CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP031540	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107B, complete sequence	0 crisprs	RT	0	1
CP031538	Lactococcus lactis subsp. cremoris strain 3107 chromosome L3107, complete sequence	1 crisprs	WYL,cas3,DEDDh,csa3,DinG	1	12
CP031544	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107F, complete sequence	0 crisprs	NA	0	0
CP031539	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107A, complete sequence	0 crisprs	NA	0	0
CP031541	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107C, complete sequence	0 crisprs	RT	0	0
CP031543	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107E, complete sequence	0 crisprs	NA	0	1
CP031542	Lactococcus lactis subsp. cremoris strain 3107 plasmid p3107D, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3149 : 18326

Lactococcus_phage(46.15%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN66618.1\|3149_3908_+	chromosome partitioning protein	H7BUL8	unidentified_phage	1.6e-16	28.4
AXN66619.1\|3911_4640_+	chromosome segregation DNA-binding protein	Q4ZC37	Staphylococcus_virus	7.2e-06	27.7
AXN66620.1\|4669_5020_-	hypothetical protein	A0A182BQ76	Lactococcus_phage	2.3e-10	75.6
AXN66621.1\|5009_6476_-	DNA polymerase IV	Q6DMX4	Streptococcus_phage	7.7e-124	51.3
AXN66622.1\|7116_7449_+	type I restriction enzyme	NA	NA	NA	NA
AXN66623.1\|7846_8470_-	Transposase	A0A1X9I6C6	Streptococcus_phage	5.8e-89	78.7
AXN66624.1\|8545_9304_-\|transposase	transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
AXN66625.1\|9315_10539_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
AXN66626.1\|11674_11875_+	hypothetical protein	Q9AZK6	Lactococcus_phage	2.2e-05	53.8
AXN66627.1\|12005_12206_+	cold-shock DNA-binding protein family	A0A1X9IGI9	Lactococcus_phage	1.6e-13	54.7
AXN66628.1\|12482_12683_+	cold-shock DNA-binding protein family	Q9AZD3	Lactococcus_phage	9.6e-30	97.0
AXN66629.1\|13148_13439_+	Transposase	NA	NA	NA	NA
AXN66630.1\|13456_14296_+	Transposase	U5P429	Shigella_phage	1.6e-46	41.0
AXN66631.1\|14570_15170_-	Transposase	A0A1B1P773	Bacillus_phage	1.4e-31	38.7
AXN66632.1\|15166_15538_-	Transposase	NA	NA	NA	NA
AXN66633.1\|15849_16146_+	DNA polymerase	NA	NA	NA	NA
AXN66634.1\|16195_16426_+	hypothetical protein	NA	NA	NA	NA
AXN66635.1\|17645_18326_-	Transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-106	81.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP031538

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP031538_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP031538_2

2131739-2131834

Orphan

Consensus_repeat	Method
TCTTCCTCAATCTTCCCAATTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP031538_2

>merge|CP031538|2|2131739-2131834|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTTCCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATATTCTTCCTCAATTTTCCCAATTCTT

>CP031538|2|2|2131739-2131834|CRISPRCasFinder
TTTGCCAGAATCTTCCTCAATCTT	CCCAATTCTTTTAAAATAAACATTTACGCAAGTTATACTTAGTAATAT
TCTTCCTCAATTTTCCCAATTCTT

Protein	Signature genes	Signature genes Name	Protein_function
CP031538.1\|AXN66328.1\|2133510_2134269_-\|putative-transposase-helper-protein-for-IS712H	unknown	unknown	gnl\|CDD\|366760
CP031538.1\|AXN66319.1\|2121071_2122136_-\|ornithine-carbamoyltransferase	unknown	unknown	gnl\|CDD\|179366
CP031538.1\|AXN66320.1\|2122370_2123534_-\|arginine-deiminase	unknown	unknown	gnl\|CDD\|234949
CP031538.1\|AXN66317.1\|2116031_2117162_-\|aminotransferase	unknown	unknown	gnl\|CDD\|235989
CP031538.1\|AXN66316.1\|2114348_2115842_-\|arginine:ornithine-antiporter-APA-family	unknown	unknown	gnl\|CDD\|163522
CP031538.1\|AXN66321.1\|2123835_2125530_-\|arginyl-tRNA-synthetase	unknown	unknown	gnl\|CDD\|183534
CP031538.1\|AXN66330.1\|2135816_2136707_+\|transposase-for-insertion-sequence-element-IS982B	unknown	unknown	gnl\|CDD\|372648
CP031538.1\|AXN66329.1\|2134280_2135504_-\|transposase-for-insertion-sequence-element-IS712H	unknown	unknown	gnl\|CDD\|226950
CP031538.1\|AXN66323.1\|2126215_2127547_-\|UDP-N-acetylmuramate--L-alanine-ligase	unknown	unknown	gnl\|CDD\|234757
CP031538.1\|AXN66325.1\|2128563_2131656_-\|Superfamily-II-DNA/RNA-helicase-SNF2-family	unknown	unknown	gnl\|CDD\|350770
CP031538.1\|AXN66327.1\|2132567_2133248_+\|Transposase	unknown	unknown	gnl\|CDD\|225853
CP031538.1\|AXN66322.1\|2125597_2126056_+\|transcriptional-regulator-ArgR-family	unknown	unknown	gnl\|CDD\|130592
CP031538.1\|AXN66326.1\|2131864_2132485_-\|Integrase	unknown	unknown	gnl\|CDD\|271189
CP031538.1\|AXN66324.1\|2127747_2128347_-\|hypothetical-protein	unknown	unknown	unknown
CP031538.1\|AXN66318.1\|2117425_2118370_-\|carbamate-kinase	unknown	unknown	gnl\|CDD\|223623
CP031538.1\|AXN66333.1\|2138896_2139058_-\|hypothetical-protein	unknown	unknown	unknown
CP031538.1\|AXN66332.1\|2137888_2138668_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|373100
CP031538.1\|AXN66335.1\|2139493_2139775_-\|flavin-nucleotide-binding-protein	unknown	unknown	gnl\|CDD\|225998
CP031538.1\|AXN66331.1\|2136859_2137816_-\|Beta-lactamase-family-protein	unknown	unknown	gnl\|CDD\|365903
CP031538.1\|AXN66334.1\|2139129_2139459_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227933

Protein	Function_ID	Function_description	E-value
CP031538.1\|AXN66327.1\|2132567_2133248_+\|Transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	5.50015e-87
CP031538.1\|AXN66320.1\|2122370_2123534_-\|arginine-deiminase	gnl\|CDD\|234949	PRK01388, PRK01388, arginine deiminase; Provisional.	0
CP031538.1\|AXN66317.1\|2116031_2117162_-\|aminotransferase	gnl\|CDD\|235989	PRK07324, PRK07324, transaminase; Validated.	0
CP031538.1\|AXN66316.1\|2114348_2115842_-\|arginine:ornithine-antiporter-APA-family	gnl\|CDD\|163522	TIGR03810, arginine-ornithine_antiporter, arginine-ornithine antiporter. Members of this protein family are the arginine/ornithine antiporter, ArcD. This exchanger of ornithine for arginine occurs in a system with arginine deiminase, ornithine carbamoyltransferase, and carbamate kinase, with together turn arginine to ornithine with the generation of ATP and release of CO2. [Transport and binding proteins, Amino acids, peptides and amines].	8.34857e-152
CP031538.1\|AXN66319.1\|2121071_2122136_-\|ornithine-carbamoyltransferase	gnl\|CDD\|179366	PRK02102, PRK02102, ornithine carbamoyltransferase; Validated.	0
CP031538.1\|AXN66330.1\|2135816_2136707_+\|transposase-for-insertion-sequence-element-IS982B	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.24582e-26
CP031538.1\|AXN66331.1\|2136859_2137816_-\|Beta-lactamase-family-protein	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	3.4174e-51
CP031538.1\|AXN66323.1\|2126215_2127547_-\|UDP-N-acetylmuramate--L-alanine-ligase	gnl\|CDD\|234757	PRK00421, murC, UDP-N-acetylmuramate--L-alanine ligase; Provisional.	0
CP031538.1\|AXN66325.1\|2128563_2131656_-\|Superfamily-II-DNA/RNA-helicase-SNF2-family	gnl\|CDD\|350770	cd18012, DEXQc_arch_SWI2_SNF2, DEAQ-box helicase domain of archaeal and bacterial SNF2-related proteins. Proteins belonging to SNF2 family of DNA dependent ATPases are important members of the chromatin remodeling complexes that are implicated in epigenetic control of gene expression. The Snf2 family comprises a large group of ATP-hydrolyzing proteins that are ubiquitous in eukaryotes, but also present in eubacteria and archaea. Archaeal SWI2 and SNF2 are members of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.8857e-94
CP031538.1\|AXN66329.1\|2134280_2135504_-\|transposase-for-insertion-sequence-element-IS712H	gnl\|CDD\|226950	COG4584, COG4584, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.63091e-43
CP031538.1\|AXN66322.1\|2125597_2126056_+\|transcriptional-regulator-ArgR-family	gnl\|CDD\|130592	TIGR01529, Arginine_repressor., arginine repressor. This model includes most members of the arginine-responsive transcriptional regulator family ArgR. This hexameric protein binds DNA at its amino end to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbor-joining tree, some of these paralogous sequences show long branches and differ significantly in an otherwise well-conserved C-terminal region motif GT[VIL][AC]GDDT. These paralogs are excluded from the seed and score in the gray zone of this model, between trusted and noise cutoffs. [Amino acid biosynthesis, Glutamate family, Regulatory functions, DNA interactions].	4.3854e-60
CP031538.1\|AXN66326.1\|2131864_2132485_-\|Integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.33692e-09
CP031538.1\|AXN66328.1\|2133510_2134269_-\|putative-transposase-helper-protein-for-IS712H	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	3.89255e-62
CP031538.1\|AXN66318.1\|2117425_2118370_-\|carbamate-kinase	gnl\|CDD\|223623	COG0549, ArcC, Carbamate kinase [Amino acid transport and metabolism].	6.8032e-176
CP031538.1\|AXN66332.1\|2137888_2138668_-\|hypothetical-protein	gnl\|CDD\|373100	pfam14507, CppA_C, CppA C-terminal. This is the C-terminal domain of the CppA protein found in species of Streptococcus. CppA is a putative C3-glycoprotein degrading proteinase, involved in pathogenicity. It is often found associated with pfam14506.	3.1718e-25
CP031538.1\|AXN66335.1\|2139493_2139775_-\|flavin-nucleotide-binding-protein	gnl\|CDD\|225998	COG3467, COG3467, Predicted flavin-nucleotide-binding protein [General function prediction only].	3.51481e-10
CP031538.1\|AXN66321.1\|2123835_2125530_-\|arginyl-tRNA-synthetase	gnl\|CDD\|183534	PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed.	0
CP031538.1\|AXN66334.1\|2139129_2139459_-\|hypothetical-protein	gnl\|CDD\|227933	COG5646, COG5646, Uncharacterized conserved protein [Function unknown].	1.81818e-27

>CP031538.1|AXN66325.1|2128563_2131656_-|Superfamily-II-DNA/RNA-helicase-SNF2-family
MPARVRSEGIALYAKGFLNDPIETDFKLTAEIDGEEVSYDLDGAQDSCTCSIFQQNHRYCKHIAAIEEYLKNQDKGSLETKDKETKGAERGLYNENIAFLDAVNGETQLNFSTDQYSIEVQIEDNSQLYDYFSMDYFLYFDLKLKSKNLGRSYVIKDIPYFLRALKNYSQYSLGSLHYIDLFFDNFDEASQEFLSFLLKIDGKSDEALTKSLYIKNGRYLNIPFLFLEEAMDLVSALEVYQLKIIGRTVNYFTFIPLDNDSEIFKFKVESQQDYIELSLFSEDYHNFYDYSLLYDNNVFYKLSQEQRRLLLVLDKQFAQKSKIKFSYSEKDKLAQALQQLSTLGKIEAPEHFVVKPFDAKFTFDLLDEKTLSLAMKFDYGTFSIDSFHDLETLEFSRDLRKEQKIFALMERLQFAKAFNSTLEITEHLSENFFLKILPSFQKLGQIELSPTLRNMRMDEVPEIHIDSQGGLLDISFNIPHVEDGEFANVIAKLQENAEFYISESGKFYHFNEKFDRLKAALHELDDQFVIQGSSLHVNINRSFQISKIFEKISGASFSEKFKSLYQHLTHPEEFPYEKPEHIKASLRSYQETGVRWMSMLSHYNLGGILADDMGLGKTVQAITFILSNLKKDESVLITAPASLTYNWASEFEKFTDEIDFVVIDGNKADRTKEIQENHQIYITSYGSFLKDFEDYQDKKLNYLLLDEAQVVKNYSSKTNKSLSALNVEHTFALSGTPLENRIEEIWAIFQVVMPGFLPKREKFNKMEPSVISRLIQPFIMRRKKEDVLEELPEKMEITVYNQLADDQKVIYLAQLELMQKQVLEMDNAALSRSRIEILAGITRLRQICNTPALFMDDYKGSSGKLERLRELLAQIKDSGHRPLIFSQFTKVFPHIEKLMEEQEMTAYKLTGSTPIKDRLSMVQAFNAGSRDAFLVSLKAGGVGLNLTSADVVILVDLWWNPAVEEQAIARAHRMGQKNTVEVIRLITQGTIEEKIMEIQERKKDLIANVLEGDTVDKVLSEAEIREILGV
>CP031538.1|AXN66324.1|2127747_2128347_-|hypothetical-protein
MVERRVVFPVIGDDEVLQKDTRVIFTNQQLLTRNPSLQDEASIETSKSKTDAKRPESFKPYKAKTSFSTQHRPLNSNHAGVSSYDKMPKKTSVDESKERAKRAAATLPKPPKQYVSPLERDKEDLTVRRSTSAILNKRPSTNDNPIRDMKKQGMNVSDAVAKNGSGMKKATPHGGAANDTQKASYFENKRKNIFDRGIV
>CP031538.1|AXN66323.1|2126215_2127547_-|UDP-N-acetylmuramate--L-alanine-ligase
MEKTYHFTGIKGSGMSALALMLHQMGKNVQGSDSTDYFFTQRGLEQVGVPLLPFDEKNIKPEFELIVGNAFRDDNNVEIAFAHKNGFPFKRYHEFLGHFMEDFTSIGVAGAHGKTSTTGMLAHVMSNIVDTSYLIGDGTGRGNAGSEYFVFESDEYERHFMPYHPEYTIMTNIDFDHPDYFEGIEDVTSAFQDYANNIKKGIFAYGEDVNLRKLSAKAPIYYYGFEANDDYRAENLIRSTRGSSFDAYFRGEKIGHFVVPTYGKHNVLNALSVVAVCHNLGLDMTDVADHLLTFRGVKRRFTEKKVGETVIIDDFAHHPTEIEATLDAARQKYPDREIVAVFQPHTFTRTIAFADEFAEVLDHADTVYLAQIYGSAREVDHHEITAQDLADKVRKPAKVIELDNVSPLLDHDRGIYVFMGAGNIQKYEIAFEKLLSQTSTNLQ
>CP031538.1|AXN66322.1|2125597_2126056_+|transcriptional-regulator-ArgR-family
MKRDKRLEIIKEIVTNNKISTQEELQSLLLERGVEVTQATLSRDIRKLNIIKKRDKGESFYSFLTSGNSKINSDLQLYFYNFVISAKSVGALVVIRTKLGEADVLANALDDERDSRTDILGTIAGADTLLVICASEKAANILTAEIKYILLG
>CP031538.1|AXN66321.1|2123835_2125530_-|arginyl-tRNA-synthetase
MDEKQLVSQALSAAIDGVLGVEQIAAIIEKPKSSDLGDLAFPAFQLAKTLRKSPQIIAGEIAEKIDTKGFEKVIAVGPYVNFFLDKNATASEVIREVLTEGEHYGDANIGEGGNVPIDMSAPNIAKPFSIGHLRSTVIGDSIAKIYEKLGYQPIKINHLGDWGKQFGLLITAYKKYGDEATITANPIDELLKLYVKINAEAKEDPEVDEEGRQWFLKMEQGDEEALRIWKWFSDVSLIEFNRIYGKLGVTFDHFMGESFYSDKMDAIVEDLENKNLLHESKGALIVDLEKYNLNPALIKKTDGATLYITRDLATAAYRKKTFNFVKSLYVVGGEQTNHFKQLKAVLKEAGYDWSDDMVHVPFGMVTQGGKKFSTRKGHVVKLEMALDEAVDRAEKQIEAKNPNLENKEEVAKQVGVGAVKFYDLKTDRNNGYDFDLDEMVSFEGETGPYVQYAHARIQSILRKANRKVNIDNISLVVSDAEAWEIVKALKEFPNIVKRAADNYEPSIIAKYAISLAQAFNKYYAHVRILEDDAQLDGRLALISATSIVLKEALRLLGVAAPENM
>CP031538.1|AXN66320.1|2122370_2123534_-|arginine-deiminase
MNNGINVNSEIGKLKSVLLHRPGAEVENITPDTMKQLLFDDIPYLKIAQKEHDFFAQTLRDNGAETVYIENLATEVFEKSSETKEEFLSHLLHEAGYRPGRTYDGLTEYLTSMPTKDMVEKVYAGVRKNELDIKRTALSDMAGSDAENYFYLNPLPNAYFTRDPQASMGVGMTINKMTFPARQPESLITEYVMANHPRFKDTPIWRDRNHTTRIEGGDELILNKTTVAIGVSERTSSKTIQNLAKELFANPFSTFDTVLAVEIPHNHAMMHLDTVFTMINHDQFTVFPGIMDGAGNINVFILRPGQDGEVELEHLTDLKAALKKVLNLSELDLIECGAGDPIAAPREQWNDGSNTLAIAPGEIVTYDRNYVTVELLKEHGIKVHEIL
>CP031538.1|AXN66319.1|2121071_2122136_-|ornithine-carbamoyltransferase
MTSPLITKAEVNSVFQGRSLLAEKDFTPAEINYLVDFGLHLKALKQQNIPHHYLEGKNIALLFAKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGIKESTEDTARVLGSMFDAIERRGFSQKEVEDLAKYSGVPVWNGLTDDWHPTQMIADFMTVKENFGYLKGLTLVYVGDGRNNMANSLIVTGSMLGVNVHIVAPDSLHPSKEVMDIANKFAEKSGAKPLATSNIEEGVKGANIIYSDVWVSMGESNWEERVKLLTPYRITMDMLKMTGNADNGKLIFMDCLPAFHDTETEYGKEIKEKYGLTEMEVTDEVFRSKYARQFEEAENRMHSIKAIMAATLGNLFIPAVPEDFK
>CP031538.1|AXN66318.1|2117425_2118370_-|carbamate-kinase
MVRRMVVALGGNAILTDDPTAKAQERALETTAEQLIPLIRNNDVEMVVTHGNGPQVGNLLLQQLAADSPKNPAMPIDTAVAMTQGQIGFWMGQAFTRALIKNKMERVPVISVVTRTVVDKDDSAFEKPTKPIGPFYDEKGLAEMKAQYPDWTFVEDSGRGYRRVVPSPKPTRIVEAEAIKPLISSSVLVTVSGGGGIPVIETQEGYEGVEAVIDKDFSAAKVAELVEADNLLILTAVDNVFVNFNKPNQKKLETVTMAEMKAYIKEGQFAAGSMLPKVEAAMEFVTRTGRPATITSLENLEDFLNNDSGTKIIP
>CP031538.1|AXN66317.1|2116031_2117162_-|aminotransferase
MELVQFGCEDWLNVWEKSATIDIAQSTIDSLSLEEVLAFEEDKGEAFMSQMMKEKFSYGWIEGSPAFKSEVAKLYKRVSEDNILSTNGATGANFLTILGLIGQGDHVIAQYPSYQQLYDWPKTLGAQVDYWKIKEENHWLPQIEDLRRLVKPNTKLICLNNAAQPTGAIMSPDFLAEVVEIARSVDAYILCDEVYLPLDEETPYAPIADLYEKGISTNSISKTYSVPGIRVGWVATQDRDLCNEFRKIRDYTLICTGVFDDALASLVLKHKDKVLARARDIVKGNLSILKEWVENEPLVSMVYPNAVSVSFVKFEQLDPMKTEDFAIQLLREKGVLIIPGNRFDLPGYARIGYCTDEKTLRQGLQLLSEFLREYKG
>CP031538.1|AXN66316.1|2114348_2115842_-|arginine:ornithine-antiporter-APA-family
MENKKTKGISLFALLAIIISGAIGGGVFNLANDLARGSTPGGVVISWLFIGFGILMLVLSFNRLITIKPDLSGVSDYARAGFGDFVGFLSGWGYWISAWTGTIGFAVLMMTSADYFFPGKFANSNGSLTILSVIIVSIISWILMLLVDRGVETAAAVNAIVMIAKLIPLVVFSITGIILFKANIFTQHFWQTFTTNFAADGSVKDFVWHAMTASGLLSQIKGSLLVMVWVFVGIEGAAMMGNRAKKKSDTAKATVIGLAVLLVIYVLLSLLPYGYMDQASLANVKAPGLVYILNEMVGGWGGSLMAVGLMISLLGAWLSWTMLPVEATQQLAEQKLLPSWFGKLNKYHAPSNSLLITQLMIQIFIIITYFVANAYNVFIYMATAVIMICYALVGAYLFKIGLKEASVKNILIGFFTFAFQALALYLSGWQYVWLAMILYTIGFLLFIGAKKESHQSISVKEWLGMLVVTVLGVLAIVVLICGAKAGTGFDLRGLLGF
>CP031538.1|AXN66326.1|2131864_2132485_-|Integrase
MKEFEKTQNAKQEDCVRKRLFIEFTYLNGNRYGEGAGLKFSTVNHGGIWIKDQYSRKSSVKNPINKQTKTLTSRRIKAFENDDTRSKEIIQWFLDHNNSGINDDYIFVRKNGHLLSDDTMNRYLHRFEKQMPDKLSSSFVMHSLRNSYITRRAEAGDTETEIMAKVGHANPNLVHTLYTHVRDTLKFDEQKKFKKQPRLLKIGKSA
>CP031538.1|AXN66327.1|2132567_2133248_+|Transposase
MNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYDRGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRLHKQFGQPRVIVKDKAPSIGSAFRKLQSNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSLRTSSTTIKGMETIRGIYKKNRRNGTLFGFSVSTEIKVLMGILA
>CP031538.1|AXN66328.1|2133510_2134269_-|putative-transposase-helper-protein-for-IS712H
MTTYHQLLNQLDHLKLDRVRQLLPEFLDEHADISLVEGLHELLSEELREREALLQERRLKKAHLPYEKRVMDFDFQFQPKINKAEILDLHTLRFLDKHENLLFIGNSGVGKTHLAISITLEALEKGYSSYFCMSTELVDRLLRANQKGTLERVLKQYANYDVLVIDEVGYLPFSRDGASLLFQLINMRYEKKSTLITTNIPLSQWSEFLQDKKLTNALLDRLVHHSKVISITGKSYRMKDYSEKKTKTPKSK
>CP031538.1|AXN66329.1|2134280_2135504_-|transposase-for-insertion-sequence-element-IS712H
MRKDILESITEHLMTGIKPNFADIARRYNCDYRTVKRYYDLGKEKTLEEASKRRVPPSLIENYKSIIEDKLKLGCSVRSIYYFIQLKGYQGSYTTVKRYARLIRESCKHKATIRIETTPGLSAQVDWKENLKLISRNGEVFTINIFLYILGYSRMKYLQLTVDRLQPTLFECLNHAFEKFGGVPEEIWFDNMKTVVDHSKSQFSNVVFNERFRQYAKDAGFKPIACRPFRPQTKGKVEALARTVDRLLVFNNEFEDLEELQALVQQLMEDLNHKEISQAIGTSPSERLDQEALNLKAFDLELLKVYSQLSVPLTRKVSKEALVIFEGRKYSVPVKYIGQTVTCEKEQEDLKVYCDQRLIARHPLSDRPFNYRREDYVEILKSDVFKHLEEDELEAYVDENLQAYDLL
>CP031538.1|AXN66330.1|2135816_2136707_+|transposase-for-insertion-sequence-element-IS982B
MTYNSTLPKVFVYLLTTIETLYQTRVPLEVQNRKNVHLATSDCLVIACYLWGVLHFSETLKAKHQLAQSLFPNFLEYSRFVRRCNALLPSIQVIRQALVFKEVEGMSVSIIDSFPIPLCQPIRNFRSKVLGDYANVGYNATKGQYFYGCKCHALVSESGYIIDYTITPASMADSSMTEEVLSQFGTPTVLGDMGYLGQSLHDRLELKGIDLMTPVRKNMKQKKILFPNFSKRRKVIERVFSFLTNLGAERCKSRSPQGFQLKLEMILLAYSLLLKSAKSLEPETLRYSIGYQVMPK
>CP031538.1|AXN66331.1|2136859_2137816_-|Beta-lactamase-family-protein
MKNQQEFLAMIEDYLERDVFPGVNFAILEGEEVSEYLFGKAALIPEPIALTPGKKWDLASLTKVIGTGTAVIDLVLAGKLELDAPLQKYYAKFTDSTVSLRQLLTHTSGIDPYIPNRDKLGFFELTEAINQIRVTDDKSFKYTDINFILLGFLLEEYYDESLDYIFNKNIFKNWEMKQTSFGSVENAVPTSQNIPLGTVHDPKAQVLKNHCGSAGLFSTLSDMILFSQAYFREEKYLELLKNYADGAKERSLAWDLPAENNDWLLHTGYTGTFILINPRIKKAVVFLSNRVHLKDNREKWIEERDRLIKFLINHLSLD
>CP031538.1|AXN66332.1|2137888_2138668_-|hypothetical-protein
MSEIINHITAFQPVYRVLHREENLDFYRGVLGFKVLVEEGAMVWLGGHEAKKDRFQLEESPGFHPVEGLKKHGQTVIKANSSEIEQLIVRNLDKIAKIYQGKNGLAFTALSPEAGLFLVSSDSLTDLPALTEINKSEIKLNLDKNFKGLSDFEITAMNLNVADKSIIEFYESVFDLKAIDGKIEFPFVTLTLNVEESEDLTAGTDEVLDLEFLIFMIDKDFDLKAFANQFSEANGTYIDASAKTFSLEVPDHAELWFVK
>CP031538.1|AXN66333.1|2138896_2139058_-|hypothetical-protein
MKNKQLQKDLLNILYFFIILIVGALVMIGLVLLLVTACEYDLSLNKFPSAKNW
>CP031538.1|AXN66334.1|2139129_2139459_-|hypothetical-protein
MEFEEFFINNQLMKLIRETVLSIFPEAQERISYGMPAWFNGKTVLIYAQPQKHHLGIYPRPNFIEKHLEVLKQQYECSKGTIKVPYGIEHGELRKLVSDVINWNLTHFT
>CP031538.1|AXN66335.1|2139493_2139775_-|flavin-nucleotide-binding-protein
MDQPDKIIEGNKNASTYSYAYQSLIGFGEAKIIEDLEEKRNALHLLMAHAAKGKTFDPIPEKTLERVGVIKIIIDSYTVKQNIHPDKKREEHK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF775673	Lactococcus phage LP9206a, complete genome	7627-7672	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF775670	Lactococcus phage LP9104, complete genome	7617-7662	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MN534318	Lactococcus phage proPhi5, complete genome	36458-36503	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MN534315	Lactococcus phage proPhi1, complete genome	36458-36503	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF775671	Lactococcus phage LP9205a, complete genome	7627-7672	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	NC_049398	Lactococcus phage 16802, complete genome	7635-7680	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF775674	Lactococcus phage LP9206b, complete genome	7627-7672	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	KC522412	Lactococcus phage CaseusJM1, complete genome	7607-7652	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	NC_049416	Lactococcus phage LP8511, complete genome	7617-7662	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF775672	Lactococcus phage LP9205b, complete genome	7627-7672	0	1.0
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF448557	Lactococcus phage 37201, complete genome	8305-8350	1	0.978
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	KP793104	Lactococcus phage 936 group phage PhiB1127, complete genome	7627-7672	1	0.978
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	KP793109	Lactococcus phage 936 group phage PhiC0139, complete genome	7627-7672	1	0.978
CP031538_1	1.1\|884594\|46\|CP031538\|CRISPRCasFinder	884594-884639	46	MF448566	Lactococcus phage 63302, complete genome	7597-7642	1	0.978

1. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF775673 (Lactococcus phage LP9206a, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

2. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF775670 (Lactococcus phage LP9104, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

3. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MN534318 (Lactococcus phage proPhi5, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

4. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MN534315 (Lactococcus phage proPhi1, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

5. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF775671 (Lactococcus phage LP9205a, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

6. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to NC_049398 (Lactococcus phage 16802, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

7. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF775674 (Lactococcus phage LP9206b, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

8. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to KC522412 (Lactococcus phage CaseusJM1, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

9. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to NC_049416 (Lactococcus phage LP8511, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

10. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF775672 (Lactococcus phage LP9205b, complete genome) position: , mismatch: 0, identity: 1.0

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	Protospacer
**********************************************

11. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF448557 (Lactococcus phage 37201, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaactgtttcagca	Protospacer
*******************************************.**

12. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to KP793104 (Lactococcus phage 936 group phage PhiB1127, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaattgtttcaaca	Protospacer
***********************************.**********

13. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to KP793109 (Lactococcus phage 936 group phage PhiC0139, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcagcaattgtttcaaca	Protospacer
***********************************.**********

14. spacer 1.1|884594|46|CP031538|CRISPRCasFinder matches to MF448566 (Lactococcus phage 63302, complete genome) position: , mismatch: 1, identity: 0.978

aagtttacagcatactgttaataatcaatcagcaactgtttcaaca	CRISPR spacer
aagtttacagcatactgttaataatcaatcggcaactgtttcaaca	Protospacer
******************************.***************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

409098 : 418613

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN64653.1\|409098_409488_+	single-strand binding protein	A0A218MNB4	uncultured_virus	2.0e-23	47.4
AXN64654.1\|409606_409891_+	Co-chaperonin GroES (HSP10)	A0A221S386	uncultured_virus	2.3e-13	43.0
AXN64655.1\|409977_411606_+	Chaperonin GroEL (HSP60 family)	A0A219YK78	uncultured_virus	1.7e-156	56.4
AXN64656.1\|411657_412470_-	Metal-dependent hydrolase of the beta-lactamase superfamily I	A0A0C5AJ83	Bacteriophage	1.5e-33	38.1
AXN64657.1\|412659_414087_-	PAS/PAC sensor signal transduction histidine kinase	W8CYF6	Bacillus_phage	3.9e-32	32.9
AXN64658.1\|414079_414781_-	DNA-binding response regulator OmpR family (Rec-wHTH domains)	W8CYM9	Bacillus_phage	1.2e-42	39.7
AXN64659.1\|414958_415594_+	thymidylate kinase	M1PSC7	Streptococcus_phage	1.6e-73	66.0
AXN64660.1\|415726_416587_+	DNA polymerase III delta prime subunit	M1NSC1	Streptococcus_phage	3.1e-64	44.8
AXN64661.1\|416636_417419_+	Phosphorelay inhibitor	NA	NA	NA	NA
AXN64662.1\|417411_417738_+	Regulator of replication initiation timing	NA	NA	NA	NA
AXN64663.1\|417737_418613_+	methyltransferase	M1PLC5	Streptococcus_phage	6.0e-100	66.1

DBSCAN-SWA_2

575038 : 630987

Bacillus_phage(20.0%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN64814.1\|575038_576457_+	6-phosphogluconate dehydrogenase (decarboxylating)	E3SJC4	Synechococcus_phage	1.4e-34	32.8
AXN64815.1\|576638_577349_+	K+ transporter	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	9.1e-30	35.2
AXN64816.1\|577362_577944_+	Transposase	NA	NA	NA	NA
AXN64817.1\|577892_578756_+	Transposase	A0A1B1P773	Bacillus_phage	8.1e-57	45.0
AXN64818.1\|578800_580168_+	Kup system potassium uptake protein	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	2.1e-27	33.7
AXN64819.1\|580382_582398_+	K+ transporter	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	2.6e-58	31.8
AXN64820.1\|582450_582621_-	hypothetical protein	NA	NA	NA	NA
AXN64821.1\|582815_583481_+	hypothetical protein	M1Q1P6	Streptococcus_phage	2.3e-19	29.8
AXN64822.1\|583612_584497_+\|tRNA	tRNA delta(2)-isopentenylpyrophosphate transferase	NA	NA	NA	NA
AXN64823.1\|584642_585311_+	Galactose-1-phosphate uridyltransferase related protein	NA	NA	NA	NA
AXN64824.1\|585475_586378_+\|protease	Membrane protease subunit stomatin/prohibitin family	A0A1V0SL90	Klosneuvirus	1.8e-35	35.2
AXN64825.1\|586755_587325_-	Surface antigen	A0A1P8BMN5	Lactococcus_phage	4.7e-13	50.6
AXN64826.1\|587751_588099_-	Transcriptional regulator xre family	A0A182BQC8	Lactococcus_phage	1.2e-43	75.4
AXN64827.1\|588863_589787_+	ribonuclease Z	NA	NA	NA	NA
AXN64828.1\|589779_590481_+	Short-chain dehydrogenase	NA	NA	NA	NA
AXN64829.1\|590653_592882_+	exonuclease RecJ	A7KV88	Bacillus_phage	8.7e-79	31.1
AXN64830.1\|593006_593519_+	Adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	5.3e-32	44.0
AXN64831.1\|593709_594273_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
AXN64832.1\|594411_596049_+	Aminodeoxychorismate lyase family	NA	NA	NA	NA
AXN64833.1\|596109_596580_+	transcription elongation factor GreA	NA	NA	NA	NA
AXN64834.1\|596671_597229_+\|transposase	IS3/IS911 transposase N-terminal protein	NA	NA	NA	NA
AXN64835.1\|597225_598047_+	Transposase	A0A1B1P773	Bacillus_phage	2.4e-50	42.4
AXN64836.1\|598262_598718_+	Transcriptional repressor	NA	NA	NA	NA
AXN64837.1\|598707_601158_+	ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	6.3e-123	34.2
AXN64838.1\|601292_601850_+	putative sigma 54 modulation protein	NA	NA	NA	NA
AXN64839.1\|602037_603339_+	enolase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
AXN64840.1\|603380_604061_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-29	36.8
AXN64841.1\|605147_605717_-	transcriptional regulator	NA	NA	NA	NA
AXN64842.1\|605903_607427_-	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase	NA	NA	NA	NA
AXN64843.1\|607620_608538_+	Mg2 and Co2 transporter CorA family	NA	NA	NA	NA
AXN64844.1\|608712_611076_+	formate acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	8.0e-107	31.8
AXN64845.1\|611204_611864_+	dephospho-CoA kinase	NA	NA	NA	NA
AXN64846.1\|611956_613084_+	multidrug resistance efflux pump	NA	NA	NA	NA
AXN64847.1\|613080_613227_+	LSU ribosomal protein L33P	NA	NA	NA	NA
AXN64848.1\|613604_614867_+	cell division-specific peptidoglycan biosynthesis regulator FtsW	NA	NA	NA	NA
AXN64849.1\|614971_618385_+	pyruvate carboxylase	NA	NA	NA	NA
AXN64850.1\|619832_622379_+	aconitate hydratase	NA	NA	NA	NA
AXN64851.1\|623676_624276_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.2e-52	52.6
AXN64852.1\|624471_625002_+	hypothetical protein	NA	NA	NA	NA
AXN64853.1\|625171_625570_+	Arsenate reductase related protein glutaredoxin family	NA	NA	NA	NA
AXN64854.1\|625720_625855_-	secreted protein	NA	NA	NA	NA
AXN64855.1\|625951_627130_-	membrane protein	NA	NA	NA	NA
AXN64856.1\|627205_627964_-\|transposase	transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
AXN64857.1\|627975_629199_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
AXN64858.1\|629610_630690_+	Calcium-transporting ATPase	NA	NA	NA	NA
AXN64859.1\|630726_630987_+\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6

DBSCAN-SWA_3

828837 : 910693

103

Lactococcus_phage(74.32%)

holin,transposase,portal,tail,capsid,terminase,plate,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65043.1\|828837_830061_+	ABC-type proline/glycine betaine transport system ATPase component	G3M9Y6	Bacillus_virus	5.0e-28	36.9
AXN65044.1\|830053_831775_+	ABC-type proline/glycine betaine transport system permease component	NA	NA	NA	NA
AXN65045.1\|831965_832136_+	hypothetical protein	NA	NA	NA	NA
AXN65046.1\|832508_833327_-	Transposase	A0A1B1P773	Bacillus_phage	1.1e-52	43.0
AXN65047.1\|833323_833695_-\|transposase	IS3/IS911 transposase N-terminal protein	NA	NA	NA	NA
AXN65048.1\|833931_834552_-	Transposase	A0A1X9I6C6	Streptococcus_phage	8.0e-99	82.9
AXN65049.1\|834801_835239_+	phosphoadenosine phosphosulfate sulfotransferase	L0P6Z6	Lactobacillus_phage	3.4e-35	46.2
AXN65050.1\|835220_835763_+	transcriptional regulator	A0A220GKT8	Streptococcus_phage	5.8e-61	66.1
AXN65051.1\|835792_836095_+	Transcriptional regulator xre family	A0A1S5SAD3	Streptococcus_phage	6.0e-07	51.7
AXN65052.1\|836376_837321_+	Co/Zn/Cd cation transporter	NA	NA	NA	NA
AXN65053.1\|837374_837806_+	membrane protein	NA	NA	NA	NA
AXN65054.1\|837876_838797_-	pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.9e-32	37.7
AXN65055.1\|838898_839582_+	16S rRNA m(2)G 1207 methyltransferase	NA	NA	NA	NA
AXN65056.1\|840456_840909_+	thymidine phosphorylase	NA	NA	NA	NA
AXN65057.1\|840910_841099_+	hypothetical protein	NA	NA	NA	NA
AXN65058.1\|841111_841774_+	Deoxyribose-phosphate aldolase	NA	NA	NA	NA
AXN65059.1\|841730_842153_+	cytidine deaminase	NA	NA	NA	NA
AXN65060.1\|842420_843476_+	nucleoside-binding protein	A0A0A7DN02	Lactobacillus_phage	1.1e-60	41.2
AXN65061.1\|843662_844370_+	transcriptional regulator GntR family	NA	NA	NA	NA
AXN65062.1\|844377_844818_-	hypothetical protein	NA	NA	NA	NA
AXN65063.1\|844915_846469_-	Signal transduction histidine kinase	W8CYF6	Bacillus_phage	1.0e-33	37.3
AXN65064.1\|846458_847169_-	DNA-binding response regulator OmpR family (Rec-wHTH domains)	A0A1V0SGR9	Hokovirus	5.3e-06	30.1
AXN65065.1\|847352_847688_+	hypothetical protein	NA	NA	NA	NA
AXN65066.1\|848302_849382_-	Integrase	A5GYP9	Lactococcus_phage	4.7e-203	99.2
AXN65067.1\|849503_850082_-	phage-encoded protein	Q9AZQ9	Lactococcus_phage	3.1e-97	98.4
AXN65068.1\|850165_850978_-	phage-encoded transcriptional regulator	Q9AZQ8	Lactococcus_phage	1.3e-152	99.6
AXN65069.1\|851218_851398_+	phage-encoded transcriptional regulator	A0A1B1IMU6	Lactococcus_phage	4.0e-27	100.0
AXN65070.1\|851418_851661_+	phage-encoded repressor	Q77JL3	Lactococcus_phage	5.2e-38	100.0
AXN65071.1\|851673_852498_+	phage-encoded protein	Q38330	Lactococcus_phage	9.3e-119	81.8
AXN65072.1\|852510_852801_+	phage-encoded protein	Q9AZW0	Lactococcus_phage	7.9e-49	97.9
AXN65073.1\|852867_853104_+	phage-encoded protein	Q9MC36	Lactococcus_phage	6.7e-38	96.2
AXN65074.1\|853208_853727_+	phage-encoded protein	Q9XJE3	Lactococcus_phage	3.6e-84	95.3
AXN65075.1\|853735_854494_+	phage-encoded translation initiation factor	Q0ILF6	Lactococcus_phage	3.4e-144	97.2
AXN65076.1\|854486_854912_+	phage-encoded single-strand binding protein	Q9AZV6	Lactococcus_phage	1.7e-71	95.0
AXN65077.1\|855040_855823_+	phage-encoded replication initiation protein	Q9XJE6	Lactococcus_phage	3.7e-125	100.0
AXN65078.1\|855822_856548_+	phage-encoded topoisomerase	A0A1P8BKN5	Lactococcus_phage	1.7e-132	97.9
AXN65079.1\|856544_857303_+	phage-encoded DNA methylase	Q9XJE8	Lactococcus_phage	1.6e-146	99.6
AXN65080.1\|857292_857682_+	phage-encoded RusA resolvase	R9QLL1	Lactococcus_phage	2.3e-67	96.9
AXN65081.1\|857685_857880_+	phage-encoded protein	Q38101	Lactococcus_phage	3.3e-27	98.4
AXN65082.1\|857872_858112_+	phage-encoded protein	Q94M89	Lactococcus_phage	1.7e-36	97.5
AXN65083.1\|858223_858403_+	phage-encoded protein	A0A1P8BMJ6	Lactococcus_phage	3.5e-23	98.3
AXN65084.1\|858392_858962_+	phage-encoded protein	Q9B002	Lactococcus_phage	3.8e-87	96.3
AXN65085.1\|858972_859233_+	phage-encoded protein	NA	NA	NA	NA
AXN65086.1\|859233_859440_+	phage-encoded protein	Q9MC26	Lactococcus_phage	3.4e-30	98.5
AXN65087.1\|859432_860062_+	phage-encoded protein	Q9AZ77	Lactococcus_phage	1.2e-65	65.4
AXN65088.1\|860058_860478_+	phage-encoded dUTPase	Q77K24	Lactococcus_phage	1.5e-72	99.3
AXN65089.1\|860482_860752_+	phage-encoded protein	A0A1P8BKH9	Lactococcus_phage	2.5e-41	87.5
AXN65090.1\|860748_861063_+	phage-encoded protein	NA	NA	NA	NA
AXN65091.1\|861074_861464_+	phage-encoded protein	A0A1P8BM10	Lactococcus_phage	4.2e-37	97.5
AXN65092.1\|861460_861787_+	phage-encoded protein	NA	NA	NA	NA
AXN65093.1\|861783_862164_+	phage-encoded protein	Q77MW4	Lactococcus_phage	1.6e-49	90.9
AXN65094.1\|862182_862413_+	phage-encoded protein	A0A1P8BMS6	Lactococcus_phage	5.4e-08	43.6
AXN65095.1\|862807_863050_+	phage-encoded protein	A6MA87	Lactococcus_virus	8.7e-25	69.6
AXN65096.1\|863130_863553_+	phage-encoded protein	Q9AYX5	Lactococcus_phage	5.5e-75	100.0
AXN65097.1\|863923_864334_+\|terminase	Phage-encoded terminase small subunit	Q9AZ67	Lactococcus_phage	1.4e-67	100.0
AXN65098.1\|864326_865715_+\|terminase	Phage-encoded terminase large subunit	Q2QER6	Lactococcus_phage	4.5e-275	100.0
AXN65099.1\|865715_867074_+\|portal	Phage-encoded portal protein SPP1 Gp6-like protein	Q9AZ65	Lactococcus_phage	3.3e-254	99.6
AXN65100.1\|867077_868118_+\|capsid	phage-encoded minor capsid protein	B5SP29	Lactococcus_phage	2.4e-188	97.4
AXN65101.1\|868163_868496_+	phage-encoded protein	Q9AYW8	Lactococcus_phage	1.3e-58	100.0
AXN65102.1\|868619_869282_+	phage-encoded scaffold protein	B5SP30	Lactococcus_phage	1.4e-77	99.5
AXN65103.1\|869283_870102_+\|head	phage-encoded major head protein	Q9AZ61	Lactococcus_phage	1.5e-140	98.2
AXN65104.1\|870101_870302_+	phage-encoded protein	B5SP32	Lactococcus_phage	9.6e-30	100.0
AXN65105.1\|870285_870618_+\|head,tail	phage-encoded gp6-like head-tail connector protein	A0A1L2JXP0	Streptococcus_phage	4.2e-54	100.0
AXN65106.1\|870614_870926_+	phage-encoded protein	B5SP34	Lactococcus_phage	1.8e-54	97.1
AXN65107.1\|870922_871249_+\|tail	phage-encoded tail component	A0A1P8BKS5	Lactococcus_phage	1.7e-52	97.2
AXN65108.1\|871245_871635_+	phage-encoded protein	Q38611	Lactococcus_phage	4.0e-64	95.3
AXN65109.1\|871645_872155_+\|tail	phage-encoded major tail protein	Q77K19	Lactococcus_phage	2.9e-86	96.4
AXN65110.1\|872270_872621_+	phage-encoded protein	B5SP38	Lactococcus_phage	5.0e-58	100.0
AXN65111.1\|872662_872974_+	phage-encoded protein	A0A1P8BKT4	Lactococcus_phage	2.5e-48	98.1
AXN65112.1\|872989_874114_+	phage-encoded tapemeasure protein	A0A1P8BLL5	Lactococcus_phage	3.1e-181	98.3
AXN65113.1\|874162_874921_-\|transposase	transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
AXN65114.1\|874932_876156_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
AXN65115.1\|876199_877783_+	phage-encoded tapemeasure protein	A0A1P8BLL5	Lactococcus_phage	9.0e-62	97.0
AXN65116.1\|877792_878554_+\|tail	phage-encoded distal tail protein	B5SP41	Lactococcus_phage	2.0e-139	97.2
AXN65117.1\|878553_881310_+\|tail	phage-encoded tail associated lysin	Q9AZ57	Lactococcus_phage	0.0e+00	97.3
AXN65118.1\|881322_882303_+\|plate	phage-encoded baseplate protein	A0A1P8BKH4	Lactococcus_phage	2.9e-180	96.6
AXN65119.1\|882292_883078_+\|plate	phage-encoded baseplate protein	B5SP44	Lactococcus_phage	1.3e-85	63.6
AXN65120.1\|883096_883588_+\|plate	phage-encoded baseplate protein	Q9G096	Lactococcus_phage	6.6e-88	97.5
AXN65121.1\|883601_883826_+	phage-encoded hemolysin XhlA	A0A1B1IMU8	Lactococcus_phage	6.1e-33	100.0
AXN65122.1\|883838_886202_+	phage-encoded neck passage structure	A0A2K8II58	Lactococcus_phage	8.0e-240	65.3
AXN65123.1\|886226_886493_+\|holin	phage-encoded holin	A0A1B1IMU0	Lactococcus_phage	1.6e-40	100.0
AXN65124.1\|886489_887779_+	Lyzozyme M1 (14-beta-N-acetylmuramidase)	Q9FZS8	Lactococcus_phage	3.5e-237	96.0
AXN65125.1\|888088_888973_+\|protease	CAAX protease	A0A059NT88	Lactococcus_phage	3.9e-83	48.3
AXN65126.1\|889690_889951_+\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN65127.1\|889962_890802_+	Transposase	A0A1P8CWQ3	Bacillus_phage	1.6e-49	41.4
AXN65128.1\|890905_891727_-	Lipopolysaccharide biosynthesis glycosyltransferase	NA	NA	NA	NA
AXN65129.1\|892041_893460_+	dipeptidase PepV	NA	NA	NA	NA
AXN65130.1\|893588_893948_+	Phosphopantetheinyl transferase (holo-ACP synthase)	NA	NA	NA	NA
AXN65131.1\|893991_895095_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	6.3e-30	28.1
AXN65132.1\|895255_895675_+	Arsenate reductase related protein glutaredoxin family	NA	NA	NA	NA
AXN65133.1\|895822_897130_+	Glutathione reductase	NA	NA	NA	NA
AXN65134.1\|897258_898176_+	ABC-type proline/glycine betaine transport system ATPase component	G3M9Y6	Bacillus_virus	9.0e-22	30.1
AXN65135.1\|898172_899675_+	Glycine betaine ABC transporter permease and substrate-binding protein	NA	NA	NA	NA
AXN65136.1\|902314_902818_+	hypothetical protein	NA	NA	NA	NA
AXN65137.1\|902827_903205_+	hypothetical protein	NA	NA	NA	NA
AXN65138.1\|903357_903780_+	hypothetical protein	NA	NA	NA	NA
AXN65139.1\|903756_904317_-	Transposase	NA	NA	NA	NA
AXN65140.1\|904462_904633_-	Transposase	NA	NA	NA	NA
AXN65141.1\|904821_906864_-	Cation transport ATPase	A0A218MNH6	uncultured_virus	1.5e-61	30.9
AXN65142.1\|907022_907910_+	5,10-methylenetetrahydrofolate dehydrogenase	A0A249XZQ2	Enterococcus_phage	2.1e-39	39.0
AXN65143.1\|908080_909334_+	Exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.2e-45	32.3
AXN65144.1\|909336_909576_+	Exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
AXN65145.1\|909802_910693_+\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA

DBSCAN-SWA_4

928981 : 982262

Bacillus_phage(41.67%)

transposase,integrase

attL 929875:929893|attR 981279:981297

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65164.1\|928981_929872_+\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
929875:929893	attL	NA	NA	NA	NA
AXN65165.1\|929995_930835_-	Transposase	A0A1P8CWQ3	Bacillus_phage	9.3e-50	41.4
AXN65166.1\|930872_931106_-\|transposase	IS981 transposase A	NA	NA	NA	NA
AXN65167.1\|931184_931859_+	RelA / SpoT (ppGpp synthetase/hydrolase) catalytic domain	NA	NA	NA	NA
AXN65168.1\|932018_932363_+	LSU ribosomal protein L19P	NA	NA	NA	NA
AXN65169.1\|932537_932954_-	Ketosteroid isomerase related protein	NA	NA	NA	NA
AXN65170.1\|933291_933753_-	Acetyltransferase GNAT family	NA	NA	NA	NA
AXN65171.1\|934006_934516_+	hypothetical protein	NA	NA	NA	NA
AXN65172.1\|934508_935837_+	Glycosyltransferase family 2 cellulose synthase (CESA) superfamily	NA	NA	NA	NA
AXN65173.1\|936067_936625_+	hypothetical protein	NA	NA	NA	NA
AXN65174.1\|936687_936933_-	hypothetical protein	NA	NA	NA	NA
AXN65175.1\|937205_937931_+	Nicotinamide mononucleotide transporter	A0A2P0ZKW0	Lactobacillus_phage	1.4e-14	28.7
AXN65176.1\|938073_938229_-	hypothetical protein	NA	NA	NA	NA
AXN65177.1\|938483_938909_+	universal stress protein A	NA	NA	NA	NA
AXN65178.1\|939076_939439_+	HU-like DNA-binding protein	NA	NA	NA	NA
AXN65179.1\|939500_940034_-	transcriptional regulator TetR family	NA	NA	NA	NA
AXN65180.1\|940195_940705_+	phage infection protein	NA	NA	NA	NA
AXN65181.1\|940705_941596_-	Transposase	NA	NA	NA	NA
AXN65182.1\|941718_943566_+	membrane protein	NA	NA	NA	NA
AXN65183.1\|943754_944087_+	metal-sulfur cluster biosynthetic enzyme	NA	NA	NA	NA
AXN65184.1\|944221_945196_+\|integrase	putative integrase/recombinase	A0A142F1N9	Bacillus_phage	7.3e-30	28.4
AXN65185.1\|945820_946063_+	hypothetical protein	NA	NA	NA	NA
AXN65186.1\|946114_946954_-	Transposase	A0A1P8CWQ3	Bacillus_phage	4.6e-49	41.1
AXN65187.1\|946965_947226_-\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN65188.1\|948528_949158_+	membrane protein	NA	NA	NA	NA
AXN65189.1\|949154_950153_+	Signal transduction histidine kinase	NA	NA	NA	NA
AXN65190.1\|950180_950810_+	DNA-binding response regulator (Rec-wHTH domains)	NA	NA	NA	NA
AXN65191.1\|950966_951686_+	hydrolase of the HAD superfamily	NA	NA	NA	NA
AXN65192.1\|951785_952376_+	peptidyl-prolyl cis-trans isomerase	A0A1V0S9I2	Catovirus	3.2e-28	45.5
AXN65193.1\|952377_952809_+	RNA binding protein (contains ribosomal protein S1 domain)	NA	NA	NA	NA
AXN65194.1\|952805_953411_+	hypothetical protein	M1Q152	Streptococcus_phage	2.2e-29	36.9
AXN65195.1\|953622_954867_+	rod shape-determining protein RodA	NA	NA	NA	NA
AXN65196.1\|956198_956960_+	acetoin reductase	NA	NA	NA	NA
AXN65197.1\|957232_957394_+	hypothetical protein	NA	NA	NA	NA
AXN65198.1\|957504_959055_+	ATPase	Q6DMX7	Streptococcus_phage	1.3e-25	23.6
AXN65199.1\|961106_962300_+	Na+/malate symporter	NA	NA	NA	NA
AXN65200.1\|962789_963464_+	permease of the drug/metabolite transporter (DMT) superfamily	NA	NA	NA	NA
AXN65201.1\|963586_964351_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.0e-26	28.4
AXN65202.1\|964331_965912_+	ABC transporter permease protein	NA	NA	NA	NA
AXN65203.1\|966997_967645_+	P-Ser-HPr phosphatase	NA	NA	NA	NA
AXN65204.1\|967798_969754_+	DNA gyrase subunit B	G3M9Z3	Bacillus_virus	3.7e-142	44.7
AXN65205.1\|969852_970038_+	hypothetical protein	NA	NA	NA	NA
AXN65206.1\|970261_970999_+	SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.2e-80	58.3
AXN65207.1\|971171_971813_+	secreted protein	NA	NA	NA	NA
AXN65208.1\|971970_972435_+	MarR family transcriptional regulator	NA	NA	NA	NA
AXN65209.1\|973971_974691_+	hypothetical protein	NA	NA	NA	NA
AXN65210.1\|974969_975860_-\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
AXN65211.1\|976023_976932_+	N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase related protein	NA	NA	NA	NA
AXN65212.1\|977209_977386_+	Transposase	NA	NA	NA	NA
AXN65213.1\|977481_978321_+	Transposase	A0A1P8CWQ3	Bacillus_phage	4.6e-49	41.1
AXN65214.1\|978445_981271_+	glycosyltransferase	NA	NA	NA	NA
AXN65215.1\|981371_982262_+\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
981279:981297	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1048825 : 1071850

Bacillus_phage(21.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65285.1\|1048825_1049518_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	1.6e-31	34.8
AXN65286.1\|1049510_1050446_+	cell division protein ftsX-like protein	NA	NA	NA	NA
AXN65287.1\|1050555_1051533_-	ribonucleoside-diphosphate reductase class Ib beta subunit	A0A096XT60	Enterococcus_phage	6.0e-117	65.7
AXN65288.1\|1051937_1054106_-	ribonucleoside-diphosphate reductase class Ib alpha subunit	A8E2R1	Enterococcus_phage	5.6e-256	60.6
AXN65289.1\|1054242_1054665_-	Ribonucleotide reduction protein	A0A142F1R4	Bacillus_phage	1.7e-12	36.4
AXN65290.1\|1054666_1054885_-	ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit	C3U2K9	Lactococcus_phage	4.4e-12	49.2
AXN65291.1\|1055058_1055700_-	acyl-phosphate glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AXN65292.1\|1055978_1057913_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.1e-125	43.4
AXN65293.1\|1058548_1059382_+	DNA polymerase III epsilon subunit related 3-5 exonuclease	A0A0K2SUJ2	Clostridium_phage	5.3e-21	40.0
AXN65294.1\|1059378_1059828_+	Acetyltransferase GNAT family	NA	NA	NA	NA
AXN65295.1\|1060100_1062575_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	6.0e-97	31.9
AXN65296.1\|1062600_1063506_-	Mg2+ and Co2+ transporter	NA	NA	NA	NA
AXN65297.1\|1065084_1065732_+	Riboflavin synthase alpha chain	A0A2H4PQS5	Staphylococcus_phage	7.2e-42	44.7
AXN65298.1\|1065743_1066940_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.1e-110	50.5
AXN65299.1\|1066966_1067431_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.4e-39	55.3
AXN65300.1\|1067612_1067873_+	Transposase	A0A1P8CWP5	Bacillus_phage	8.4e-10	37.6
AXN65301.1\|1067884_1068724_+	Transposase	A0A1P8CWQ3	Bacillus_phage	6.0e-49	41.1
AXN65302.1\|1068756_1069659_-	transcription regulator	NA	NA	NA	NA
AXN65303.1\|1069758_1070139_+	hypothetical protein	NA	NA	NA	NA
AXN65304.1\|1070429_1070882_+	signal peptidase II Aspartic peptidase MEROPS family A08	NA	NA	NA	NA
AXN65305.1\|1070944_1071850_+	ribosomal large subunit pseudouridine synthase D	A0A2H4UV25	Bodo_saltans_virus	6.0e-10	27.8

DBSCAN-SWA_6

1106349 : 1115969

Streptococcus_phage(42.86%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65342.1\|1106349_1107303_+	Phosphate starvation-inducible protein PhoH predicted ATPase	H6X2N1	Pseudomonas_phage	2.0e-48	48.4
AXN65343.1\|1107372_1107867_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AXN65344.1\|1107957_1108446_+\|protease	metalloprotease	NA	NA	NA	NA
AXN65345.1\|1108429_1108885_+	diacylglycerol kinase	NA	NA	NA	NA
AXN65346.1\|1108901_1109480_+	hypothetical protein	NA	NA	NA	NA
AXN65347.1\|1109537_1110188_-	amidophosphoribosyltransferase	NA	NA	NA	NA
AXN65348.1\|1110187_1110700_-	replication restart DNA helicase PriA	A0A1X9I5S6	Streptococcus_phage	6.1e-36	52.5
AXN65349.1\|1110696_1111482_-	competence protein FA	A0A1X9I5S6	Streptococcus_phage	3.1e-63	51.2
AXN65350.1\|1111538_1112174_+	hypothetical protein	A0A1X9I5T8	Streptococcus_phage	6.6e-56	54.5
AXN65351.1\|1112391_1113615_+\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
AXN65352.1\|1113626_1114385_+\|transposase	transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
AXN65353.1\|1114524_1114884_+	VanZ family protein	NA	NA	NA	NA
AXN65354.1\|1114949_1115969_+	hypothetical protein	K4JUR1	Caulobacter_phage	7.6e-54	41.1

DBSCAN-SWA_7

1197094 : 1309354

106

Bacillus_phage(23.08%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65421.1\|1197094_1198330_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.4e-134	58.6
AXN65422.1\|1198326_1198914_+	GTPase	NA	NA	NA	NA
AXN65423.1\|1198967_1199318_+	Dihydroneopterin aldolase	NA	NA	NA	NA
AXN65424.1\|1199397_1200447_+	GTP cyclohydrolase I	A0A088F7Y4	Vibrio_phage	8.7e-37	45.1
AXN65425.1\|1200443_1201517_+	dihydropteroate synthase	NA	NA	NA	NA
AXN65426.1\|1201519_1202020_+	Dihydroneopterin triphosphate pyrophosphohydrolase	NA	NA	NA	NA
AXN65427.1\|1202035_1203319_+	Folylpolyglutamate synthase	NA	NA	NA	NA
AXN65428.1\|1203447_1204086_+	Deoxynucleoside kinase	Q5ULP7	Lactobacillus_virus	5.1e-48	47.5
AXN65429.1\|1204266_1205553_+	homoserine dehydrogenase	NA	NA	NA	NA
AXN65430.1\|1205557_1206448_+	homoserine kinase	NA	NA	NA	NA
AXN65431.1\|1206700_1207300_+	hypothetical protein	NA	NA	NA	NA
AXN65432.1\|1207342_1208242_+	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
AXN65433.1\|1208701_1209982_+	ABC-type spermidine/putrescine transport system ATPase component	Q6GZ03	Mycoplasma_phage	2.1e-32	38.9
AXN65434.1\|1209978_1210767_+	spermidine/putrescine ABC transporter permease protein	NA	NA	NA	NA
AXN65435.1\|1210768_1211569_+	spermidine/putrescine ABC transporter permease protein	NA	NA	NA	NA
AXN65436.1\|1211616_1212684_+	Spermidine/putrescine-binding periplasmic protein	NA	NA	NA	NA
AXN65437.1\|1212993_1213893_-	transcriptional regulator AraC family	NA	NA	NA	NA
AXN65438.1\|1215384_1216566_+	Endoglucanase	NA	NA	NA	NA
AXN65439.1\|1216598_1217435_+	Beta-xylosidase	NA	NA	NA	NA
AXN65440.1\|1217467_1218307_-	Transposase	A0A1P8CWQ3	Bacillus_phage	9.3e-50	41.4
AXN65441.1\|1218318_1218579_-\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN65442.1\|1218642_1219050_+	Aldo/keto reductase of diketogulonate reductase family	NA	NA	NA	NA
AXN65443.1\|1219344_1219590_+	hypothetical protein	NA	NA	NA	NA
AXN65444.1\|1222411_1222672_+\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN65445.1\|1222683_1223055_+	Transposase	NA	NA	NA	NA
AXN65446.1\|1223112_1223523_+	Transposase	A0A1P8CWQ3	Bacillus_phage	1.5e-24	43.9
AXN65447.1\|1223862_1224567_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
AXN65448.1\|1224704_1225526_+	Transcriptional regulator	NA	NA	NA	NA
AXN65449.1\|1225588_1226959_+\|tRNA	tRNA (uracil-5-)-methyltransferase related enzyme	E4ZFI6	Streptococcus_phage	1.1e-140	55.7
AXN65450.1\|1227003_1228611_+	NAD(FAD)-utilizing dehydrogenase	NA	NA	NA	NA
AXN65451.1\|1228612_1229326_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AXN65452.1\|1229297_1230470_+	permease	NA	NA	NA	NA
AXN65453.1\|1230497_1231754_+	TPR repeat-containing protein Tetratricopeptide repeat family	NA	NA	NA	NA
AXN65454.1\|1231908_1233573_+	acetolactate synthase	NA	NA	NA	NA
AXN65455.1\|1233679_1234825_-	arabinose efflux permease	NA	NA	NA	NA
AXN65456.1\|1234932_1235331_+	transcriptional regulator	NA	NA	NA	NA
AXN65457.1\|1235647_1236538_-\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
AXN65458.1\|1237118_1237271_+	Transcriptional regulator xre family	NA	NA	NA	NA
AXN65459.1\|1237655_1239659_+	RNAse R	Q0GXV6	Lactococcus_phage	3.2e-80	39.6
AXN65460.1\|1239977_1240469_+	Tryptophan-rich sensory protein	NA	NA	NA	NA
AXN65461.1\|1240532_1240709_+	membrane protein	NA	NA	NA	NA
AXN65462.1\|1240743_1241424_-	Transposase	A0A1X9I6C6	Streptococcus_phage	1.6e-108	82.7
AXN65463.1\|1241938_1242829_+\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
AXN65464.1\|1242859_1244560_+	Dihydroxyacetone kinase family protein	NA	NA	NA	NA
AXN65465.1\|1244556_1245348_+	Steroid 5-alpha reductase family enzyme	NA	NA	NA	NA
AXN65466.1\|1245579_1246338_-\|transposase	transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
AXN65467.1\|1246349_1247573_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	4.9e-233	100.0
AXN65468.1\|1249114_1250071_+	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
AXN65469.1\|1250300_1250498_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
AXN65470.1\|1250910_1252218_+	histidinol dehydrogenase	NA	NA	NA	NA
AXN65471.1\|1252218_1252827_+	imidazoleglycerol-phosphate dehydratase	NA	NA	NA	NA
AXN65472.1\|1253000_1253609_+	Aminoglycoside phosphotransferase	A0A193CJY5	Infectious_laryngotracheitis_virus	4.4e-09	26.1
AXN65473.1\|1253653_1254262_+	imidazole glycerol phosphate synthase subunit hisH	NA	NA	NA	NA
AXN65474.1\|1254261_1255002_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	NA	NA	NA	NA
AXN65475.1\|1254970_1255750_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
AXN65476.1\|1255746_1256385_+	phosphoribosyl-AMP cyclohydrolase / phosphoribosyl-ATP pyrophosphatase	NA	NA	NA	NA
AXN65477.1\|1256385_1257171_+	histidinol-phosphatase	NA	NA	NA	NA
AXN65478.1\|1257203_1258163_-	hypothetical protein	NA	NA	NA	NA
AXN65479.1\|1258585_1260127_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	3.1e-06	36.5
AXN65480.1\|1260162_1260648_+	hypothetical protein	NA	NA	NA	NA
AXN65481.1\|1260674_1261466_+	membrane protein	NA	NA	NA	NA
AXN65482.1\|1261606_1262638_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AXN65483.1\|1262639_1263107_+	hypothetical protein	NA	NA	NA	NA
AXN65484.1\|1263149_1263602_+	hypothetical protein	NA	NA	NA	NA
AXN65485.1\|1263658_1265035_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AXN65486.1\|1265034_1265568_+	hypothetical protein	NA	NA	NA	NA
AXN65487.1\|1265610_1266186_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AXN65488.1\|1266199_1266982_+	ABC-type molybdenum transport system ATPase component/photorepair protein PhrA	A0A2H4PQG7	Staphylococcus_phage	1.0e-13	27.5
AXN65489.1\|1267101_1268814_+	dihydroxyacid dehydratase	NA	NA	NA	NA
AXN65490.1\|1268824_1270549_+	acetolactate synthase large subunit	A9YVT5	Ostreococcus_tauri_virus	3.9e-42	27.7
AXN65491.1\|1270541_1271018_+	acetolactate synthase 3 regulatory subunit	NA	NA	NA	NA
AXN65492.1\|1271063_1272086_+	ketol-acid reductoisomerase	NA	NA	NA	NA
AXN65493.1\|1272144_1273395_+	threonine dehydratase	NA	NA	NA	NA
AXN65494.1\|1273529_1274240_+	Alpha-acetolactate decarboxylase	NA	NA	NA	NA
AXN65495.1\|1274279_1274660_+	Translation initiation inhibitor	NA	NA	NA	NA
AXN65496.1\|1274808_1275657_+	Rossmann fold nucleotide-binding protein for DNA uptake	NA	NA	NA	NA
AXN65497.1\|1275922_1278049_+	DNA topoisomerase I	A0A1V0SCS0	Indivirus	4.2e-99	36.4
AXN65498.1\|1278120_1279467_+\|tRNA	tRNA (uracil-5-)-methyltransferase Gid	NA	NA	NA	NA
AXN65499.1\|1279516_1280587_-	tyrosine recombinase XerC subunit	NA	NA	NA	NA
AXN65500.1\|1281213_1281921_-	hypothetical protein	NA	NA	NA	NA
AXN65501.1\|1282298_1283078_-	peptidase	NA	NA	NA	NA
AXN65502.1\|1283100_1283307_-	L-lactate oxidase	NA	NA	NA	NA
AXN65503.1\|1283499_1284417_-	Saccharopine dehydrogenase related protein	NA	NA	NA	NA
AXN65504.1\|1284565_1285093_-\|protease	intracellular protease/amidase	NA	NA	NA	NA
AXN65505.1\|1285092_1285425_-	transcriptional regulator ArsR family	NA	NA	NA	NA
AXN65506.1\|1285587_1286655_-	hypothetical protein	A0A172Q0Y5	Acinetobacter_phage	1.2e-54	41.5
AXN65507.1\|1287057_1287318_+\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN65508.1\|1287329_1288169_+	Transposase	A0A1P8CWQ3	Bacillus_phage	9.3e-50	41.4
AXN65509.1\|1288585_1289443_-	5,10-methylenetetrahydrofolate reductase	NA	NA	NA	NA
AXN65510.1\|1289432_1291706_-	methionine synthase (B12-independent)	NA	NA	NA	NA
AXN65511.1\|1291865_1292519_-	Iron-dependent repressor	NA	NA	NA	NA
AXN65512.1\|1292611_1295344_-	Mg(2+) transport ATPase P-type	A0A1J0FA34	Only_Syngen_Nebraska_virus	8.6e-44	23.3
AXN65513.1\|1295818_1297105_-	D-alanyl transfer protein	NA	NA	NA	NA
AXN65514.1\|1297094_1297334_-	D-alanyl carrier protein	NA	NA	NA	NA
AXN65515.1\|1297369_1298593_-	D-alanyl transfer protein	A0A125RNP0	Pseudomonas_phage	2.4e-22	30.8
AXN65516.1\|1298592_1300092_-	D-alanine--poly(phosphoribitol) ligase subunit 1	A0A2K9L3I8	Tupanvirus	3.1e-40	30.0
AXN65517.1\|1300430_1301087_-	thiamine-phosphate pyrophosphorylase	NA	NA	NA	NA
AXN65518.1\|1301173_1301881_-	Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AXN65519.1\|1301893_1302646_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
AXN65520.1\|1302931_1303255_-	glycosyl transferase GT2 family	NA	NA	NA	NA
AXN65521.1\|1303276_1304167_-\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
AXN65522.1\|1304239_1304500_-	glycosyl transferase	NA	NA	NA	NA
AXN65523.1\|1304646_1306743_+	Cation transport ATPase	A0A218MNH6	uncultured_virus	8.2e-63	31.4
AXN65524.1\|1306954_1307473_+\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA
AXN65525.1\|1307509_1308190_+	Transposase	A0A1X9I6C6	Streptococcus_phage	7.4e-106	81.4
AXN65526.1\|1308463_1309354_-\|transposase	transposase for insertion sequence element IS982B	NA	NA	NA	NA

DBSCAN-SWA_8

1562533 : 1571893

Bacillus_phage(37.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65757.1\|1562533_1563373_-	Transposase	A0A1P8CWQ3	Bacillus_phage	7.9e-49	40.7
AXN65758.1\|1563384_1563645_-\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN65759.1\|1563831_1564482_+	hypothetical protein	NA	NA	NA	NA
AXN65760.1\|1564589_1565360_+	Glycoside hydrolase family 25	Q38326	Lactococcus_phage	4.2e-65	74.4
AXN65761.1\|1565546_1565837_+	Transposase	NA	NA	NA	NA
AXN65762.1\|1565854_1566694_+	Transposase	U5P429	Shigella_phage	1.6e-46	41.0
AXN65763.1\|1566750_1567572_-	Transposase	A0A1B1P773	Bacillus_phage	6.7e-53	43.5
AXN65764.1\|1567568_1568126_-	Transposase	NA	NA	NA	NA
AXN65765.1\|1568258_1569332_-	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.5e-60	35.1
AXN65766.1\|1569419_1570352_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-23	30.5
AXN65767.1\|1570600_1571893_-	Uracil permease	Q9KX94	Enterobacteria_phage	5.8e-59	37.0

DBSCAN-SWA_9

1613814 : 1626745

Lactococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN65802.1\|1613814_1615104_-	Lyzozyme M1 (14-beta-N-acetylmuramidase)	A0A1P8BLG2	Lactococcus_phage	5.1e-241	97.7
AXN65803.1\|1615100_1615319_-	hypothetical protein	Q38613	Lactococcus_phage	1.0e-24	92.2
AXN65804.1\|1615362_1616586_+\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
AXN65805.1\|1616597_1617356_+\|transposase	transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
AXN65806.1\|1617479_1617659_-	hypothetical protein	A0A1P8BKV7	Lactococcus_phage	8.9e-27	100.0
AXN65807.1\|1617659_1618079_-	hypothetical protein	A0A1P8BKW0	Lactococcus_phage	6.0e-74	100.0
AXN65808.1\|1618068_1618233_-	hypothetical protein	R9QMC0	Lactococcus_phage	7.1e-23	98.1
AXN65809.1\|1618241_1619132_-	primosomal protein DnaI	R9QM21	Lactococcus_phage	3.0e-163	99.3
AXN65810.1\|1619141_1619948_-	replication protein	A0A1P8BL25	Lactococcus_phage	1.7e-56	97.2
AXN65811.1\|1620075_1620501_-	single-strand binding protein	Q9AZV6	Lactococcus_phage	1.5e-72	97.2
AXN65812.1\|1620493_1621252_-	hypothetical protein	Q0ILF6	Lactococcus_phage	1.7e-143	96.8
AXN65813.1\|1621260_1621659_-	hypothetical protein	A0A1X9IGE4	Lactococcus_phage	9.8e-42	64.9
AXN65814.1\|1621756_1621993_-	hypothetical protein	A5GYQ9	Lactococcus_phage	1.8e-38	97.4
AXN65815.1\|1622095_1622374_+	hypothetical protein	A0A059NT68	Lactococcus_phage	1.1e-47	100.0
AXN65816.1\|1622328_1622562_-	hypothetical protein	A0A059NT46	Lactococcus_phage	1.8e-35	100.0
AXN65817.1\|1622715_1622952_-	hypothetical protein	A0A059NT59	Lactococcus_phage	4.3e-37	100.0
AXN65818.1\|1622964_1623690_-	Phage anti-repressor protein	A0A1P8BKW5	Lactococcus_phage	1.5e-133	100.0
AXN65819.1\|1623703_1623943_-	hypothetical protein	A0A1P8BKU7	Lactococcus_phage	9.1e-35	94.9
AXN65820.1\|1624283_1624487_-	hypothetical protein	A0A1B1IMU6	Lactococcus_phage	4.0e-23	93.1
AXN65821.1\|1624749_1625562_+	Transcriptional regulator xre family	A0A1B1IMP5	Lactococcus_phage	3.0e-106	72.2
AXN65822.1\|1625611_1626745_+	Integrase	A0A059NT56	Lactococcus_phage	1.6e-201	98.4

DBSCAN-SWA_10

1894993 : 1945139

Lactococcus_phage(31.25%)

transposase,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN66077.1\|1894993_1895752_-\|transposase	putative transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
AXN66078.1\|1895763_1896987_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
AXN66079.1\|1897236_1897503_-	hypothetical protein	NA	NA	NA	NA
AXN66080.1\|1897516_1898314_-	peptide transporter	E2ELL2	Clostridium_phage	1.8e-18	38.3
AXN66081.1\|1898457_1899015_-	resolvase	A0A0A8WIK3	Clostridium_phage	2.9e-31	43.1
AXN66082.1\|1899221_1899572_-	hypothetical protein	A0A182BQ76	Lactococcus_phage	2.3e-10	75.6
AXN66083.1\|1899561_1901028_-	DNA polymerase IV	Q6DMX4	Streptococcus_phage	8.5e-123	51.3
AXN66084.1\|1901276_1901912_+	Type II restriction endonuclease	NA	NA	NA	NA
AXN66085.1\|1902076_1903858_+	NTPase	NA	NA	NA	NA
AXN66086.1\|1904126_1904375_+	hypothetical protein	NA	NA	NA	NA
AXN66087.1\|1904790_1906938_+	Multidrug/protein/lipid ABC transporter ATP-binding and permease protein	W8CYL7	Bacillus_phage	3.5e-40	27.1
AXN66088.1\|1906952_1908377_+	Lactococcin A secretion protein lcnD	NA	NA	NA	NA
AXN66089.1\|1908450_1908678_+	hypothetical protein	NA	NA	NA	NA
AXN66090.1\|1908734_1908989_+	Lactococcin-A immunity protein	NA	NA	NA	NA
AXN66091.1\|1909263_1909470_+	lactococcin-B precursor	NA	NA	NA	NA
AXN66092.1\|1909496_1909772_+	lactococcin B immunity	NA	NA	NA	NA
AXN66093.1\|1910552_1910717_+	hypothetical protein	NA	NA	NA	NA
AXN66094.1\|1910919_1911372_+	Transport protein	NA	NA	NA	NA
AXN66095.1\|1911410_1912067_+	hypothetical protein	NA	NA	NA	NA
AXN66096.1\|1912166_1912448_-	hypothetical protein	NA	NA	NA	NA
AXN66097.1\|1912449_1912677_-	hypothetical protein	NA	NA	NA	NA
AXN66098.1\|1913029_1914349_+	hypothetical protein	NA	NA	NA	NA
AXN66099.1\|1914856_1915081_-	hypothetical protein	NA	NA	NA	NA
AXN66100.1\|1915167_1916061_-	Transposase	NA	NA	NA	NA
AXN66101.1\|1916259_1916376_+	hypothetical protein	NA	NA	NA	NA
AXN66102.1\|1916561_1917737_-	Transposase	A0A0N9STL0	Staphylococcus_phage	1.4e-32	32.3
AXN66103.1\|1918465_1918930_-\|bacteriocin	bacteriocin immunity protein A3	NA	NA	NA	NA
AXN66104.1\|1918948_1919182_-	secreted protein	NA	NA	NA	NA
AXN66105.1\|1919207_1919417_-	hypothetical protein	NA	NA	NA	NA
AXN66106.1\|1919490_1920915_-	Lactococcin A secretion protein lcnD	NA	NA	NA	NA
AXN66107.1\|1923494_1924673_-	serine/threonine protein kinase	A0A2K9L5D2	Tupanvirus	4.4e-13	29.5
AXN66108.1\|1924763_1925321_-	recombinase/resolvase/invertase	A0A1J1J8Z4	Escherichia_phage	1.1e-33	45.1
AXN66109.1\|1925490_1925727_-	hypothetical protein	NA	NA	NA	NA
AXN66110.1\|1925716_1928776_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
AXN66111.1\|1928793_1929264_-	hypothetical protein	NA	NA	NA	NA
AXN66112.1\|1929427_1930018_+	Surface antigen	NA	NA	NA	NA
AXN66113.1\|1930230_1931268_-	AbiD/F protein	NA	NA	NA	NA
AXN66114.1\|1931636_1932317_-	Transposase	A0A1X9I6C6	Streptococcus_phage	5.1e-115	88.9
AXN66115.1\|1932562_1932865_-	Serine hydroxymethyltransferase/Phosphoribosyl-dephospho-CoA transferase family enzyme	NA	NA	NA	NA
AXN66116.1\|1933008_1933209_-	hypothetical protein	NA	NA	NA	NA
AXN66117.1\|1933335_1933455_-	Replication protein	NA	NA	NA	NA
AXN66118.1\|1933590_1933974_-	Transposase	A0A1X9I6C6	Streptococcus_phage	2.7e-52	56.1
AXN66119.1\|1934255_1934954_+\|protease	metal-dependent membrane protease	NA	NA	NA	NA
AXN66120.1\|1935321_1935603_+	hypothetical protein	NA	NA	NA	NA
AXN66121.1\|1936143_1936974_-	hypothetical protein	NA	NA	NA	NA
AXN66122.1\|1937030_1939028_-	hypothetical protein	NA	NA	NA	NA
AXN66123.1\|1939096_1939984_-	hypothetical protein	NA	NA	NA	NA
AXN66124.1\|1940082_1940763_-	Transposase	A0A1X9I6C6	Streptococcus_phage	9.1e-112	85.4
AXN66125.1\|1940883_1941951_-	hypothetical protein	NA	NA	NA	NA
AXN66126.1\|1941953_1942163_-	hypothetical protein	NA	NA	NA	NA
AXN66127.1\|1942165_1943005_-	DNA topoisomerase I	A0A1X9I6W8	Streptococcus_phage	1.5e-55	45.9
AXN66128.1\|1943145_1943904_-\|transposase	putative transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	2.6e-136	99.6
AXN66129.1\|1943915_1945139_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	5.4e-232	99.8

DBSCAN-SWA_11

1950820 : 1999517

Lactococcus_phage(70.37%)

transposase,tRNA,tail,terminase,capsid,protease,integrase,head

attL 1959313:1959329|attR 1985789:1985805

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN66137.1\|1950820_1951978_-	hypothetical protein	A0A0A0RSI6	Bacillus_phage	1.7e-22	31.2
AXN66138.1\|1951979_1952249_-	conjugal transfer protein	NA	NA	NA	NA
AXN66139.1\|1952333_1953014_+	Transposase	A0A1X9I6C6	Streptococcus_phage	6.5e-110	85.0
AXN66140.1\|1953086_1953260_-	hypothetical protein	A0A1W6JLD0	Lactococcus_phage	2.3e-24	96.5
AXN66141.1\|1953259_1955422_-	hypothetical protein	Q9AZL5	Lactococcus_phage	2.0e-282	91.1
AXN66142.1\|1955627_1955972_-	hypothetical protein	Q9AZL6	Lactococcus_phage	1.6e-27	98.2
AXN66143.1\|1956031_1956637_-	small major structural protein	Q9AZL7	Lactococcus_phage	1.4e-103	95.0
AXN66144.1\|1956638_1957034_-\|tail	phage tail protein	Q9AZL8	Lactococcus_phage	1.4e-67	100.0
AXN66145.1\|1957030_1957513_-	hypothetical protein	Q9AZL9	Lactococcus_phage	5.3e-82	97.5
AXN66146.1\|1957512_1957848_-\|head,tail	head-tail joining protein	Q9AZM0	Lactococcus_phage	1.4e-52	94.6
AXN66147.1\|1957834_1958140_-	hypothetical protein	Q9AZM1	Lactococcus_phage	2.9e-49	97.0
AXN66148.1\|1958150_1959464_-\|capsid	capsid protein	Q9AZM2	Lactococcus_phage	6.1e-189	92.0
1959313:1959329	attL	NA	NA	NA	NA
AXN66149.1\|1959453_1960041_-\|head,protease	prohead protease	Q9AZM3	Lactococcus_phage	8.4e-106	98.5
AXN66150.1\|1960040_1961120_-	hypothetical protein	Q9AZM4	Lactococcus_phage	6.5e-197	98.9
AXN66151.1\|1961116_1961281_-	hypothetical protein	Q9AZM5	Lactococcus_phage	2.8e-19	94.4
AXN66152.1\|1961289_1963101_-\|terminase	terminase	Q9AZM6	Lactococcus_phage	0.0e+00	98.3
AXN66153.1\|1963100_1963553_-\|terminase	terminase	Q9AZM7	Lactococcus_phage	6.5e-82	99.3
AXN66154.1\|1963668_1964172_-	hypothetical protein	Q9AZM8	Lactococcus_phage	5.9e-92	98.8
AXN66155.1\|1964405_1964828_-	hypothetical protein	Q9AYX5	Lactococcus_phage	5.5e-75	100.0
AXN66156.1\|1964907_1965747_-	Transposase	A0A1P8CWQ3	Bacillus_phage	9.3e-50	41.4
AXN66157.1\|1965758_1966019_-\|transposase	IS981 transposase A	A0A1P8CWP5	Bacillus_phage	1.9e-09	37.6
AXN66158.1\|1966098_1966434_+	hypothetical protein	NA	NA	NA	NA
AXN66159.1\|1966500_1966947_+	Integrase	Q9AZK8	Lactococcus_phage	2.0e-35	58.0
AXN66160.1\|1966995_1967754_-\|transposase	putative transposase helper protein for IS712H	A0A059NT77	Lactococcus_phage	5.3e-137	100.0
AXN66161.1\|1967765_1968989_-\|transposase	transposase for insertion sequence element IS712H	A0A059NT83	Lactococcus_phage	5.4e-232	99.8
AXN66162.1\|1969117_1969852_+\|integrase	phage integrase	A0A1X9I5Y5	Streptococcus_phage	7.1e-46	45.7
AXN66163.1\|1970146_1970653_-	hypothetical protein	NA	NA	NA	NA
AXN66164.1\|1970662_1970851_-	hypothetical protein	NA	NA	NA	NA
AXN66165.1\|1970861_1971422_-	hypothetical protein	NA	NA	NA	NA
AXN66166.1\|1971449_1971692_-	membrane protein	NA	NA	NA	NA
AXN66167.1\|1971927_1972899_-\|tRNA	methionyl-tRNA formyltransferase	NA	NA	NA	NA
AXN66168.1\|1972895_1973360_-	Hypothetical protein	NA	NA	NA	NA
AXN66169.1\|1973325_1973847_-	Phosphohydrolase MutT/nudix family	NA	NA	NA	NA
AXN66170.1\|1973860_1974235_-	hypothetical protein	NA	NA	NA	NA
AXN66171.1\|1975495_1977841_-	primosome assembly protein PriA	NA	NA	NA	NA
AXN66172.1\|1978017_1978371_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AXN66173.1\|1978439_1979057_-	guanylate kinase	NA	NA	NA	NA
AXN66174.1\|1979205_1980801_-	2,3-cyclic-nucleotide 2-phosphodiesterase	NA	NA	NA	NA
AXN66175.1\|1981034_1981748_-	6-phosphogluconolactonase	NA	NA	NA	NA
AXN66176.1\|1981851_1983051_-	S-adenosylmethionine synthetase	A0A2H4PQS6	Staphylococcus_phage	3.7e-140	66.0
AXN66177.1\|1983543_1984737_-	cyclopropane-fatty-acyl-phospholipid synthase	NA	NA	NA	NA
AXN66178.1\|1984892_1985645_+	acetyl-CoA carboxylase ligase / biotin operon repressor bifunctional protein	NA	NA	NA	NA
AXN66179.1\|1985772_1986237_-	Putative stress-responsive transcriptional regulator	NA	NA	NA	NA
1985789:1985805	attR	NA	NA	NA	NA
AXN66180.1\|1986264_1986468_-	hypothetical protein	NA	NA	NA	NA
AXN66181.1\|1986572_1987685_-	hypothetical protein	NA	NA	NA	NA
AXN66182.1\|1987895_1989527_-	Surface antigen	A0A0A7RUS8	Clostridium_phage	5.3e-17	36.4
AXN66183.1\|1989975_1990779_-	fructose-bisphosphate aldolase	NA	NA	NA	NA
AXN66184.1\|1996811_1997471_-	membrane protein	NA	NA	NA	NA
AXN66185.1\|1997576_1999517_-\|tRNA	Ser-tRNA(Thr) hydrolase / threonyl-tRNA synthetase	A0A1V0SKZ9	Klosneuvirus	3.7e-65	33.2

DBSCAN-SWA_12

2069578 : 2084400

Lactococcus_phage(89.47%)

protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN66254.1\|2069578_2069899_-	hypothetical protein	Q9AZD9	Lactococcus_phage	8.7e-49	94.3
AXN66255.1\|2069999_2070329_-	hypothetical protein	Q9AZE0	Lactococcus_phage	2.3e-52	98.2
AXN66256.1\|2070542_2071133_-\|head,protease	prohead protease	Q9AZE1	Lactococcus_phage	1.9e-105	97.4
AXN66257.1\|2071141_2071750_-	hypothetical protein	Q9AZE2	Lactococcus_phage	1.3e-77	79.7
AXN66258.1\|2071775_2071958_-	hypothetical protein	Q9AZE3	Lactococcus_phage	1.4e-22	91.4
AXN66259.1\|2072164_2073799_-	Phage DNA polymerase (ATPase domain)	Q9AZI5	Lactococcus_phage	5.8e-298	92.6
AXN66260.1\|2073809_2074604_-	hypothetical protein	Q9AZI6	Lactococcus_phage	2.3e-143	90.5
AXN66261.1\|2074600_2074936_-	hypothetical protein	Q9AZI7	Lactococcus_phage	1.7e-50	89.8
AXN66262.1\|2074932_2075247_-	hypothetical protein	NA	NA	NA	NA
AXN66263.1\|2075243_2075498_-	hypothetical protein	Q9AZE9	Lactococcus_phage	1.3e-34	86.7
AXN66264.1\|2075494_2075734_-	hypothetical protein	Q9AZJ0	Lactococcus_phage	1.0e-38	97.5
AXN66265.1\|2075776_2076058_-	hypothetical protein	Q9AZJ1	Lactococcus_phage	3.0e-45	93.5
AXN66266.1\|2076050_2076575_-	hypothetical protein	Q9AZJ3	Lactococcus_phage	1.5e-69	77.2
AXN66267.1\|2076571_2076769_-	hypothetical protein	Q9AZF2	Lactococcus_phage	1.4e-25	95.1
AXN66268.1\|2076783_2077005_-	hypothetical protein	NA	NA	NA	NA
AXN66269.1\|2077629_2078319_-	phage-encoded protein	R9QNB1	Lactococcus_phage	1.3e-89	78.7
AXN66270.1\|2078424_2078640_-	repressor	A5GZ66	Lactococcus_phage	4.8e-11	47.0
AXN66271.1\|2078764_2079241_+	XRE family transcriptional regulator	A5GZ65	Lactococcus_phage	8.8e-13	58.2
AXN66272.1\|2079365_2079623_+	hypothetical protein	NA	NA	NA	NA
AXN66273.1\|2080126_2080405_+	hypothetical protein	A3QSC6	Clostridium_virus	1.8e-05	32.5
AXN66274.1\|2081521_2081686_+	hypothetical protein	NA	NA	NA	NA
AXN66275.1\|2081673_2082822_+	specificity determinant HsdS	A0A2H4PQP5	Staphylococcus_phage	2.0e-26	28.7
AXN66276.1\|2083218_2084400_+	Integrase	Q9AZK8	Lactococcus_phage	1.2e-90	45.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP031543

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1772 : 9305

Streptococcus_phage(50.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXN66713.1\|1772_3020_+	Relaxase	A0A2H4PQP5	Staphylococcus_phage	7.9e-21	26.4
AXN66714.1\|3205_4156_+	Mg2 and Co2 transporter	NA	NA	NA	NA
AXN66715.1\|4537_5119_+	hypothetical protein	NA	NA	NA	NA
AXN66716.1\|5134_5725_+\|integrase	integrase	D2XR58	Bacillus_phage	1.4e-20	33.7
AXN66717.1\|5929_6448_-	helicase	NA	NA	NA	NA
AXN66718.1\|6641_7322_+	Transposase	A0A1X9I6C6	Streptococcus_phage	9.1e-112	85.4
AXN66719.1\|7451_7730_+	hypothetical protein	NA	NA	NA	NA
AXN66720.1\|7937_8129_+	Transposase	A0A1X9I6E7	Streptococcus_phage	5.1e-20	90.2
AXN66721.1\|8083_8314_+	Transposase	A0A1X9I6E7	Streptococcus_phage	1.8e-27	78.4
AXN66722.1\|8615_9305_-	diadenosine tetraphosphatase	A0A0C5JZB3	Enterococcus_phage	1.4e-30	35.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP031540

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP031538

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP031543

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection