K+-transporting subunit KdpA. The K+ transport system actively transports K+ ions via ATP hydrolysis.	1.52821e-89
CP033561.1\|AZC09554.1\|1540286_1541123_+\|phosphoenolpyruvate-synthase-regulatory-protein	gnl\|CDD\|235419	PRK05339, PRK05339, pyruvate, phosphate dikinase/phosphoenolpyruvate synthase regulator.	1.38782e-126
CP033561.1\|AZC09559.1\|1553968_1554784_+\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	gnl\|CDD\|236467	PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.	1.18957e-123
CP033561.1\|AZC09551.1\|1531157_1531541_-\|30S-ribosomal-protein-S6	gnl\|CDD\|179034	PRK00453, rpsF, 30S ribosomal protein S6; Reviewed.	8.15519e-45
CP033561.1\|AZC09553.1\|1532610_1532940_-\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|182568	PRK10582, PRK10582, cytochrome o ubiquinol oxidase subunit IV; Provisional.	2.30491e-39
CP033561.1\|AZC09549.1\|1530400_1530910_-\|50S-ribosomal-protein-L9	gnl\|CDD\|234659	PRK00137, rplI, 50S ribosomal protein L9; Reviewed.	3.51661e-71
CP033561.1\|AZC09552.1\|1531722_1532580_-\|protoheme-IX-farnesyltransferase	gnl\|CDD\|235293	PRK04375, PRK04375, protoheme IX farnesyltransferase; Provisional.	4.88781e-113
CP033561.1\|AZC09558.1\|1550116_1550536_-\|hypothetical-protein	gnl\|CDD\|274783	TIGR03789, pdsO, proteobacterial sortase system peptidoglycan-associated protein. A newly defined histidine kinase (TIGR03785) and response regulator (TIGR03787) gene pair occurs exclusively in Proteobacteria, mostly of marine origin, nearly all of which contain a subfamily 6 sortase (TIGR03784) and its single dedicated target protein (TIGR03788) adjacent to to the sortase. This protein family shows up in only in those species with the histidine kinase/response regulator gene pair, and often adjacent to that pair. It belongs to the pfam00691 domain family, which is the peptidoglycan-associated region of flagellar motor protein MotB, OmpA (whose N-terminal region forms an outer membrane beta barrel), and peptidoglycan-associated lipoprotein Pal. Its function is unknown. We assign the gene symbol pdsO, for Proteobacterial Dedicated Sortase system OmpA family protein. [Protein fate, Protein and peptide secretion and trafficking].	0.000378589
CP033561.1\|AZC09561.1\|1555629_1556604_-\|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270274	cd13556, PBP2_SsuA_like_1, Substrate binding domain of putative sulfonate binding protein, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.68514e-143
CP033561.1\|AZC09550.1\|1530918_1531146_-\|30S-ribosomal-protein-S18	gnl\|CDD\|178997	PRK00391, rpsR, 30S ribosomal protein S18; Reviewed.	4.16554e-37
CP033561.1\|AZC09556.1\|1547021_1547486_+\|poly-beta-1,6-N-acetyl-D-glucosamine-biosynthesis-protein-PgaD	gnl\|CDD\|188455	TIGR03940, PGA_PgaD, poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD. Members of this protein family are PgaD, essential to the production of poly-beta-1,6-N-acetyl-D-glucosamine (PGA). This cytoplasmic membrane protein appears to be an auxiliary subunit to the PGA synthase, PgaC (TIGR03937). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	2.3469e-18
CP033561.1\|AZC09555.1\|1545777_1547025_+\|poly-beta-1,6-N-acetyl-D-glucosamine-synthase	gnl\|CDD\|236882	PRK11204, PRK11204, N-glycosyltransferase; Provisional.	0
CP033561.1\|AZC09566.1\|1567623_1569561_+\|K(+)-transporting-ATPase-subunit-B	gnl\|CDD\|234905	PRK01122, PRK01122, potassium-transporting ATPase subunit KdpB.	0
CP033561.1\|AZC09562.1\|1561873_1562452_-\|flavin-reductase	gnl\|CDD\|214900	smart00903, Flavin_Reduct, Flavin reductase like domain. This entry represents the FMN-binding domain found in NAD(P)H-flavin oxidoreductases (flavin reductases), a class of enzymes capable of producing reduced flavin for bacterial bioluminescence and other biological processes. This domain is also found in various other oxidoreductase and monooxygenase enzymes... This domain consists of a beta-barrel with Greek key topology, and is related to the ferredoxin reductase-like FAD-binding domain. The flavin reductases have a different dimerisation mode than that found in the PNP oxidase-like family, which also carries an FMN-binding domain with a similar topology.	7.45719e-25
CP033561.1\|AZC09557.1\|1548244_1549249_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274646	TIGR03558, oxido_grp_1, luciferase family oxidoreductase, group 1. The Pfam domain family pfam00296 is named for luciferase-like monooxygenases, but the family also contains several coenzyme F420-dependent enzymes. This protein family represents a well-resolved clade within family pfam00296 and shows no restriction to coenzyme F420-positive species, unlike some other clades within pfam00296. [Unknown function, Enzymes of unknown specificity].	0
CP033561.1\|AZC09548.1\|1526923_1527658_+\|peptidase	gnl\|CDD\|239734	cd03765, proteasome_beta_bacterial, Bacterial proteasome, beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.	3.20276e-137
CP033561.1\|AZC09564.1\|1563440_1564754_+\|AarF/ABC1/UbiB-kinase-family-protein	gnl\|CDD\|223733	COG0661, AarF, Predicted unusual protein kinase [General function prediction only].	2.90771e-93

>CP033561.1|AZC09557.1|1548244_1549249_-|LLM-class-flavin-dependent-oxidoreductase
MRSLQDTKFSILELAPIRDDKTIEFSLRHALELAQHAEKLGYDRFWLAEHHNMDGIASSATAVLLGFIAAHTQRIRLGSGGIMLPNHAPLVVAEQFGTLATLYPNRIELGLGRAPGTDQVTMRALRRGHQETEDQFPRDVVEILQYFKVPEPGQRIVATPGQNTHVPVWLLGSSLFSAQLAARLGLPYSFASHFAPRMLGQAIELYRENFEPSEYLDKPYISMGVPVVVANTDEEAQFLATSAYQRVLGLIRGESLKLKPPVTSMQGLWNTAEQLSVENFYQMAQIGSTETVRSGLEKLLATYEVDEFIFTCDVYDTNKRLDSFTRLMQLKSAN
>CP033561.1|AZC09556.1|1547021_1547486_+|poly-beta-1,6-N-acetyl-D-glucosamine-biosynthesis-protein-PgaD
MKNKQNNDIEVLDIPEYIDQPKYVKNKTANYTLQTVGWFCLMWLFFPLVSLFLWFYEGHLIYDYVWVDHISEVNTVLHLLLLISLSALVLILWASYNWLRFHGDDRRSKAPNSPVELLASQFMVSTESLSELQKSQRIILYYDDQGYLTRYDLK
>CP033561.1|AZC09555.1|1545777_1547025_+|poly-beta-1,6-N-acetyl-D-glucosamine-synthase
MRVLLDILFAFAFLYPLLMAWTWMVGGLWFFFKREYHEQQLPEPSNEGCSIIIPCFNEEAQVRQTIRYALQTKYPNFEVIAVNDGSSDRTAEILDELAAQDTRLRVVHLAENQGKAVALRSGVLVSKYEYLVCIDGDALLHPHAVLWLMQPFLKFPRIGAVTGNPRILNRSSILGKLQVGEFSSIIGLIKRAQRTYGRIFTVSGVIVAFRKTALVRVGFWSDDKITEDIDISWKLQMDHWDIQYIPQALCYIYMPETFKGLWKQRLRWAQGGVEVLLEYIPKMFKIRLRRMWPVMLEALVSIVWSYVMIFIFLLFLIGLFIDLPQQWQINSLMPQWYGVILGGTCLIQFLVSLWIDHRYDRGRLFRNYFWVIWYPLFFWLLTLFTSVVAVPKTIFNTKKRARWVSPDRGFRGDNS
>CP033561.1|AZC09554.1|1540286_1541123_+|phosphoenolpyruvate-synthase-regulatory-protein
MSESKQFKRSVFFISDGTAITAETLGHSLLAQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTRDGCLPLVFDTLVDPHVREIINTAKAVNLDVFEGLISKLEQELGTPPTTLVGQTHAVTDSEYYKARIDAVHFALDNDDGARTRHYDKADLILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDLDDNRLPAVLREHRSKLFGLMIDAERLVAIRSERKANSRYASFSQCQMELRAIEGIYISEGIKYLNVTEMSIEEISTRILQMTGLKRRIG
>CP033561.1|AZC09553.1|1532610_1532940_-|cytochrome-o-ubiquinol-oxidase-subunit-IV
MSSHEHNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGFSRGLLVTVIAITAVAQVLVQLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMMI
>CP033561.1|AZC09552.1|1531722_1532580_-|protoheme-IX-farnesyltransferase
MTKPGILFGNFVTTLGGFFLAAQGSIDILLLLLTLIGTTLVVASGCVVNNVIDQDIDTKMQRTQNRALVKKTISPTVALIYAFVLGIIGFSILWFGVNGYAFLFAVIGFVVYVGFYSLWTKRTSIHQTVIGSISGASPPVIGYTAVTHQFDVAALLLFLAYGLWQMPHSWAIAIYRFDDYKNAGIPILPVARSIYRTKIECVIYILLFAAVLNGLYCFGYTNVFFLITFNALTAYWFYLSIIGFKAENDQLWAKRFFLYSVILITLLSLSFSFTYQSPAPNLPLF
>CP033561.1|AZC09551.1|1531157_1531541_-|30S-ribosomal-protein-S6
MRHYEIVLLVHPDQSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHYILMNVECGQTTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAEEKRARKAQREEAQQVAQEAE
>CP033561.1|AZC09550.1|1530918_1531146_-|30S-ribosomal-protein-S18
MARFYRRRKFCRFTAENVAYIDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLSLIPYTDNHK
>CP033561.1|AZC09549.1|1530400_1530910_-|50S-ribosomal-protein-L9
MDVILLQRIKNLGKLGDKVSVKAGYGRNFLIPQGKAVAATEANTAAFEARRAELEKQEAEVLAAAQARAEQLNEVNIVITAKAGDEGKLFGSIGTRDIADALTNAGLTVDRAEVRLPNGALRHTGEFNIAIQLHHDVVAEVLVTIVSEYFSSKRACSRMLFFLSLKFMK
>CP033561.1|AZC09548.1|1526923_1527658_+|peptidase
MTYCCALRLEQGLVFISDTRTNAGVDHISVFRKLHTFGVTGERFIALQTAGNLATTQAVIGHLQNALTLQQEPNLYSINTMFEVADLVGKTLKNVLEDISSDTQEQMNYACSILVGGQIKGGDMQLYNVYPQGNFICATTDTPYFQIGESKYGKPILDRALYYAMPLDDALRCSLISFDSTLRSNVSVGLPLDALVYSRDSFVIPMGKRISEDDPYFSQISRQWSDTLRRGLQEMPKPTDDYWR
>CP033561.1|AZC09558.1|1550116_1550536_-|hypothetical-protein
MKLNALLCSAVLATSMMTVAHADNTTHVAAASALGSVAGTAIGKSMGGTSGATIGAALGGAGGAAVASDRRHRTESAIGGGLGGGAGYTVGKSMGGTNGGYIGAALGAAGGGALGNKIAKDRDYDRSSKHWKKKHRHHH
>CP033561.1|AZC09559.1|1553968_1554784_+|peptide-chain-release-factor-N(5)-glutamine-methyltransferase
MNIAQALAIRGEPDSYERQENAWLLEHFLKINSLELKFRLEQELTPQQEQEYLAGLERIQNGEPLAYVTGSQPFWTLDLKVTSDTLVPRPDTEVLVETVLNLNLPKNANIVDLGTGTGAIALALASERPNWQVTATDIYAPTLEVAKENAQTHGLQHVKFACGAWFEALELQQFDLIVSNPPYIDPEDEHMQALATEPRRALVADHQGLADIEIIIAQGKNWLKPQGWIVLEHGYDQGQAVRGIFTEHGFSEIKTIQDYGQNDRVTLARWI
>CP033561.1|AZC09560.1|1554786_1555626_-|ABC-transporter-permease
MSDSLNKAELNHFLAQQALKSQKNHLNNKFTRWFKALLIPLIFLVGCEFLVRNGYINAYLLPAPSSLWQSFLDLAHTDLFAHIYISTWRVLFGFIIGSGLGLIFAIWVGLSKEAEAYLEPTFSAIKSIPSLAWIPLLLLWLGIDEGSKITLIAIGAFFPTYTNTVAAIHNVDKKLIEVGKVYRLNAFQRVLSIILPAASPGILTGLRNSLSLSWMFMIAAELIAATQGIGYLLSDGRETSRPDIVIIAIILLALLGKITDSLMKLIENWLLRWRDTLQK
>CP033561.1|AZC09561.1|1555629_1556604_-|aliphatic-sulfonate-ABC-transporter-substrate-binding-protein
MSLKSKFSLPKTLLASTLGFVFASSTFAAIPTTLKLDYAYYAPTSLVVKDQKLLEKALPNTQIKWVFSQGSNRSLEYLNSNSIDFASTAGLAAVLSRANGSPIKTVYVQSQPEWTALVVSKNSPIKSLKDLKGKKIAATKGTDPFLFTLQALETVGLSKRDVQLVHLQHPDGKTALERGQVDAWAGLDPLMASAQIQSGAKLLYRNVGFNSYSVLSVKEDFAKQSPEAVEAVIKAYEQARKWAKANPDKVAALLAQESKLPLPVAKLQLSRTNFDQSIPSATQAQALKRSGKILTEEDLVRKGTNVNQVVDQLLDPRFAQKVVK
>CP033561.1|AZC09562.1|1561873_1562452_-|flavin-reductase
MSQSYIAPVELEKAYRLLNHGPTVLVSAQHGDDRNVMAAAWACALEFKPAKVSVVLDKSTKTRQLVEQSGYFTLQVPCYAQLNMTKQLGTISKLDAPQKLEHCGVELFYQKDLTSPLVSGCIAWLVCKLIPEPHNQSAHDLFIGSVVGAWADSRVFRDGHWHFQDAPKELRSLHYIAGGTFYLIGEEVKADL
>CP033561.1|AZC09563.1|1562621_1563398_+|HesA/MoeB/ThiF-family-protein
MTELQDIDFVELSDEEMHLYSRQILLDGWDIEAQEKLKLANVLIVGAGGIGCSSAELLARAGVGKITLIDVDTIEISNLQRQIAFGHEDIGHYKAEVLAKRLQKINPYICVEYFNERLDEHNIDRLVEHQDVVLDGCDNFTTRYLVNSACKKHQVALISASAIGFQAQMFMVEGDSACYECLFPKEQHDNEGLRCAESGVLATTPVMIASLQAHHTLLYLGLNRTPLKQKLLLWDGLNMSQRIVNFDKDINCPLCQAS
>CP033561.1|AZC09564.1|1563440_1564754_+|AarF/ABC1/UbiB-kinase-family-protein
MVLKKYEKNILFDGLRSVARIGETAVVAAKAGIKYATDKPSNAKLMRETFESLGSTYIKLGQFIASTPSLFPREYVEEFQGCLDQTPTLPFSYIQGVLASEFEGRDLSEIFSYIDEKPLASASIAQVHAAKLTTGEDVVIKVQKPGVETILYTDLNVVHWAAKLLERAVPKIKFAALSDIVDEIKTRMVREVDFIEEAQNLDDFVEYLNISQNQAATAPKVYHQFSTRRVLTMQRLYGVSLTDFSVVKQYAKDPSQVLITAMNTWFGSLMLCKSFHADLHAGNLMLLEDGRIGFIDFGIVGQLKPEVWTACIAFMDALQKTDYQAMAENMLKMGMTHNKVDVQVLAQDLERLFNGVLMADPQQILSTNPADLNDIMMDMVGVGERHGIKFPRDFALLFKQMLYFDRFMRVLAPYTDIYADQRLKMVQNMEPASLLKH
>CP033561.1|AZC09565.1|1564769_1565150_+|dihydroneopterin-aldolase
MDAIIIEGLKVETVIGCFNWERQIIQPLMLDLTIHNDLSRAAASDKLEDTLNYAQICELSAQTIQQAKPELIEHAAHLVLQCLFETFPTIEKITITIRKPAIIAEANAVGIRLERTRNNFCARPSE
>CP033561.1|AZC09566.1|1567623_1569561_+|K(+)-transporting-ATPase-subunit-B
MQLKNPVMAIVWLGTVITALSTLMGYATLVFGLVVTAILFITILFANYAEAVAEARGRGQASSLRAARENLTARRLNSLTDRQATQVAATELHLNDYIEVHAGELVPADGEIVEGFATINESAVTGESAPVLREAGTDRSGVIGGTKVLTDRIVVQVTAESGQSFLDRMIALVEGSNRQKTPNEIALGFLLMVMTITFLIVVISLPFIAHYLHIELDPVVLVALLVCLIPTTIGGLLPAIGIAGMNRALKANVLAKSGKAVEVAGDIDVLLLDKTGTITYGDRQATSFYPLTSVSESELRAAVWVSSLADPTPEGKSIVKLAKEQGLKQQEPEQAEFISFSASTRISGVNLPNGEQIRKGALDAILKFVDEDYSQDLELKARVEQVAKKGATPLVVANQHHVLGVIELSDVIKHGIKERFARLREMGIKTVMVTGDNPLTAAAIAAEAGVDDYIAEAKPEDKLACIRTEQQQGRLVAMVGDGTNDAPALAQADIGLAMNSGTQAAKEAGNMVDLDSDPTKLLAVVEIGKQQLITRGALTTFSLANDVSKYFAILPALFAAAIPQMQVLNVMHLASPNSAILSALIFNAIIIPLLIPIALRGVKFKPSTATQLLRRNMLIYGVGGVVLPFIAIKAIDVVIVQLFGL
>CP033561.1|AZC09567.1|1569574_1570180_+|potassium-transporting-ATPase-subunit-KdpC
MKTYAQNSEANLGQTLRASFGLLIFTLVGCGAVYSAIATGAGQVLFHNQANGSLIEIDHKVLGSKLVAQPFVGEAYFHPRPSAVAYDPMAMGATNLALTNPELQKQIDAQILEVKKQDHTSSTAIPSDLVTKSGSGIDPHISPESAQIQVARVAQARHLDPKVVEELLQKHIEPVQFGVLGQARVNVLELNIALDQLQSTH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033561_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033561_2

2195529-2195643

Orphan

Consensus_repeat	Method
GTCTTCTTGCGAAGCTTTAGTCACTTCTCAGGACAAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033561_2

>merge|CP033561|2|2195529-2195643|CRISPRCasFinder
GTCTTCTTGCGAAGCTTTAGTCACTTCTCAGGACAAAGAATGCTTTATTTATCCTCTTCCACTCGAGCACAGCTCTCGTCTTCTTGCGAAGCTTTAGTCGCTTCTCAGGACAAAG

>CP033561|2|2|2195529-2195643|CRISPRCasFinder
GTCTTCTTGCGAAGCTTTAGTCACTTCTCAGGACAAAG	AATGCTTTATTTATCCTCTTCCACTCGAGCACAGCTCTC
GTCTTCTTGCGAAGCTTTAGTCGCTTCTCAGGACAAAG

Protein	Signature genes	Signature genes Name	Protein_function
CP033561.1\|AZC09832.1\|2181596_2181878_-\|DUF971-domain-containing-protein	unknown	unknown	gnl\|CDD\|226066
CP033561.1\|AZC09840.1\|2200504_2201563_-\|2,3-butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP033561.1\|AZC09845.1\|2207705_2208692_+\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
CP033561.1\|AZC09836.1\|2188069_2188813_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
CP033561.1\|AZC09831.1\|2175467_2175653_-\|hypothetical-protein	unknown	unknown	unknown
CP033561.1\|AZC09841.1\|2201592_2202378_-\|acetoin-reductase	unknown	unknown	gnl\|CDD\|187624
CP033561.1\|AZC09834.1\|2184589_2186020_-\|nitrate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270277
CP033561.1\|AZC09828.1\|2168173_2168878_+\|CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|224702
CP033561.1\|AZC09846.1\|2208849_2209989_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|183114
CP033561.1\|AZC10819.1\|2198416_2199478_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
CP033561.1\|AZC09833.1\|2181861_2182860_-\|HEAT-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|237512
CP033561.1\|AZC09839.1\|2197319_2197967_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP033561.1\|AZC09829.1\|2171115_2172288_+\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238383
CP033561.1\|AZC09830.1\|2172347_2173244_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176148
CP033561.1\|AZC09844.1\|2206378_2207341_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	unknown	unknown	gnl\|CDD\|238958
CP033561.1\|AZC09835.1\|2186039_2186285_-\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|224069
CP033561.1\|AZC09837.1\|2190489_2191098_-\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|234675
CP033561.1\|AZC09842.1\|2202404_2203808_-\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
CP033561.1\|AZC09838.1\|2195654_2197310_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|350353
CP033561.1\|AZC09843.1\|2203818_2205345_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|237001

Protein	Function_ID	Function_description	E-value
CP033561.1\|AZC09832.1\|2181596_2181878_-\|DUF971-domain-containing-protein	gnl\|CDD\|226066	COG3536, COG3536, Uncharacterized protein conserved in bacteria [Function unknown].	1.29035e-16
CP033561.1\|AZC09840.1\|2200504_2201563_-\|2,3-butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
CP033561.1\|AZC09845.1\|2207705_2208692_+\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
CP033561.1\|AZC09836.1\|2188069_2188813_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.17942e-74
CP033561.1\|AZC09841.1\|2201592_2202378_-\|acetoin-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.14898e-114
CP033561.1\|AZC09834.1\|2184589_2186020_-\|nitrate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270277	cd13559, PBP2_SsuA_like_3, Putative substrate binding domain of sulfonate binding protein-like, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.283e-133
CP033561.1\|AZC09828.1\|2168173_2168878_+\|CoA-transferase-subunit-A	gnl\|CDD\|224702	COG1788, AtoD, Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism].	3.13474e-112
CP033561.1\|AZC09846.1\|2208849_2209989_+\|transcriptional-regulator	gnl\|CDD\|183114	PRK11388, PRK11388, DNA-binding transcriptional regulator DhaR; Provisional.	3.13876e-09
CP033561.1\|AZC10819.1\|2198416_2199478_+\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	1.12502e-121
CP033561.1\|AZC09833.1\|2181861_2182860_-\|HEAT-repeat-domain-containing-protein	gnl\|CDD\|237512	PRK13800, PRK13800, fumarate reductase/succinate dehydrogenase flavoprotein subunit.	5.70788e-18
CP033561.1\|AZC09839.1\|2197319_2197967_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	2.3041e-77
CP033561.1\|AZC09829.1\|2171115_2172288_+\|thiolase-family-protein	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	0
CP033561.1\|AZC09830.1\|2172347_2173244_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176148	cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.53592e-83
CP033561.1\|AZC09844.1\|2206378_2207341_-\|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP033561.1\|AZC09835.1\|2186039_2186285_-\|ferredoxin-family-protein	gnl\|CDD\|224069	COG1146, COG1146, Ferredoxin [Energy production and conversion].	8.24428e-10
CP033561.1\|AZC09837.1\|2190489_2191098_-\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	8.344e-85
CP033561.1\|AZC09842.1\|2202404_2203808_-\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
CP033561.1\|AZC09838.1\|2195654_2197310_-\|TIGR01244-family-phosphatase	gnl\|CDD\|350353	cd14503, PTP-bact, bacterial tyrosine-protein phosphataseS similar to Neisseria NMA1982. This subfamily is composed of bacterial tyrosine-protein phosphatases similar to Neisseria meningitidis NMA1982, which displays phosphatase activity but whose biological function is still unknown.	4.0018e-39
CP033561.1\|AZC09843.1\|2203818_2205345_-\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|237001	PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.	6.80465e-113

>CP033561.1|AZC09837.1|2190489_2191098_-|FMN-dependent-NADH-azoreductase
MKLLQIDTSILGEQSVSRQLTSSVTGKLSAAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNETAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQAALDNAAAQIAQLAG
>CP033561.1|AZC09836.1|2188069_2188813_-|GntR-family-transcriptional-regulator
MSQLPQDPKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELKQVPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLSEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>CP033561.1|AZC09835.1|2186039_2186285_-|ferredoxin-family-protein
MAFIFKEVQHRTVAPVIIDEDKCIADKGCTVCVDVCPMDLLAIDPTTQKAYMQFDECWYCMPCEKDCPTDAVKVNIPYLLK
>CP033561.1|AZC09834.1|2184589_2186020_-|nitrate-ABC-transporter-substrate-binding-protein
MRQNKLINKKLLLSSLIGAMVLGTLGCGSKTETVRVAIGTQDTTINCATGGLLIRELNLLPKYLPKDGEYKNAKYDIQWKNFTSGAPLTSEMVAGRLDLGAMADFPAVNNLAAFKKAGKESIFLAPLSGSINGSGNAIVVPIDSKVTSLKELKGQTISVPFASTAHGLLLRAIQAEGWQLDKDIKVIAQAPEVAGPALKSHKIAAHADFVPFGELFAYQGFAKKIYDGSQAKSPTFHGSLASKDYAQQHPEVIKAYLQATIEANRLIQEQPEKYSELIAEKTGIPAEVVYLFHGPLGLQTRDLTWKPEYRKATQIAIDTLKVLGKNDGTLALNKFINDQYIKDAFQASGLNYSQQLADYAKSPLVANDALTGQPIKTFDRVTQIWVKGEEKVRSYETPEHAFSDLKKIQANGKTVRVVYSQDHQSNIKLLANLAWYATDKAGQIQAFLLKDDAEKWAKQQGGKVYDFKAIQLVTQS
>CP033561.1|AZC09833.1|2181861_2182860_-|HEAT-repeat-domain-containing-protein
MSFYYQALDDFDEYNQEFLTQLNHADEKIRFVALMNIGDEESPDLLPWLHTALQHDSSALVREEAAKKLESWEDPTSLQVLAQALFDADLNVRQAASQSLSEVKNAASAQILAPYLKHTDTFALSAILRALKPLRPQQLFEEISALVHHEDVLVRREAVSALSWLQQDQAIKILAKTAETDVDDEVRRIATGGLAYSQSISAEVIQALQHSLTSESWQLRVEAALTIGKLRIVQLEAPLIHAVSDLYWQVRIAAVRSLGLLKSHLAVAHLTDNFKHEISNLRKEVALALGEIGTSEAQNLLEQHQNDSDPEVRKAIRIGLNQIGEVKYANQT
>CP033561.1|AZC09832.1|2181596_2181878_-|DUF971-domain-containing-protein
MQIRPDIHVDTINKQVHFIWTDGSSVYLSHQSLREICPCGFCRAKRIKQIKIEHQNVEVTAMFDQGYGAQICFNDGHDKGIFPWAFLKEFAKS
>CP033561.1|AZC09831.1|2175467_2175653_-|hypothetical-protein
MLKVIGALLILGSFTCYLLIGNEEKTETKSSHMLKEAEQSIKNAELSIQKAKQNIPTASYK
>CP033561.1|AZC09830.1|2172347_2173244_-|LysR-family-transcriptional-regulator
MFDLDSRLLNIFYHIYRFKSVSMAADAIGLTQPSVSNGLNKIRQHFNDPLFIRVGNEMIPTELAKQIFPLISEVIDKVESINNFNVNFDPLTSDQLFTIAMTDVSHLVLLPQLTNYLKEKAPLIRLNIRPITPETSYQMANGEIDLAIGFLPQLEEGFYQQKFFRQHYVVISSKSHPRLDPNNFTLEDYMREYHIDIDAGIGHYHIKNELQNKGLDRNILIRLPSYLGVGLVVQETDAIATVPYYLSQVLLVRENLQILPAPLDFPTYDVKQHWHMSCHHKSSHKWFRQTCYELFKTA
>CP033561.1|AZC09829.1|2171115_2172288_+|thiolase-family-protein
MSSIVIVSGSRTAMGGFQGSLSSLTAPELGAAVIRESIQRAGVKPEQIDEVIFGCVLSAGIGQGPARQAMRKAGVPDHVGAVTINKLCGSAMKAVLMASDTLKAGSANIIVAGGMESMTNAPYILPKARGGYRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTKGFTREQMDDFAISSLKKAQTAITEGYFKEEIVPVEVKTRKGVEVVDQDEQPLKANLEKIPTLRPAFSKDGTITAANSSSISDGAAALVLTTEEYAQSHGLNTLAKIVATSTHSQHPSEFTIAPISAIQKVLERAGWSVDEVDAWEINEAFAMVAMAPIHELGIDEAKVNVHGGACALGHPIGATGSRIILSLIYALKRLGKKKGVAALCIGGGEATAVAIEI
>CP033561.1|AZC09828.1|2168173_2168878_+|CoA-transferase-subunit-A
MNKVYANPEAALKDVIADNQTLAVGGFGLCGIPEKLIIAVKQSGVTGLTCISNNAGVDDFGLGILLQTKQIKKMISSYVGENKEFERQYLNGELEVELTPQGTLAEKLRAGGAGIPAFYTQTGVGTLIAEGKEERTFHGKNYILEESLTADVALVKAYKADKAGNLVFRKTAQNFNPECAMAGKITIAEVEQVVEIGELDPDEIHLPGIYVNRIVLNASPEKRIEHKTLSTEAV
>CP033561.1|AZC09838.1|2195654_2197310_-|TIGR01244-family-phosphatase
MELKRVNQDFYVAGQITADDIAKIADQGVKTLICNRPDGEGADQPNVIEIEEAAQQYGLNVIYQPVTSGKITDQQVTEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPSNAALLVESGNKLGFNLKGLVPRILKRDHEPATIPCYSVVIVGAGAAGISVASSLLCREPHLDIVIIDPADTHYYQPGWTMVGGGIFKPQVTARSMTSVIPSKVKWMKAAVAGFDPEHNQVILEGCQPIQYKALVVCPGLKLNWHGIEGLVETLGKNGVTSNYRYDLAPYTWELVQQLNGGKAIFTQPPMPIKCAGAPQKAMYLSADYWLKQGKLKDISIHFYNTGAVLFGVKEYVPALMQYVEKYGTELHFNHQLVKVDGPAKKAWFKVVNDENAALVETDFDMLHVVPPQQAPDFIRASTLTDEAGWVSVNPQTLQHTQHANIFALGDVMNAPNAKTAAAARAQAPIVAVNVITQLKGEQNFCEYNGYGSCPLTVERGKIVLAEFGYGGKLLPSFPKWVIDGQKPSRLAWLLKEQILPPIYWQGMLKGREWMVKPERG
>CP033561.1|AZC09839.1|2197319_2197967_-|MBL-fold-metallo-hydrolase
MLGCEETREVILIDPVASDIEIYTKELERHQFTLIYTLDTHVHADHITAANLLRERFHCKSVLHRNSDVNCGDILITDGCMLKVGNLSIEARYTPGHTNACTSYLVGNMVFTGDALLIDGCGRTDFQQGSAGTLYDSIHKQLFSLPDETIVYPGHDYKGRLSSTIGNERLNNSRLGQNRSREDFIKLMNNLNLPYPKQIDKALPANQACGSTSQS
>CP033561.1|AZC10819.1|2198416_2199478_+|sigma-54-dependent-Fis-family-transcriptional-regulator
MRKRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIADQVELTEQLQDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNANILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQILLNYDWPGNVRELKNTLLYALTMANGKVEIEVEDLPNELLNAEDYVKLPEINTELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>CP033561.1|AZC09840.1|2200504_2201563_-|2,3-butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPSCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAFVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP033561.1|AZC09841.1|2201592_2202378_-|acetoin-reductase
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQREHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>CP033561.1|AZC09842.1|2202404_2203808_-|dihydrolipoyl-dehydrogenase
MSEAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEERHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDIQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFSGRAQLTAKEKIEVTDAQGNSQALSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVLTDAVVQSIQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAIICVEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP033561.1|AZC09843.1|2203818_2205345_-|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEVSDAEIEKFIASLGGSAAQAPSEQSKAETSAPVAEKAEQPQTVAASASAPAKVAKDDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLVKVTGSGREGRISVQDIQKTVQAAGGQWPDVKQQTQTKVVKSTADDSQILATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPTPLNEQAVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP033561.1|AZC09844.1|2206378_2207341_-|thiamine-pyrophosphate-dependent-dehydrogenase-E1-component-subunit-alpha
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP033561.1|AZC09845.1|2207705_2208692_+|lipoyl-synthase
MDLKRQIETGIKLRGIDKVSRIPIKILPTEELPKKPEWIRAKITDFEEIQRIKNLLRQQKLHSVCEEAACPNLPECFGGGTATFMIMGDICTRRCPFCDVAHGRPMPLDENEPKHLAETVANLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRNRCPDTLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYEHSLNLLKRFKKYCPDIKTKCGLMVGLGEIEAEVIALLNDLKDHDVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTQHGQRLGFKNIWSAPMVRSSYFADRQYFGEPAPKPFSREDVLS
>CP033561.1|AZC09846.1|2208849_2209989_+|transcriptional-regulator
MDMSKQLLLPSTDNLPSFFRPETISETPCLGKKPSLDLDAAPIFDLDHEWQHSLFGRSIQECHRNLMHIAEDADMAIGVTDPHGTLLWTWSSTPMRSSAEQVHFVEGGQWSTQAVGQNAIGLALNTHSASCVYSHENQMNSVRDWVCYAAPITDANTGQFYGIMNLSTKYQKHNSLGILAVERCADIVKQAIQLHQKNILYIKALGTPKVQYNQHGLTLTQRQIEILCILALCPEGINLEELHYALYGDRPVSTTTLKAELSQLRNLIPDVIESRPYRLNCEIQCDFLMAEQALNLGFTATTLTLYRGSFLAKSESPFLCAWRDCFDARLSHVIYQIDDVDQLLRVVSRVPDRVDAVERLLELLPEETPYRAKLLKLLE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

521756 : 587087

uncultured_Caudovirales_phage(33.33%)

tRNA,tail,integrase,protease

attL 520777:520793|attR 570645:570661

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
520777:520793	attL	NA	NA	NA	NA
AZC09086.1\|521756_522185_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	6.4e-31	50.0
AZC09087.1\|522191_522845_-	starvation protein A	NA	NA	NA	NA
AZC09088.1\|523016_523403_-	30S ribosomal protein S9	NA	NA	NA	NA
AZC09089.1\|523415_523844_-	50S ribosomal protein L13	NA	NA	NA	NA
AZC09090.1\|525023_525560_+	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AZC09091.1\|525522_525837_+	hypothetical protein	NA	NA	NA	NA
AZC09092.1\|526719_527163_-	DUF2147 domain-containing protein	NA	NA	NA	NA
AZC10753.1\|527247_527922_-	LrgB family protein	NA	NA	NA	NA
AZC09093.1\|527932_528304_-	hypothetical protein	NA	NA	NA	NA
AZC09094.1\|529887_530649_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZC09095.1\|530696_532322_-	phospholipase D family protein	NA	NA	NA	NA
AZC09096.1\|533489_533969_-	OmpA family protein	NA	NA	NA	NA
AZC09097.1\|535212_535716_-	YfiR family protein	NA	NA	NA	NA
AZC09098.1\|543267_544749_+	hypothetical protein	NA	NA	NA	NA
AZC09099.1\|545038_545374_-	TIGR01244 family phosphatase	NA	NA	NA	NA
AZC09100.1\|546904_547321_+	acyl-CoA thioesterase	NA	NA	NA	NA
AZC09101.1\|547971_548466_-	DUF4442 domain-containing protein	NA	NA	NA	NA
AZC09102.1\|551338_551818_-	hypothetical protein	NA	NA	NA	NA
AZC09103.1\|551822_552125_-	hypothetical protein	NA	NA	NA	NA
AZC09104.1\|552159_552774_-	septation protein IspZ	NA	NA	NA	NA
AZC09105.1\|553676_554588_-	bestrophin	NA	NA	NA	NA
AZC09106.1\|556789_557755_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.2e-31	32.7
AZC09107.1\|559715_560045_-	preprotein translocase subunit YajC	NA	NA	NA	NA
AZC09108.1\|563362_564400_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AZC09109.1\|564822_565893_+\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	9.1e-42	35.8
AZC09110.1\|565898_566198_-	hypothetical protein	NA	NA	NA	NA
AZC09111.1\|566972_567284_-	hypothetical protein	NA	NA	NA	NA
AZC09112.1\|567288_567558_-	hypothetical protein	NA	NA	NA	NA
AZC09113.1\|570376_570568_-	hypothetical protein	NA	NA	NA	NA
AZC09114.1\|570660_571002_+	XRE family transcriptional regulator	A0A2H4J8M8	uncultured_Caudovirales_phage	5.5e-09	43.8
570645:570661	attR	NA	NA	NA	NA
AZC09115.1\|571028_571982_+	hypothetical protein	NA	NA	NA	NA
AZC09116.1\|572017_572233_-	hypothetical protein	NA	NA	NA	NA
AZC09117.1\|572349_573183_-	DUF2158 domain-containing protein	Q8H9L9	Vibrio_phage	3.5e-33	74.2
AZC09118.1\|573977_574388_+	hypothetical protein	NA	NA	NA	NA
AZC09119.1\|574384_574567_+	hypothetical protein	NA	NA	NA	NA
AZC09120.1\|576181_576625_+	hypothetical protein	NA	NA	NA	NA
AZC09121.1\|576618_577146_+	hypothetical protein	NA	NA	NA	NA
AZC09122.1\|577168_577813_+	SOS response-associated peptidase	A0A218MNF5	uncultured_virus	5.4e-66	55.5
AZC09123.1\|577922_578465_+	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	1.7e-44	57.9
AZC09124.1\|578421_579717_+	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	1.6e-157	62.6
AZC09125.1\|580007_580208_-	conjugal transfer protein TraR	NA	NA	NA	NA
AZC09126.1\|580572_581886_-	DNA primase	A0A2H4JAV0	uncultured_Caudovirales_phage	1.6e-96	42.9
AZC10754.1\|584831_585032_-\|tail	GpE family phage tail protein	NA	NA	NA	NA
AZC09127.1\|584958_585312_-\|tail	phage tail assembly protein	E5FFG7	Burkholderia_phage	4.1e-15	50.0
AZC09128.1\|585380_585899_-\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	3.3e-53	59.6
AZC09129.1\|585911_587087_-\|tail	phage tail sheath protein	A0A077K9Y4	Ralstonia_phage	3.2e-149	67.6

DBSCAN-SWA_2

1163200 : 1169250

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC09369.1\|1163200_1164349_-	D-alanyl-D-alanine carboxypeptidase PBP5/6	B6DZZ7	Stx2-converting_phage	2.0e-63	36.8
AZC09370.1\|1165854_1166358_-	class I SAM-dependent methyltransferase	A0A0N7IRF6	Acinetobacter_phage	9.1e-69	75.0
AZC09371.1\|1166332_1166542_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	3.7e-32	94.2
AZC09372.1\|1166538_1167045_-	hypothetical protein	A0A1B1P9F6	Acinetobacter_phage	5.6e-82	92.2
AZC10786.1\|1167317_1167938_-	hypothetical protein	A0A2H4JDC0	uncultured_Caudovirales_phage	5.6e-76	65.1
AZC09373.1\|1168063_1168312_-	hypothetical protein	NA	NA	NA	NA
AZC09374.1\|1168311_1169250_-	hypothetical protein	A0A2H4JAZ0	uncultured_Caudovirales_phage	4.3e-144	83.7

DBSCAN-SWA_3

1247253 : 1250885

Acinetobacter_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC09414.1\|1247253_1247838_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.7e-111	100.0
AZC09415.1\|1247952_1248222_-	hypothetical protein	A0A0P0J067	Acinetobacter_phage	5.6e-41	97.8
AZC09416.1\|1248256_1249054_-	hypothetical protein	A0A0E3M3Z6	Verrucomicrobia_phage	7.5e-65	50.6
AZC09417.1\|1249050_1249353_-	hypothetical protein	NA	NA	NA	NA
AZC09418.1\|1249349_1249559_-	hypothetical protein	A0A0P0IRG7	Acinetobacter_phage	5.9e-30	91.2
AZC09419.1\|1249555_1249993_-	DUF551 domain-containing protein	A0A1B1P9F6	Acinetobacter_phage	9.2e-33	76.6
AZC09420.1\|1250004_1250268_-	hypothetical protein	NA	NA	NA	NA
AZC10789.1\|1250264_1250885_-	hypothetical protein	A0A2H4JDC0	uncultured_Caudovirales_phage	5.6e-76	65.1

DBSCAN-SWA_4

1254293 : 1264689

Acinetobacter_phage(81.82%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC09424.1\|1254293_1254521_-	hypothetical protein	A0A0P0I8I5	Acinetobacter_phage	1.9e-26	96.9
AZC09425.1\|1255381_1255570_+	hypothetical protein	NA	NA	NA	NA
AZC10791.1\|1255588_1255888_+	hypothetical protein	NA	NA	NA	NA
AZC09426.1\|1256830_1257604_+	hypothetical protein	A0A2H4JAL8	uncultured_Caudovirales_phage	6.8e-71	57.5
AZC09427.1\|1258340_1258628_+	hypothetical protein	A0A1B1P9H6	Acinetobacter_phage	5.3e-05	33.7
AZC09428.1\|1258788_1259004_+	hypothetical protein	NA	NA	NA	NA
AZC09429.1\|1259183_1259387_+	hypothetical protein	A0A1J0MGM9	Acinetobacter_phage	4.0e-07	47.6
AZC09430.1\|1259447_1259786_+	hypothetical protein	A0A068CDI0	Acinetobacter_phage	2.5e-09	39.2
AZC09431.1\|1260325_1260559_+	hypothetical protein	A0A0P0J0G5	Acinetobacter_phage	1.1e-19	79.7
AZC09432.1\|1260555_1260858_+	hypothetical protein	NA	NA	NA	NA
AZC09433.1\|1260854_1261106_+	hypothetical protein	NA	NA	NA	NA
AZC09434.1\|1261105_1261390_+	hypothetical protein	K4I378	Acinetobacter_phage	1.5e-28	61.1
AZC09435.1\|1261399_1261963_+	hypothetical protein	A0A1B1P9I8	Acinetobacter_phage	5.3e-57	63.3
AZC09436.1\|1262089_1262332_+	hypothetical protein	NA	NA	NA	NA
AZC09437.1\|1262469_1262655_+	hypothetical protein	NA	NA	NA	NA
AZC09438.1\|1262825_1263110_+	hypothetical protein	A0A0D4DC07	Acinetobacter_phage	3.0e-37	80.2
AZC09439.1\|1263133_1263394_+	hypothetical protein	NA	NA	NA	NA
AZC09440.1\|1263446_1263929_+	hypothetical protein	A0A0D4DC11	Acinetobacter_phage	5.3e-58	67.5
AZC09441.1\|1264089_1264689_+\|terminase	terminase small subunit	A0A2H4J480	uncultured_Caudovirales_phage	7.6e-38	51.6

DBSCAN-SWA_5

2760761 : 2823310

Acinetobacter_phage(26.09%)

integrase,transposase,tRNA,terminase,head

attL 2765870:2765925|attR 2806822:2806877

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZC10082.1\|2760761_2761508_-	LPS export ABC transporter ATP-binding protein	W5SAS9	Pithovirus	8.6e-23	30.0
AZC10083.1\|2761507_2762056_-	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZC10084.1\|2762039_2762588_-	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZC10085.1\|2762625_2763165_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
AZC10848.1\|2763168_2764146_-	KpsF/GutQ family sugar-phosphate isomerase	A0A0A0Q3B9	Pectobacterium_bacteriophage	6.6e-23	33.7
AZC10086.1\|2764437_2765781_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	2.0e-54	30.7
2765870:2765925	attL	NA	NA	NA	NA
AZC10087.1\|2766134_2767148_+\|integrase	site-specific integrase	A0A0R6PHH4	Moraxella_phage	1.0e-66	40.3
AZC10088.1\|2767176_2767374_-	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	3.1e-12	71.1
AZC10849.1\|2768138_2768510_-	hypothetical protein	A0A2H4JFC0	uncultured_Caudovirales_phage	1.2e-30	52.0
AZC10089.1\|2770961_2771201_-	hypothetical protein	NA	NA	NA	NA
AZC10090.1\|2778383_2778572_-	hypothetical protein	NA	NA	NA	NA
AZC10091.1\|2778622_2778817_-	hypothetical protein	NA	NA	NA	NA
AZC10092.1\|2781710_2782181_-	DUF2833 domain-containing protein	W6MW30	Pseudomonas_phage	9.3e-15	28.8
AZC10093.1\|2782177_2784214_-	hypothetical protein	Q775D1	Bordetella_phage	1.4e-131	39.6
AZC10094.1\|2784775_2785081_-	hypothetical protein	NA	NA	NA	NA
AZC10095.1\|2785093_2785498_-	hypothetical protein	NA	NA	NA	NA
AZC10096.1\|2785511_2786534_-	hypothetical protein	Q775C7	Bordetella_phage	3.5e-91	50.6
AZC10097.1\|2786545_2787199_-	hypothetical protein	G9L6C4	Escherichia_phage	1.4e-13	34.9
AZC10850.1\|2789183_2789474_-	hypothetical protein	NA	NA	NA	NA
AZC10098.1\|2789546_2791169_-\|terminase	terminase	Q775B9	Bordetella_phage	1.1e-184	59.9
AZC10099.1\|2791152_2791422_-	hypothetical protein	NA	NA	NA	NA
AZC10100.1\|2791418_2791859_-	hypothetical protein	NA	NA	NA	NA
AZC10101.1\|2791885_2792602_-\|terminase	terminase small subunit	A0A1Y0SUQ3	Pseudomonas_phage	2.6e-45	45.9
AZC10102.1\|2792821_2793250_-	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	2.8e-50	73.4
AZC10103.1\|2794025_2794910_-	DUF1376 domain-containing protein	NA	NA	NA	NA
AZC10104.1\|2794906_2795275_-	hypothetical protein	NA	NA	NA	NA
AZC10105.1\|2795271_2796849_-	DNA cytosine methyltransferase	A0A1I9KFD6	Aeromonas_phage	1.8e-134	51.2
AZC10106.1\|2796845_2797067_-	hypothetical protein	NA	NA	NA	NA
AZC10107.1\|2797115_2797481_-	transcriptional regulator	J7I452	Acinetobacter_phage	7.4e-44	81.2
AZC10108.1\|2797489_2797678_-	hypothetical protein	NA	NA	NA	NA
AZC10109.1\|2797781_2798507_+	helix-turn-helix domain-containing protein	A0A0P0I8E0	Acinetobacter_phage	3.1e-62	49.6
AZC10110.1\|2798509_2798815_+	bZIP transcription factor	NA	NA	NA	NA
AZC10111.1\|2798979_2799354_+	hypothetical protein	C5IHK2	Burkholderia_virus	8.7e-08	35.6
AZC10112.1\|2799422_2800301_+	DUF2303 family protein	I6NVL7	Burkholderia_virus	1.6e-28	34.9
AZC10851.1\|2800430_2801003_+	hypothetical protein	NA	NA	NA	NA
AZC10113.1\|2801004_2801343_+	hypothetical protein	NA	NA	NA	NA
AZC10114.1\|2801351_2802332_+	recombinase	A0A0A7RWR9	Clostridium_phage	1.4e-49	35.7
AZC10115.1\|2804828_2805062_+	protein ninH	NA	NA	NA	NA
AZC10116.1\|2805733_2806030_+	hypothetical protein	NA	NA	NA	NA
AZC10117.1\|2809493_2810087_-	DUF4142 domain-containing protein	NA	NA	NA	NA
2806822:2806877	attR	NA	NA	NA	NA
AZC10118.1\|2811147_2811912_-	hypothetical protein	NA	NA	NA	NA
AZC10119.1\|2812255_2812579_-	hypothetical protein	NA	NA	NA	NA
AZC10120.1\|2812627_2813734_-\|head	phage head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	1.2e-142	65.5
AZC10121.1\|2815405_2816431_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-51	37.8
AZC10122.1\|2816488_2816608_+	hypothetical protein	NA	NA	NA	NA
AZC10123.1\|2817246_2817498_-	hypothetical protein	NA	NA	NA	NA
AZC10124.1\|2817780_2818002_-	hypothetical protein	NA	NA	NA	NA
AZC10125.1\|2819296_2819512_-	cold-shock protein	Q9AZD3	Lactococcus_phage	4.5e-17	66.7
AZC10126.1\|2820027_2820645_+	LysE family translocator	NA	NA	NA	NA
AZC10127.1\|2821298_2821688_-	hypothetical protein	A0A0P0IYC0	Acinetobacter_phage	4.8e-49	72.8
AZC10852.1\|2823079_2823310_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033561

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection