CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP031723	Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence	1 crisprs	csa3	1	2
CP031725	Enterobacter hormaechei strain WCHEH020038 plasmid pNDM5_020038, complete sequence	0 crisprs	NA	0	0
CP031724	Enterobacter hormaechei strain WCHEH020038 plasmid pCTXM9_020038, complete sequence	0 crisprs	csa3	0	3
CP031726	Enterobacter hormaechei strain WCHEH020038 chromosome, complete genome	0 crisprs	cas3,DinG,DEDDh,csa3,WYL,cas14j	0	337
CP031722	Enterobacter hormaechei strain WCHEH020038 plasmid p1_020038, complete sequence	0 crisprs	DEDDh	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP031723_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP031723_1

50263-50397

Orphan

Consensus_repeat	Method
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP031723_1

>merge|CP031723|1|50263-50397|CRISPRCasFinder
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCACCTCCTACTTGCGTGTCAGAACTCATCCTTCAACCCCGTCTGGAATATCGATTCCACACGCCGGATTTAACTGGGACCATGGTCCCAC

>CP031723|1|1|50263-50397|CRISPRCasFinder
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCAC	CTCCTACTTGCGTGTCAGAACTCATCCTTCAACCCCGTC
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCATGGTCCCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP031723.1\|AXQ32049.1\|48958_49924_+\|ParB/RepB/Spo0J-family-plasmid-partition-protein	unknown	unknown	gnl\|CDD\|184254
CP031723.1\|AXQ32058.1\|58292_58559_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	gnl\|CDD\|368576
CP031723.1\|AXQ32042.1\|42820_43051_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
CP031723.1\|AXQ32051.1\|51321_52026_-\|IS6-family-transposase-IS15DIV	unknown	unknown	gnl\|CDD\|225853
CP031723.1\|AXQ32059.1\|58701_59466_+\|IS6-like-element-IS6100-family-transposase	unknown	unknown	gnl\|CDD\|225853
CP031723.1\|AXQ32046.1\|44562_45339_+\|phage-integrase-family-protein	unknown	unknown	gnl\|CDD\|334163
CP031723.1\|AXQ32052.1\|52072_52681_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|172294
CP031723.1\|AXQ32048.1\|47792_48959_+\|plasmid-partitioning-protein-SopA	unknown	unknown	gnl\|CDD\|184261
CP031723.1\|AXQ32047.1\|46041_47052_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
CP031723.1\|AXQ32055.1\|55654_56359_-\|IS6-family-transposase-IS15DIV	unknown	unknown	gnl\|CDD\|225853
CP031723.1\|AXQ32054.1\|54055_55165_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
CP031723.1\|AXQ32040.1\|40777_42340_-\|ATP-dependent-endonuclease	unknown	unknown	gnl\|CDD\|173776
CP031723.1\|AXQ32043.1\|43007_43310_+\|hypothetical-protein	unknown	unknown	unknown
CP031723.1\|AXQ32045.1\|44013_44544_+\|hypothetical-protein	unknown	unknown	unknown
CP031723.1\|AXQ32050.1\|50573_51254_-\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|179607
CP031723.1\|AXQ32053.1\|52776_53961_+\|tetracycline-efflux-MFS-transporter-Tet(D)	unknown	unknown	gnl\|CDD\|340946
CP031723.1\|AXQ32057.1\|57598_58072_+\|trimethoprim-resistant-dihydrofolate-reductase-DfrA14	unknown	unknown	gnl\|CDD\|238127
CP031723.1\|AXQ32056.1\|56429_57443_-\|class-1-integron-integrase-IntI1	unknown	unknown	gnl\|CDD\|185315
CP031723.1\|AXQ32044.1\|43592_43883_+\|hypothetical-protein	unknown	unknown	unknown
CP031723.1\|AXQ32041.1\|42413_42824_-\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350229

Protein	Function_ID	Function_description	E-value
CP031723.1\|AXQ32049.1\|48958_49924_+\|ParB/RepB/Spo0J-family-plasmid-partition-protein	gnl\|CDD\|184254	PRK13698, PRK13698, ParB/RepB/Spo0J family plasmid partition protein.	0
CP031723.1\|AXQ32055.1\|55654_56359_-\|IS6-family-transposase-IS15DIV	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
CP031723.1\|AXQ32051.1\|51321_52026_-\|IS6-family-transposase-IS15DIV	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
CP031723.1\|AXQ32059.1\|58701_59466_+\|IS6-like-element-IS6100-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.97603e-67
CP031723.1\|AXQ32046.1\|44562_45339_+\|phage-integrase-family-protein	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	9.41107e-39
CP031723.1\|AXQ32052.1\|52072_52681_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|172294	PRK13756, PRK13756, TetR family transcriptional regulator.	5.40352e-132
CP031723.1\|AXQ32056.1\|56429_57443_-\|class-1-integron-integrase-IntI1	gnl\|CDD\|185315	PRK15417, PRK15417, integron integrase.	0
CP031723.1\|AXQ32047.1\|46041_47052_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	0.000207968
CP031723.1\|AXQ32054.1\|54055_55165_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
CP031723.1\|AXQ32040.1\|40777_42340_-\|ATP-dependent-endonuclease	gnl\|CDD\|173776	cd01026, TOPRIM_OLD, TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family. The bacteriophage P2 OLD protein, which has DNase as well as RNase activity, consists of an N-terminal ABC-type ATPase domain and a C-terminal Toprim domain; the nuclease activity of OLD is stimulated by ATP, though the ATPase activity is not DNA-dependent. Functional details on OLD are scant and further experimentation is required to define the relationship between the ATPase and Toprim nuclease domains. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). The conserved glutamate may act as a general acid in strand cleavage by nucleases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.	3.83508e-20
CP031723.1\|AXQ32058.1\|58292_58559_+\|plasmid-mobilization-relaxosome-protein-MobC	gnl\|CDD\|368576	pfam05713, MobC, Bacterial mobilisation protein (MobC). This family consists of several bacterial MobC-like, mobilisation proteins. MobC proteins belong to the group of relaxases. Together with MobA and MobB they bind to a single cis-active site of a mobilising plasmid, the origin of transfer (oriT) region. The absence of MobC has several different effects on oriT DNA. Site- and strand-specific nicking by MobA protein is severely reduced, accounting for the lower frequency of mobilisation. The localized DNA strand separation required for this nicking is less affected, but becomes more sensitive to the level of active DNA gyrase in the cell. In addition, strand separation is not efficiently extended through the region containing the nick site. These effects suggest a model in which MobC acts as a molecular wedge for the relaxosome-induced melting of oriT DNA. The effect of MobC on strand separation may be partially complemented by the helical distortion induced by supercoiling. However, MobC extends the melted region through the nick site, thus providing the single-stranded substrate required for cleavage by MobA.	3.4368e-05
CP031723.1\|AXQ32041.1\|42413_42824_-\|PIN-domain-containing-protein	gnl\|CDD\|350229	cd09881, PIN_VapC4-5_FitB-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC4 and VapC5, and Neisseria gonorrhoeae FitB and related proteins. This family includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This family belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	4.70668e-41
CP031723.1\|AXQ32050.1\|50573_51254_-\|DUF4113-domain-containing-protein	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	4.99848e-165
CP031723.1\|AXQ32053.1\|52776_53961_+\|tetracycline-efflux-MFS-transporter-Tet(D)	gnl\|CDD\|340946	cd17388, MFS_TetA, Tetracycline resistance protein TetA and related proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of tetracycline resistance proteins similar to Escherichia coli TetA(A), TetA(B), and TetA(E), which are metal-tetracycline/H(+) antiporters that confer resistance to tetracycline by an active tetracycline efflux, which is an energy-dependent process that decreases the accumulation of the antibiotic in cells. TetA-like tetracycline resistance proteins belongs to the Eukaryotic Solute carrier 46 (SLC46)/Bacterial Tetracycline resistance (TetA) -like (SLC46/TetA-like) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.08286e-146
CP031723.1\|AXQ32057.1\|57598_58072_+\|trimethoprim-resistant-dihydrofolate-reductase-DfrA14	gnl\|CDD\|238127	cd00209, DHFR, Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate which is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication, inhibitors of DHFR (such as Methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis.	1.49291e-53
CP031723.1\|AXQ32048.1\|47792_48959_+\|plasmid-partitioning-protein-SopA	gnl\|CDD\|184261	PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional.	0
CP031723.1\|AXQ32042.1\|42820_43051_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	1.20731e-10

>CP031723.1|AXQ32049.1|48958_49924_+|ParB/RepB/Spo0J-family-plasmid-partition-protein
MKRAPVIPKHTVKDIRPETEPSAAPAAPMVDSLIARVGAMARGNTILLPVCGREVKFILEAIPGESVETASRVWSGNERDQELLTEDALDDLIPSFMLSGQQTPAFGRRVEGVIEIADGSRRRKAAILTSSDYRVLVGDLDDEQMMALSRLGNDYRPVSAYERGNRYAQRLENDFNGNISALAEAENISRKIITRCINTAHLPKSVVALFTHPGELSARSGETLYKAFSGKEALLLQRTQQLHEQKKAGVIFESEEVIGLLTDVLKEPSGKKVNLNTRHQFVPGATALYKGDKVIFNLDKSRLPAECIEKIESILRDLQKV
>CP031723.1|AXQ32048.1|47792_48959_+|plasmid-partitioning-protein-SopA
MGLMETLDQCITAGHEMTKAIAIAQFNDDSPEARKITRRWRVGEAADLIGVSSQAIRDAEKAGRLPHPDMEMRGRVEQRVGYTIEQINHMRDVFGTRLRRPDDSVPPVIAVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAEDTLLPFYLGERDDAAYAVKATCWPGLDIIPSCLALHRIETELMGRFDNGKLPTEPHMMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDLLKNVDLQGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR
>CP031723.1|AXQ32047.1|46041_47052_-|replication-initiation-protein
MAMENNELPLNLQEVNKTTGEVVKLDVNSASTVQPVALMRLGLFVPTLKSTSRSKTNRKNVTDATEELVQLSIARSEGYTDVRITGSRLDMDTDFKVWLGIIRSMYDFGVKDDTLKLSFVEFVKMCGFDSRRSNKKMRDRISNSLFKLASVTLKFQSETKGWTTHLVQSAYYDITADVVEIRAEPKLFELYQMDRRVLLRLKAIDALQRKESAQALYTYIESLPQNPAPISMKRMRDRLNLTSNLYTQNHTVRKAMAQLKDIGYLDYTEFKRGRATYFSVHYRNPKLISSKVVVPREPEEEVPEQNYDEVIKALKAAGIDPQKLAKALASVKPGND
>CP031723.1|AXQ32046.1|44562_45339_+|phage-integrase-family-protein
MMPALPGHSGAFSSAQLPVAIDYPAALALRQMALVQDELPKYLLAPEVSALLHYVPDLHRKMLLTTLWNTGARINEALALTRSDFSLAPPYPFVQLATLKQRVEKAARTAGRAPAGSQPHRNVPLSDPQYARQLEMMVATLKIPLERRNKRTGRTEKVRIWEITDRTVRTWLGEAVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFSMAEADAVAMLKKR
>CP031723.1|AXQ32045.1|44013_44544_+|hypothetical-protein
MCKLTGFIMGLTILLGVTARDAGAATLSEMRMVNASQKPGMVIICSRTSEIPQKGESPVRIESLLRGVVLQNDGDRMMFDVTYTQRNAEESIPFRTEKYRLTTELEATRQKMAIDPETIELSLPRARGLEETFLAGMKASPVSFEDYTNYRVKSATEYLILPGPASPDAPVMHCTL
>CP031723.1|AXQ32044.1|43592_43883_+|hypothetical-protein
MNMKITLSVLFEALIILGHDRVWMEESEFEHIYGYGCYREIHTWDDRTVAWWDDADDTWYLSTEVDVITPFLGPLPKKEGELSEEKCFQLMTLGRY
>CP031723.1|AXQ32043.1|43007_43310_+|hypothetical-protein
MARLLPFLKIDTVLMIFLPGKYGYVMHIRNEVHCTGCVHMFSIGRCSAYVYIEHMQMVSICVCHTYADVRHMDMLCISFLFTFPGQIRKKVVPDHGDFLR
>CP031723.1|AXQ32042.1|42820_43051_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMAERGDVVSDEGRVNL
>CP031723.1|AXQ32041.1|42413_42824_-|PIN-domain-containing-protein
MNKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITWAEVSLASQEAGPAAQKLADAFAARLDAILPWDRTAVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
>CP031723.1|AXQ32040.1|40777_42340_-|ATP-dependent-endonuclease
MPLITRLMLQNFKKFPELDLRFTHDRNILVGDNESGKSTILLALDLVLSDSRHRVEALGVESLLSQSAVRHFQEGERRAELLPVLTADVFLSNGGDPDLNGRQNLAGIDADGLRMRIAPMTEEYGQDIHNVLQQDPDNFPYEYYSVRFSTFSGGHFAGFRRYLRHLLLDSARIDNEHAAQEYTRTVYSVNVPVADRYRLENSYRQQKMLFCTRHLSAINDTLETYQFGVRSGAKSGLEANLDITEDGISIRHRGKGRQCFIKTEFALQRHQQQGELHALLLEEPENHLSHVSMKRLVNQLATERQTQVFIATHSSHISSRLDLRKAILLGSTRPVLMNELSAETAAFFMKAPDNNVLEFALARRALLVEGDAEFILIEAFYRRLYGRAPEDDGVHIIAIGGTSFRRYLELARLLENRVAALRDNDGNYQQNCDERYADVLCSRTRAFADRDNTRSTFEICLYQDNAALCDALFRGTRRTLTVQEYMLANKAEAAFRLLQLHAEELTVPDYIQEALAWIRE
>CP031723.1|AXQ32050.1|50573_51254_-|DUF4113-domain-containing-protein
MGIRTALDLALTNPAFIRKNFSVVLERTVRELNGESCMSLEEAPPTKQQIVCSRSFGEKITEYDSLRQAVCQYAERASEKLRKERQYCRHISVFIKTSPFAVKEPYYGNVATEKLLTPTQDTRDIIAAATTALERIWKDGHLYAKAGVMLNDFTGSGVSQLQLFDERPPRPHSSELMKVLDGINHSGLGQIWFAGRGIAPSWQMKRDMLSPAYTTRWKDIPVARIR
>CP031723.1|AXQ32051.1|51321_52026_-|IS6-family-transposase-IS15DIV
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>CP031723.1|AXQ32052.1|52072_52681_-|TetR-family-transcriptional-regulator
MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAAPDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFGHCCK
>CP031723.1|AXQ32053.1|52776_53961_+|tetracycline-efflux-MFS-transporter-Tet(D)
MNKPAVIALVITLLDAMGIGLIMPVLPSLLREYLPEADVANHYGILLALYAVMQVCFAPLLGRWSDKLGRRPVLLLSLAGAAFDYTLLALSNVLWMLYLGRIISGITGATGAVAASVVADSTAVSERTAWFGRLGAAFGAGLIAGPAIGGLAGDISPHLPFVIAAILNACTFLMVFFIFKPAVQTEEKPAEQKQESAGISFITLLKPLALLLFVFFTAQLIGQIPATVWVLFTESRFAWDSAAVGFSLAGLGAMHALFQAVVAGALAKRLSEKTIIFAGFIADATAFLLMSAITSGWMVYPVLILLAGGGIALPALQGIISAGASAANQGKLQGVLVSLTNLTGVAGPLLFAFIFSQTQQSADGTVWLIGTALYGLLLAICLLIRKPAPVAATC
>CP031723.1|AXQ32054.1|54055_55165_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFGPGLPLEIVEIDVAPPKKGEVLVKISHTGVCHTDAYTLSGDDPEGLFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECDFCTSGKTNLCVAVRETQGKGVMPDGTSRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPQANAEQVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGGIGLAVVQGARQAKAGRIFAIDTNPSKFELAKQFGATDCINPNDYDKPVQQVLVEMTKWGVDHTFECIGNVNVMRSALESAHRGWGQSVIIGVAGAGKEISTRPFQLVTGRVWKGTAFGGVKGRTQLPGMVEDAMSGKIELAPFVTHTMELDKINEAFDLMHDGKSIRTVIHY
>CP031723.1|AXQ32055.1|55654_56359_-|IS6-family-transposase-IS15DIV
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>CP031723.1|AXQ32056.1|56429_57443_-|class-1-integron-integrase-IntI1
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER
>CP031723.1|AXQ32057.1|57598_58072_+|trimethoprim-resistant-dihydrofolate-reductase-DfrA14
MKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLSTIDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
>CP031723.1|AXQ32058.1|58292_58559_+|plasmid-mobilization-relaxosome-protein-MobC
MPVLTDEEVNTVRESCRQLGAIGRNLNQVARALNIEFRESDKLKQEAIEKLAERIDQHLDHVSELFDKTWSRWHDCHFQKTTAPVDWA
>CP031723.1|AXQ32059.1|58701_59466_+|IS6-like-element-IS6100-family-transposase
MTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEMLAERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREGKLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQARPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP012428	Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence	20127-20165	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NC_014107	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence	48095-48133	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	40032-40070	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	40032-40070	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP042541	Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence	40032-40070	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP031723	Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence	50311-50349	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP042567	Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence	40032-40070	0	1.0
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	100226-100264	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1315-1353	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1402-1440	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP031569	Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence	7815-7853	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP050011	Citrobacter sp. Y3 plasmid unnamed2, complete sequence	27572-27610	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP019840	Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence	70340-70378	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP022149	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence	50338-50376	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP009855	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence	14593-14631	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP008907	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence	83191-83229	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	65584-65622	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_LT991956	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2	52487-52525	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP029719	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence	1341-1379	1	0.974
CP031723_1	1.1\|50311\|39\|CP031723\|CRISPRCasFinder	50311-50349	39	NZ_CP039454	Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence	72766-72804	3	0.923

1. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP012428 (Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

2. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NC_014107 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

3. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP046273 (Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

4. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP012169 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

5. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP042541 (Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

6. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP031723 (Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

7. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP042567 (Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

8. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

9. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

10. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

11. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP031569 (Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

12. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP050011 (Citrobacter sp. Y3 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

13. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP019840 (Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

14. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP022149 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

15. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP009855 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

16. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP008907 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

17. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

18. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_LT991956 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

19. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP029719 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

20. spacer 1.1|50311|39|CP031723|CRISPRCasFinder matches to NZ_CP039454 (Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence) position: , mismatch: 3, identity: 0.923

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtttcagaactcatccgtcaaccccgcc	Protospacer
************* ************* *********.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

32 : 62408

Escherichia_phage(18.18%)

transposase,integrase

attL 56409:56427|attR 73218:73236

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32000.1\|32_1037_-\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
AXQ32001.1\|2933_3638_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32002.1\|3831_5178_+	ImpA domain-containing protein	NA	NA	NA	NA
AXQ32003.1\|5351_5990_+	DUF2913 family protein	NA	NA	NA	NA
AXQ32004.1\|6123_6954_+	hypothetical protein	NA	NA	NA	NA
AXQ32005.1\|7702_8521_+	hypothetical protein	NA	NA	NA	NA
AXQ32006.1\|8887_9373_-	N-acetyltransferase	NA	NA	NA	NA
AXQ32007.1\|9360_9627_-	DUF1778 domain-containing protein	NA	NA	NA	NA
AXQ32083.1\|9986_10166_-	hypothetical protein	NA	NA	NA	NA
AXQ32008.1\|10279_11293_+	replication initiation protein	NA	NA	NA	NA
AXQ32009.1\|11833_12100_-	hypothetical protein	NA	NA	NA	NA
AXQ32010.1\|12243_13050_+	DUF4225 domain-containing protein	NA	NA	NA	NA
AXQ32011.1\|13024_13354_-	hypothetical protein	NA	NA	NA	NA
AXQ32012.1\|13436_13775_-	hypothetical protein	NA	NA	NA	NA
AXQ32013.1\|13789_14560_-	conjugal transfer protein TraX	NA	NA	NA	NA
AXQ32014.1\|14926_15451_-	hypothetical protein	NA	NA	NA	NA
AXQ32015.1\|15592_15853_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
AXQ32016.1\|15839_16136_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AXQ32017.1\|16355_16790_-	copper-binding protein	NA	NA	NA	NA
AXQ32018.1\|17007_18408_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.9e-18	26.3
AXQ32019.1\|18404_19085_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.9e-30	34.8
AXQ32020.1\|19139_20069_-	copper resistance protein CopD	NA	NA	NA	NA
AXQ32021.1\|20073_20454_-	copper resistance system chaperone PcoC	NA	NA	NA	NA
AXQ32022.1\|20493_21390_-	copper resistance protein B	NA	NA	NA	NA
AXQ32023.1\|21389_23207_-	multicopper oxidase PcoA	NA	NA	NA	NA
AXQ32024.1\|23293_23512_+	hypothetical protein	NA	NA	NA	NA
AXQ32025.1\|23441_23891_+	copper resistance protein	NA	NA	NA	NA
AXQ32026.1\|24179_24917_+	peptidase M23	A0A2H4JAF5	uncultured_Caudovirales_phage	1.3e-10	31.9
AXQ32027.1\|24950_25148_-	DUF2933 domain-containing protein	NA	NA	NA	NA
AXQ32028.1\|25188_27630_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.4e-83	35.3
AXQ32029.1\|27757_28198_-	hypothetical protein	NA	NA	NA	NA
AXQ32030.1\|28283_31430_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	6.8e-61	22.2
AXQ32031.1\|31440_32733_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AXQ32032.1\|32846_33200_-	copper ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ32033.1\|33228_34614_-	Cu(I)/Ag(I) efflux RND transporter outer membrane protein	NA	NA	NA	NA
AXQ32034.1\|34803_35484_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.7e-31	35.6
AXQ32035.1\|35476_36952_+	Cu(+)/Ag(+) sensor histidine kinase	W8CYF6	Bacillus_phage	2.3e-27	30.1
AXQ32036.1\|37202_37634_+	silver-binding protein SilE	NA	NA	NA	NA
AXQ32037.1\|37779_38130_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	6.0e-19	51.4
AXQ32038.1\|38315_39224_-	HNH endonuclease	NA	NA	NA	NA
AXQ32039.1\|39770_40793_-	DNA helicase UvrD	NA	NA	NA	NA
AXQ32040.1\|40777_42340_-	ATP-dependent endonuclease	NA	NA	NA	NA
AXQ32041.1\|42413_42824_-	PIN domain-containing protein	NA	NA	NA	NA
AXQ32042.1\|42820_43051_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AXQ32043.1\|43007_43310_+	hypothetical protein	NA	NA	NA	NA
AXQ32044.1\|43592_43883_+	hypothetical protein	NA	NA	NA	NA
AXQ32045.1\|44013_44544_+	hypothetical protein	NA	NA	NA	NA
AXQ32046.1\|44562_45339_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.0e-52	91.2
AXQ32047.1\|46041_47052_-	replication initiation protein	J9Q7H0	Salmonella_phage	6.3e-85	55.2
AXQ32048.1\|47792_48959_+	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	5.5e-218	94.3
AXQ32049.1\|48958_49924_+	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	9.8e-136	76.9
AXQ32050.1\|50573_51254_-	DUF4113 domain-containing protein	F1C5A5	Cronobacter_phage	1.6e-79	62.8
AXQ32051.1\|51321_52026_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32052.1\|52072_52681_-	TetR family transcriptional regulator	NA	NA	NA	NA
AXQ32053.1\|52776_53961_+	tetracycline efflux MFS transporter Tet(D)	NA	NA	NA	NA
AXQ32054.1\|54055_55165_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.8e-33	30.2
AXQ32055.1\|55654_56359_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
56409:56427	attL	NA	NA	NA	NA
AXQ32056.1\|56429_57443_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AXQ32057.1\|57598_58072_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
AXQ32058.1\|58292_58559_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AXQ32059.1\|58701_59466_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AXQ32060.1\|59507_59720_+	resolvase	NA	NA	NA	NA
AXQ32061.1\|59732_60941_+	restriction endonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
AXQ32062.1\|60974_62408_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
73218:73236	attR	NA	NA	NA	NA

DBSCAN-SWA_2

73387 : 82355

uncultured_Caudovirales_phage(83.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32069.1\|73387_74110_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.5e-96	73.0
AXQ32070.1\|74167_74596_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.3e-52	70.7
AXQ32071.1\|74645_75929_-	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	2.9e-175	74.6
AXQ32072.1\|76024_76378_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	5.9e-22	57.1
AXQ32073.1\|76860_78339_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	1.6e-198	74.0
AXQ32074.1\|78357_79185_+	universal stress protein	NA	NA	NA	NA
AXQ32075.1\|79349_82355_-\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP031724

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

81018 : 113421

Escherichia_phage(28.57%)

transposase,integrase

attL 98441:98457|attR 117852:117868

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32156.1\|81018_81999_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	1.0e-185	99.4
AXQ32383.1\|82037_82196_-	ABC transporter	NA	NA	NA	NA
AXQ32157.1\|82209_83451_+	tellurium resistance protein TerF	NA	NA	NA	NA
AXQ32158.1\|83541_83997_+	hypothetical protein	NA	NA	NA	NA
AXQ32159.1\|84237_84429_-	hypothetical protein	NA	NA	NA	NA
AXQ32160.1\|84520_84862_-	hypothetical protein	NA	NA	NA	NA
AXQ32161.1\|85848_86103_+	hypothetical protein	NA	NA	NA	NA
AXQ32162.1\|86105_88145_-	ATP-dependent helicase	E3T5J8	Cafeteria_roenbergensis_virus	1.7e-25	25.3
AXQ32163.1\|88141_89128_-	hypothetical protein	NA	NA	NA	NA
AXQ32164.1\|90048_90441_+	hypothetical protein	NA	NA	NA	NA
AXQ32165.1\|90419_90731_+	hypothetical protein	NA	NA	NA	NA
AXQ32166.1\|91099_91756_+	hypothetical protein	NA	NA	NA	NA
AXQ32167.1\|91958_92456_+	hypothetical protein	NA	NA	NA	NA
AXQ32168.1\|92460_93849_+	hypothetical protein	NA	NA	NA	NA
AXQ32384.1\|94249_94543_+	XRE family transcriptional regulator	NA	NA	NA	NA
AXQ32169.1\|94547_95873_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AXQ32170.1\|95933_96140_+	hypothetical protein	NA	NA	NA	NA
AXQ32171.1\|96240_96651_+	hypothetical protein	NA	NA	NA	NA
AXQ32172.1\|96663_97188_+	hypothetical protein	NA	NA	NA	NA
AXQ32173.1\|97369_98374_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
98441:98457	attL	NA	NA	NA	NA
AXQ32174.1\|101425_101983_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
AXQ32175.1\|102020_102341_-\|transposase	transposase	NA	NA	NA	NA
AXQ32176.1\|102279_103293_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AXQ32385.1\|103438_103972_+	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
AXQ32177.1\|104029_104821_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
AXQ32178.1\|104984_105332_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AXQ32179.1\|105325_106165_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AXQ32180.1\|106569_108111_+\|transposase	IS91 family transposase	NA	NA	NA	NA
AXQ32181.1\|108374_109031_+	quinolone resistance pentapeptide repeat protein QnrA1	NA	NA	NA	NA
AXQ32182.1\|109216_110092_+	LysR family transcriptional regulator	NA	NA	NA	NA
AXQ32386.1\|110095_110461_-	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
AXQ32387.1\|110353_110689_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AXQ32183.1\|110682_111522_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AXQ32184.1\|111451_111631_-	hypothetical protein	NA	NA	NA	NA
AXQ32185.1\|111649_112150_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXQ32186.1\|112455_112569_-	NTP-binding protein	NA	NA	NA	NA
AXQ32187.1\|112656_113421_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
117852:117868	attR	NA	NA	NA	NA

DBSCAN-SWA_2

125842 : 162718

Escherichia_phage(54.55%)

transposase,integrase

attL 146637:146696|attR 153117:153230

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32202.1\|125842_126547_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32203.1\|126828_127005_+	hypothetical protein	Q716C2	Shigella_phage	6.7e-11	58.0
AXQ32204.1\|127072_127288_-	hypothetical protein	NA	NA	NA	NA
AXQ32205.1\|127368_128037_-	TetR family transcriptional regulator	NA	NA	NA	NA
AXQ32206.1\|128181_129381_+	tetracycline efflux MFS transporter Tet(A)	NA	NA	NA	NA
AXQ32207.1\|129895_130399_+	hypothetical protein	NA	NA	NA	NA
AXQ32208.1\|130435_131140_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32209.1\|131766_132471_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32210.1\|134104_135007_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
AXQ32211.1\|135044_135278_-	hypothetical protein	NA	NA	NA	NA
AXQ32212.1\|135268_136030_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AXQ32213.1\|136050_136911_-	class A extended-spectrum beta-lactamase SHV-12	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AXQ32214.1\|136874_137057_-	hypothetical protein	NA	NA	NA	NA
AXQ32215.1\|137643_139221_-	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	1.2e-95	99.4
AXQ32216.1\|139530_140091_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
AXQ32217.1\|140094_143061_+\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0
AXQ32390.1\|143556_145065_+\|transposase	IS21-like element ISCfr8 family transposase	A0A2L1IVA1	Escherichia_phage	9.9e-26	32.7
AXQ32218.1\|145051_145792_+	AAA family ATPase	U5N3V8	Enterobacteria_phage	4.4e-43	41.7
AXQ32219.1\|146019_146574_-	aminoglycoside N-acetyltransferase AAC(6')-Ib3	NA	NA	NA	NA
146637:146696	attL	NA	NA	NA	NA
AXQ32220.1\|146750_147764_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	6.1e-72	45.5
AXQ32221.1\|147702_148017_+\|transposase	transposase	NA	NA	NA	NA
AXQ32222.1\|148545_149250_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32223.1\|149355_150336_+\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	7.5e-184	99.1
AXQ32224.1\|150671_151331_+	type A-1 chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	4.2e-130	99.1
AXQ32225.1\|151292_151517_-	hypothetical protein	NA	NA	NA	NA
AXQ32226.1\|151507_152212_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXQ32227.1\|152102_153062_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.7e-47	40.5
AXQ32228.1\|153217_153691_+	trimethoprim-resistant dihydrofolate reductase DfrA16	G3MBI7	Bacillus_virus	1.4e-18	30.8
153117:153230	attR	NA	NA	NA	NA
AXQ32229.1\|153795_154587_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
AXQ32230.1\|154750_155098_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AXQ32231.1\|155091_155931_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AXQ32232.1\|156335_157877_+\|transposase	IS91 family transposase	NA	NA	NA	NA
AXQ32233.1\|158203_159079_+	class A extended-spectrum beta-lactamase CTX-M-9	A0A1B0VBP7	Salmonella_phage	2.3e-152	99.3
AXQ32234.1\|159983_161606_-	phosphoethanolamine--lipid A transferase	NA	NA	NA	NA
AXQ32235.1\|161794_162718_-\|transposase	IS5 family transposase	Q9MCT5	Escherichia_phage	8.4e-177	99.7

DBSCAN-SWA_3

176744 : 182013

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32253.1\|176744_178223_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	7.3e-199	74.4
AXQ32254.1\|178241_179069_+	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	4.9e-43	37.2
AXQ32255.1\|179128_179554_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.6e-50	70.7
AXQ32256.1\|179566_180856_-	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	9.9e-168	71.4
AXQ32257.1\|180901_181222_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.7e-20	53.7
AXQ32258.1\|181308_182013_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	8.8e-86	72.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP031726

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 9737

Buzura_suppressaria_nuclear_polyhedrosis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32455.1\|1348_3283_-	PrkA family serine protein kinase	NA	NA	NA	NA
AXQ32456.1\|3715_4462_+	MipA/OmpV family protein	NA	NA	NA	NA
AXQ32457.1\|4529_5414_-	D-hexose-6-phosphate mutarotase	NA	NA	NA	NA
AXQ32458.1\|5488_6484_-	glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AXQ32459.1\|6825_7239_+	peptide-methionine (R)-S-oxide reductase	NA	NA	NA	NA
AXQ32460.1\|7280_7559_+	DUF1315 family protein	NA	NA	NA	NA
AXQ32461.1\|7619_8876_-	chitinase	W5VKF1	Buzura_suppressaria_nuclear_polyhedrosis_virus	4.5e-24	28.2
AXQ32462.1\|9095_9737_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L2K0	Tupanvirus	2.1e-17	34.6

DBSCAN-SWA_2

14565 : 16473

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32466.1\|14565_16473_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	6.8e-40	29.5

DBSCAN-SWA_3

21394 : 22015

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32473.1\|21394_22015_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	3.8e-08	28.4

DBSCAN-SWA_4

26622 : 27843

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32478.1\|26622_27843_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-25	27.5

DBSCAN-SWA_5

35173 : 36001

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32486.1\|35173_36001_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.1e-71	54.2

DBSCAN-SWA_6

42195 : 47903

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32494.1\|42195_44445_-	catalase HPII	A0A2K9L572	Tupanvirus	7.6e-139	48.2
AXQ32495.1\|44633_44888_+	cell division activator CedA	NA	NA	NA	NA
AXQ32496.1\|44936_46328_-	L-cystine transporter	NA	NA	NA	NA
AXQ32497.1\|46455_47046_-	metal-dependent hydrolase	NA	NA	NA	NA
AXQ36520.1\|47141_47903_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	1.9e-17	32.3

DBSCAN-SWA_7

54018 : 67438

Tupanvirus(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32506.1\|54018_55947_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.9e-128	37.1
AXQ32507.1\|55950_56493_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.8e-15	32.9
AXQ32508.1\|56590_56788_+	50S ribosomal protein L35	NA	NA	NA	NA
AXQ32509.1\|56838_57195_+	50S ribosomal protein L20	NA	NA	NA	NA
AXQ32510.1\|57499_58483_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	9.9e-35	43.2
AXQ32511.1\|58498_60886_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AXQ32512.1\|60890_61190_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	7.2e-13	40.0
AXQ32513.1\|61293_62274_+	vitamin B12 ABC transporter permease BtuC	NA	NA	NA	NA
AXQ32514.1\|62307_62859_+	glutathione peroxidase	NA	NA	NA	NA
AXQ32515.1\|62858_63614_+	vitamin B12 ABC transporter ATP-binding protein BtuD	A0A2R8FG22	Brazilian_cedratvirus	6.5e-10	29.2
AXQ32516.1\|63686_64151_+	endopeptidase	A0A1V0DZX6	Clostridioides_phage	2.3e-13	36.7
AXQ32517.1\|64444_65158_+	EAL domain-containing protein	NA	NA	NA	NA
AXQ32518.1\|65219_66662_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	5.7e-55	34.7
AXQ32519.1\|66658_67438_-	heme ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-13	28.6

DBSCAN-SWA_8

72760 : 77505

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32524.1\|72760_73807_-	3-deoxy-7-phosphoheptulonate synthase AroH	S4W5F1	Pandoravirus	6.1e-83	47.4
AXQ32525.1\|73957_74791_-	kinase/pyrophosphorylase	NA	NA	NA	NA
AXQ32526.1\|75126_77505_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	1.6e-171	36.7

DBSCAN-SWA_9

99689 : 106704

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32546.1\|99689_100418_+	helix-turn-helix-type transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.8e-50	50.8
AXQ36523.1\|100527_100983_-	DUF3828 domain-containing protein	NA	NA	NA	NA
AXQ32547.1\|101362_101629_-	hypothetical protein	NA	NA	NA	NA
AXQ32548.1\|101617_101986_+	Fe-S cluster assembly scaffold SufA	A0A2H4N7N5	Lake_Baikal_phage	2.9e-16	42.2
AXQ32549.1\|101994_103485_+	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
AXQ32550.1\|103494_104241_+	Fe-S cluster assembly ATPase SufC	A0A1V0SE00	Indivirus	3.3e-06	24.3
AXQ32551.1\|104215_105487_+	Fe-S cluster assembly protein SufD	NA	NA	NA	NA
AXQ32552.1\|105483_106704_+	cysteine desulfurase SufS	Q2XUY6	environmental_halophage	7.6e-93	41.9

DBSCAN-SWA_10

111812 : 114606

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32558.1\|111812_113183_-	pyridoxal-phosphate dependent enzyme	A0A1W6JHY1	Lactococcus_phage	2.9e-48	37.4
AXQ32559.1\|113583_114606_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.3e-28	34.7

DBSCAN-SWA_11

117817 : 118633

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32565.1\|117817_118633_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.8e-35	41.4

DBSCAN-SWA_12

128182 : 139343

Cyanophage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32574.1\|128182_128653_+	heat-shock protein	A0A1D7SNF0	Cyanophage	5.8e-09	31.8
AXQ32575.1\|129142_130516_-	MdtK family multidrug efflux MATE transporter	NA	NA	NA	NA
AXQ32576.1\|130741_131383_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	3.9e-24	37.3
AXQ32577.1\|131414_132563_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	3.6e-84	44.8
AXQ32578.1\|132861_134061_-	Bcr/CflA family multidrug efflux MFS transporter	NA	NA	NA	NA
AXQ32579.1\|134173_135085_+	LysR family transcriptional regulator	NA	NA	NA	NA
AXQ32580.1\|135102_136128_-	HTH-type transcriptional repressor PurR	C6ZCU4	Enterobacteria_phage	1.3e-32	32.2
AXQ32581.1\|136425_136515_+	YnhF family membrane protein	NA	NA	NA	NA
AXQ32582.1\|136676_137843_+	MFS transporter	NA	NA	NA	NA
AXQ32583.1\|137880_138462_-	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	6.2e-45	45.3
AXQ32584.1\|138584_139343_-	peptidoglycan endopeptidase	A0A217EQL1	Bacillus_phage	9.4e-17	38.7

DBSCAN-SWA_13

146201 : 146720

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32592.1\|146201_146720_+	superoxide dismutase [Cu-Zn] SodC2	Q9MC02	Salmonella_phage	5.4e-48	56.1

DBSCAN-SWA_14

150494 : 151859

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32595.1\|150494_151859_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	9.0e-18	35.6

DBSCAN-SWA_15

155156 : 156431

Cronobacter_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32600.1\|155156_156431_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	1.6e-85	42.6

DBSCAN-SWA_16

181417 : 183460

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32623.1\|181417_182716_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	3.6e-16	24.5
AXQ32624.1\|183040_183460_-	anti-adapter protein IraM	Q20GJ2	Phage_258-320	2.8e-15	38.9

DBSCAN-SWA_17

195052 : 195568

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32635.1\|195052_195568_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.2e-24	56.9

DBSCAN-SWA_18

201929 : 210735

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32641.1\|201929_203591_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-10	61.9
AXQ32642.1\|203736_204603_+	aldo/keto reductase family oxidoreductase	NA	NA	NA	NA
AXQ32643.1\|204649_204850_-	hypothetical protein	NA	NA	NA	NA
AXQ36530.1\|205175_205595_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	6.7e-33	54.3
AXQ32644.1\|205942_208372_+	membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	NA	NA	NA	NA
AXQ32645.1\|208458_210735_-	pyrroloquinoline quinone biosynthesis protein PqqF	A0A2P1EIE5	Megavirus	5.0e-05	26.6

DBSCAN-SWA_19

215215 : 216481

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32651.1\|215215_216481_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	4.8e-207	82.0

DBSCAN-SWA_20

230324 : 231473

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32667.1\|230324_231473_-	osmoprotectant ABC transporter ATP-binding protein OsmV	G9BWD6	Planktothrix_phage	8.3e-25	32.6

DBSCAN-SWA_21

235801 : 259107

Escherichia_phage(35.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32672.1\|235801_236479_+	type A chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	1.5e-77	62.6
AXQ32673.1\|236654_236966_-	DNA damage-inducible SOS regulon protein	NA	NA	NA	NA
AXQ32674.1\|237075_237690_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	3.3e-28	34.7
AXQ32675.1\|237734_238589_-	dimethylsulfoxide reductase	A0A077SK59	Escherichia_phage	1.2e-23	34.9
AXQ32676.1\|238590_239208_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.4e-74	59.1
AXQ32677.1\|239218_241615_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	4.1e-215	49.5
AXQ32678.1\|241786_242092_-	DUF1161 domain-containing protein	NA	NA	NA	NA
AXQ32679.1\|242194_243049_-	benzoate transporter	M1I711	Paramecium_bursaria_Chlorella_virus	8.1e-25	33.2
AXQ32680.1\|243241_243952_+	YnfC family lipoprotein	NA	NA	NA	NA
AXQ32681.1\|243969_244530_-	spermidine N1-acetyltransferase	NA	NA	NA	NA
AXQ32682.1\|244529_244868_-	DUF1283 family protein	NA	NA	NA	NA
AXQ32683.1\|245018_245345_+	YnfA family protein	A0A218MNG8	uncultured_virus	7.1e-22	54.5
AXQ32684.1\|245456_246671_+	D-galactonate dehydratase family protein	Q6A202	Oenococcus_phage	3.3e-48	30.0
AXQ32685.1\|246685_247705_+	Zn-dependent oxidoreductase	NA	NA	NA	NA
AXQ32686.1\|247778_249158_+	MFS transporter	NA	NA	NA	NA
AXQ32687.1\|249381_250845_+	mannitol dehydrogenase family protein	H8ZJP8	Ostreococcus_tauri_virus	2.9e-46	30.5
AXQ32688.1\|250889_251093_-	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	4.4e-14	56.7
AXQ32689.1\|251380_251812_+	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	1.5e-16	35.2
AXQ32690.1\|251847_252534_-	GntR family transcriptional regulator	NA	NA	NA	NA
AXQ32691.1\|252624_253371_-	bifunctional NADP-dependent 3-hydroxy acid dehydrogenase/3-hydroxypropionate dehydrogenase YdfG	NA	NA	NA	NA
AXQ32692.1\|253514_255548_+	peptidyl-dipeptidase Dcp	A0A1V0SIU1	Klosneuvirus	1.7e-20	20.9
AXQ36532.1\|255678_256470_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
AXQ32693.1\|256579_257383_+	AraC family transcriptional regulator	NA	NA	NA	NA
AXQ32694.1\|257483_257975_+	DUF523 domain-containing protein	NA	NA	NA	NA
AXQ32695.1\|258034_258718_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.6e-79	59.5
AXQ32696.1\|258867_259107_-	DinI family protein	K7PKM2	Enterobacterial_phage	5.0e-33	91.1

DBSCAN-SWA_22

266800 : 267790

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32704.1\|266800_267790_-	2-hydroxyacid dehydrogenase	M1HUT5	Acanthocystis_turfacea_Chlorella_virus	1.6e-69	44.7

DBSCAN-SWA_23

297992 : 299213

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32733.1\|297992_299213_+	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	4.1e-38	31.6

DBSCAN-SWA_24

305419 : 310908

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32742.1\|305419_306106_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	8.5e-09	31.1
AXQ32743.1\|306196_306802_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AXQ32744.1\|307005_310908_+	ATP-dependent RNA helicase HrpA	A0A1V0SIV3	Klosneuvirus	5.0e-53	29.4

DBSCAN-SWA_25

317861 : 320257

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32749.1\|317861_318392_+	cytochrome b561	A0A0U2QLA7	Escherichia_phage	1.0e-17	43.0
AXQ32750.1\|318432_319500_-	oxidoreductase	NA	NA	NA	NA
AXQ32751.1\|319513_320257_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.7e-15	28.5

DBSCAN-SWA_26

340678 : 342844

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32754.1\|340678_342844_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.0e-31	27.2

DBSCAN-SWA_27

350844 : 353679

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32763.1\|350844_351964_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AXQ32764.1\|352252_352528_+	metal/formaldehyde-sensitive transcriptional repressor	NA	NA	NA	NA
AXQ32765.1\|352560_353679_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	3.6e-33	29.1

DBSCAN-SWA_28

358108 : 359614

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32769.1\|358108_359614_+	carboxylesterase/lipase family protein	S4VZJ7	Pandoravirus	1.1e-32	31.7

DBSCAN-SWA_29

367722 : 368952

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32778.1\|367722_368952_-	peptidase T	A0A0K2CPK3	Brevibacillus_phage	2.1e-05	39.1

DBSCAN-SWA_30

375291 : 380983

Phage_TP(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32785.1\|375291_377256_+\|protease	collagenase-like protease	Q6DW11	Phage_TP	1.2e-23	28.6
AXQ32786.1\|377252_377486_-	DUF2554 family protein	NA	NA	NA	NA
AXQ32787.1\|377729_378092_+	hypothetical protein	NA	NA	NA	NA
AXQ36537.1\|378240_379239_-	transcriptional regulator FtrA	NA	NA	NA	NA
AXQ32788.1\|379312_379723_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
AXQ32789.1\|379879_380983_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	A0A218MNE0	uncultured_virus	3.6e-102	48.4

DBSCAN-SWA_31

385124 : 386630

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32793.1\|385124_385922_+	urea ABC transporter ATP-binding protein UrtD	A0A2R8FG22	Brazilian_cedratvirus	4.7e-11	26.8
AXQ32794.1\|385931_386630_+	urea ABC transporter ATP-binding subunit UrtE	A0A2H4PQG7	Staphylococcus_phage	1.5e-13	25.8

DBSCAN-SWA_32

389964 : 390351

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32799.1\|389964_390351_-	MDR efflux pump AcrAB transcriptional activator MarA	D0R0F8	Streptococcus_phage	2.1e-09	33.3

DBSCAN-SWA_33

400245 : 401211

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32810.1\|400245_401211_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.9e-12	30.9

DBSCAN-SWA_34

406970 : 409003

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32817.1\|406970_407711_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.5e-30	35.5
AXQ32818.1\|407707_409003_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.0e-15	24.2

DBSCAN-SWA_35

428048 : 428933

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32836.1\|428048_428933_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	9.7e-82	56.5

DBSCAN-SWA_36

437136 : 441234

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32846.1\|437136_438687_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-09	25.8
AXQ32847.1\|438782_439799_-	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
AXQ32848.1\|439827_441234_-	glycosyl hydrolase family 32	S6ATV4	Bacillus_phage	2.4e-10	24.3

DBSCAN-SWA_37

453309 : 455961

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32859.1\|453309_454296_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	31.6
AXQ32860.1\|454288_455215_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-14	29.3
AXQ32861.1\|455211_455961_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.4e-17	33.7

DBSCAN-SWA_38

462798 : 465725

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32869.1\|462798_464508_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	4.2e-41	26.1
AXQ32870.1\|464714_465725_+	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	1.7e-26	25.8

DBSCAN-SWA_39

476179 : 478789

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32879.1\|476179_477253_+	porin OmpD	Q1MVN1	Enterobacteria_phage	1.7e-149	70.6
AXQ32880.1\|477298_478789_-	SmvA family efflux MFS transporter	A0A0M3UL24	Mycobacterium_phage	5.7e-34	30.9

DBSCAN-SWA_40

484882 : 486427

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32884.1\|484882_486427_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	39.5

DBSCAN-SWA_41

489527 : 497582

Acinetobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32889.1\|489527_489890_+	CHAP domain-containing protein	E5EPY3	Acinetobacter_phage	1.3e-05	32.1
AXQ32890.1\|489889_490315_+	DUF3828 domain-containing protein	NA	NA	NA	NA
AXQ32891.1\|490382_492485_-	elongation factor G	E4ZFJ7	Streptococcus_phage	2.4e-62	27.0
AXQ32892.1\|492646_492946_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AXQ32893.1\|492938_493580_-	DNA-binding protein	NA	NA	NA	NA
AXQ32894.1\|493671_494673_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferase	A0A1W6JP29	Morganella_phage	4.4e-54	40.2
AXQ32895.1\|494859_495090_-	tautomerase PptA	NA	NA	NA	NA
AXQ32896.1\|495127_495745_-	glutathione S-transferase family protein	NA	NA	NA	NA
AXQ32897.1\|495911_496799_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ32898.1\|496808_497582_-	amino acid ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-20	31.5

DBSCAN-SWA_42

503529 : 504069

Leuconostoc_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32905.1\|503529_504069_-	adenylate kinase	A0A097BYE2	Leuconostoc_phage	3.4e-13	34.7

DBSCAN-SWA_43

508767 : 510885

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32910.1\|508767_510885_+	TonB-dependent receptor	A0A1B0VCF0	Salmonella_phage	3.3e-136	67.4

DBSCAN-SWA_44

536840 : 617852

Enterobacteria_phage(29.63%)

tail,tRNA,holin,plate,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ32934.1\|536840_538001_+	porin OmpS2	Q1MVN1	Enterobacteria_phage	2.5e-117	59.3
AXQ32935.1\|538035_538458_-	GFA family protein	NA	NA	NA	NA
AXQ32936.1\|538461_538659_-	hypothetical protein	NA	NA	NA	NA
AXQ32937.1\|539079_539280_+	hypothetical protein	A0A0U2JGI6	Escherichia_phage	1.1e-20	71.7
AXQ32938.1\|539699_540377_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	3.1e-80	58.7
AXQ32939.1\|540554_541400_+	ParA family protein	A0A1X9IGI7	Lactococcus_phage	1.6e-33	37.3
AXQ32940.1\|541392_541791_+	hypothetical protein	NA	NA	NA	NA
AXQ32941.1\|541790_542456_+	hypothetical protein	NA	NA	NA	NA
AXQ32942.1\|542489_543758_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	5.3e-230	91.7
AXQ32943.1\|543760_544180_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	5.5e-35	55.9
AXQ36540.1\|544352_544910_-	DNA-invertase	A0A1S6L009	Salmonella_phage	3.5e-77	78.7
AXQ32944.1\|545794_547120_-\|tail	phage tail protein	K7P6I4	Enterobacteria_phage	1.1e-137	60.3
AXQ32945.1\|547178_547412_-	cor protein	E4WL42	Enterobacteria_phage	7.3e-29	75.0
AXQ32946.1\|547519_548191_-	hypothetical protein	A0A2P0WA07	Enterobacter_phage	1.2e-87	73.5
AXQ32947.1\|548191_548506_-	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
AXQ32948.1\|548549_552101_-	DUF1983 domain-containing protein	K7P7D9	Enterobacteria_phage	0.0e+00	89.4
AXQ32949.1\|552153_552783_-\|tail	tail assembly protein	K7PGY0	Enterobacteria_phage	1.6e-54	57.9
AXQ32950.1\|552815_553526_-	peptidase P60	K7PJX1	Enterobacterial_phage	1.5e-141	95.7
AXQ32951.1\|553527_554283_-\|tail	phage minor tail protein L	G8C7J7	Escherichia_phage	5.2e-116	77.6
AXQ32952.1\|554279_554627_-\|tail	phage tail protein	I6PBN7	Cronobacter_phage	2.6e-38	63.5
AXQ32953.1\|554701_555385_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.4e-40	42.8
AXQ32954.1\|555498_558429_-\|tail	phage tail tape measure protein	I6PCW3	Cronobacter_phage	2.6e-131	35.6
AXQ32955.1\|558425_558740_-	hypothetical protein	I6PD79	Cronobacter_phage	1.1e-16	65.0
AXQ32956.1\|558736_559048_-	hypothetical protein	I6PDG2	Cronobacter_phage	2.4e-35	68.0
AXQ32957.1\|559110_559782_-\|tail	phage tail protein	I6PBN6	Cronobacter_phage	4.4e-50	48.4
AXQ32958.1\|559851_560262_-	hypothetical protein	I6PDJ8	Cronobacter_phage	1.7e-33	53.6
AXQ32959.1\|560258_560843_-	hypothetical protein	G8C7Q1	Escherichia_phage	8.5e-50	55.8
AXQ32960.1\|560844_561195_-	hypothetical protein	I6PD77	Cronobacter_phage	8.1e-32	55.2
AXQ32961.1\|561196_561679_-	hypothetical protein	A0A2I7RQ74	Vibrio_phage	2.3e-08	31.3
AXQ32962.1\|561996_562950_-	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	9.0e-134	74.7
AXQ32963.1\|562961_563732_-	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	2.2e-66	59.1
AXQ32964.1\|563812_564910_-	hypothetical protein	I6PD76	Cronobacter_phage	9.5e-119	59.1
AXQ32965.1\|564911_566300_-	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	3.3e-124	49.7
AXQ32966.1\|566301_567609_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	5.0e-143	57.3
AXQ32967.1\|567586_568585_-\|terminase	terminase small subunit	I6X6R5	Burkholderia_virus	1.1e-38	43.4
AXQ32968.1\|568631_569081_-	hypothetical protein	NA	NA	NA	NA
AXQ32969.1\|569862_570051_+	hypothetical protein	NA	NA	NA	NA
AXQ36541.1\|570801_571077_-	hypothetical protein	G8C7W1	Escherichia_phage	2.4e-31	83.3
AXQ32970.1\|571084_571714_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	4.6e-102	87.6
AXQ32971.1\|571713_571995_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	1.3e-19	46.2
AXQ32972.1\|571981_572368_-	hypothetical protein	A0A192Y8P2	Salmonella_phage	3.2e-45	78.1
AXQ32973.1\|572461_572650_-	hypothetical protein	NA	NA	NA	NA
AXQ32974.1\|573153_573345_-	hypothetical protein	NA	NA	NA	NA
AXQ32975.1\|573870_574704_-	antitermination protein	K7PKS8	Enterobacteria_phage	1.4e-122	78.7
AXQ36542.1\|574700_575063_-	RusA family crossover junction endodeoxyribonuclease	K7PM48	Enterobacteria_phage	5.2e-50	83.1
AXQ32976.1\|575065_575266_-	hypothetical protein	H6WRY8	Salmonella_phage	1.3e-26	77.3
AXQ32977.1\|575270_575873_-	DUF1367 family protein	A0A0M4QX23	Salmonella_phage	3.1e-95	83.0
AXQ36543.1\|575912_576110_-	hypothetical protein	K7PHG9	Enterobacteria_phage	1.4e-20	70.5
AXQ32978.1\|576260_576485_-	DinI family protein	K7PM44	Enterobacteria_phage	4.7e-25	71.4
AXQ32979.1\|576850_577300_-	glyoxalase/bleomycin resistance/extradiol dioxygenase family protein	NA	NA	NA	NA
AXQ32980.1\|577787_578969_+	diguanylate phosphodiesterase	NA	NA	NA	NA
AXQ32981.1\|579240_579897_+	TetR family transcriptional regulator	NA	NA	NA	NA
AXQ32982.1\|579958_580942_-	oxidoreductase	NA	NA	NA	NA
AXQ32983.1\|581385_581604_-	hypothetical protein	NA	NA	NA	NA
AXQ32984.1\|581907_582357_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
AXQ32985.1\|582464_582647_-	hypothetical protein	NA	NA	NA	NA
AXQ32986.1\|582633_583320_-	phage replication protein	G8C7U6	Escherichia_phage	6.4e-81	63.4
AXQ32987.1\|583316_584174_-	hypothetical protein	K7PGZ0	Enterobacteria_phage	2.9e-99	70.1
AXQ32988.1\|584318_584870_-	hypothetical protein	K7PJT7	Enterobacteria_phage	5.7e-32	46.4
AXQ32989.1\|584872_585091_-	Rha family transcriptional regulator	K7PKS2	Enterobacteria_phage	9.2e-18	57.7
AXQ32990.1\|585188_585572_+	transcriptional regulator	K7PHG0	Enterobacteria_phage	1.7e-46	76.4
AXQ32991.1\|585739_586879_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AXQ32992.1\|586875_587388_+	DUF4411 family protein	NA	NA	NA	NA
AXQ32993.1\|588164_591437_+	exodeoxyribonuclease	K7P6V4	Enterobacteria_phage	0.0e+00	68.4
AXQ32994.1\|591447_592533_+	enterohemolysin	K7PKR8	Enterobacteria_phage	2.0e-121	63.1
AXQ32995.1\|592571_592814_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	1.3e-33	93.6
AXQ32996.1\|592878_593091_+	hypothetical protein	A0A0U2RY08	Escherichia_phage	4.3e-20	64.8
AXQ32997.1\|593092_594331_+	DUF3596 domain-containing protein	A0A0U2JGI6	Escherichia_phage	1.0e-169	70.5
AXQ32998.1\|594369_595305_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.0e-142	95.7
AXQ32999.1\|595348_596722_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.1e-50	31.6
AXQ33000.1\|597070_597268_+	hypothetical protein	NA	NA	NA	NA
AXQ33001.1\|597206_598190_-	zinc transporter ZntB	NA	NA	NA	NA
AXQ33002.1\|598280_599411_-	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	28.6
AXQ33003.1\|599727_600216_-	hypothetical protein	NA	NA	NA	NA
AXQ33004.1\|600244_601561_-	hypothetical protein	NA	NA	NA	NA
AXQ33005.1\|601584_602040_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
AXQ33006.1\|603185_603710_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AXQ33007.1\|604594_605068_-	hypothetical protein	NA	NA	NA	NA
AXQ33008.1\|607193_607688_-	hypothetical protein	NA	NA	NA	NA
AXQ33009.1\|607697_608705_-	hypothetical protein	NA	NA	NA	NA
AXQ33010.1\|608694_611157_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
AXQ33011.1\|611161_611686_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AXQ33012.1\|611721_612804_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
AXQ33013.1\|613136_613628_-	hypothetical protein	NA	NA	NA	NA
AXQ33014.1\|616082_617852_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

DBSCAN-SWA_45

624086 : 624350

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33018.1\|624086_624350_-	PAAR domain-containing protein	R9U4D0	Rhizobium_phage	1.5e-06	48.0

DBSCAN-SWA_46

630536 : 633185

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33022.1\|630536_633185_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.2e-95	32.8

DBSCAN-SWA_47

650632 : 651715

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33037.1\|650632_651715_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-08	26.0

DBSCAN-SWA_48

668793 : 678277

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33054.1\|668793_669786_+	peptide ABC transporter ATP-binding protein SapD	G9BWD6	Planktothrix_phage	2.3e-07	26.1
AXQ33055.1\|669787_670594_+	peptide ABC transporter ATP-binding protein SapF	G3M9Y6	Bacillus_virus	2.3e-13	26.8
AXQ33056.1\|670590_671181_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AXQ33057.1\|671313_671715_+	RidA family protein	NA	NA	NA	NA
AXQ33058.1\|671762_672584_+	AraC family transcriptional regulator	NA	NA	NA	NA
AXQ33059.1\|672592_673933_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.2e-17	30.0
AXQ33060.1\|674326_675115_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
AXQ33061.1\|675267_676254_+	CMD domain-containing protein	NA	NA	NA	NA
AXQ33062.1\|676342_678277_+	exoribonuclease II	A0A2H4UVB7	Bodo_saltans_virus	4.2e-05	23.3

DBSCAN-SWA_49

686934 : 687525

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33071.1\|686934_687525_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-42	48.4

DBSCAN-SWA_50

692449 : 696779

Tupanvirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33075.1\|692449_695047_-	type I DNA topoisomerase	A0A2K9L5F8	Tupanvirus	4.6e-87	34.0
AXQ33076.1\|695445_695697_+	DUF2498 family protein	NA	NA	NA	NA
AXQ33077.1\|695732_696779_-\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	1.3e-19	29.2

DBSCAN-SWA_51

702728 : 705686

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33084.1\|702728_704324_+	bifunctional anthranilate synthase glutamate amidotransferase component TrpG/anthranilate phosphoribosyltransferase TrpD	A0A0N7IRD9	Acinetobacter_phage	1.8e-49	37.0
AXQ33085.1\|704327_705686_+	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.0e-37	41.0

DBSCAN-SWA_52

719967 : 722864

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33102.1\|719967_720804_-	transporter	A0A1B0Y2S3	Lactobacillus_phage	6.1e-09	39.8
AXQ33103.1\|720849_721854_-	oligopeptide ABC transporter ATP-binding protein OppF	G3M9Y6	Bacillus_virus	8.9e-15	30.7
AXQ33104.1\|721850_722864_-	oligopeptide ABC transporter ATP-binding protein OppD	G9BWD6	Planktothrix_phage	1.8e-15	29.4

DBSCAN-SWA_53

731079 : 741101

Citrobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36550.1\|731079_731694_-	thymidine kinase	A0A0A0YP64	Citrobacter_phage	1.7e-56	54.7
AXQ33110.1\|732244_732658_+	DNA-binding transcriptional regulator H-NS	NA	NA	NA	NA
AXQ33111.1\|732860_733766_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	2.6e-58	47.2
AXQ33112.1\|733965_734979_-	two-component system response regulator RssB	NA	NA	NA	NA
AXQ33113.1\|735068_735971_-	patatin-like phospholipase RssA	NA	NA	NA	NA
AXQ33114.1\|736084_736549_+	YchJ family protein	NA	NA	NA	NA
AXQ33115.1\|736590_737433_+	formyltetrahydrofolate deformylase	M4QRX9	Synechococcus_phage	2.7e-12	49.3
AXQ33116.1\|738181_738859_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
AXQ33117.1\|738858_739569_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
AXQ33118.1\|739565_741101_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.7e-20	42.2

DBSCAN-SWA_54

757436 : 758225

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33126.1\|757436_758225_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-30	36.9

DBSCAN-SWA_55

765416 : 771128

Mythimna_unipuncta_granulovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33134.1\|765416_765647_-	putative cation transport regulator ChaB	A0A1S5YE01	Mythimna_unipuncta_granulovirus	1.0e-06	45.3
AXQ33135.1\|765915_767016_+	sodium-potassium/proton antiporter ChaA	NA	NA	NA	NA
AXQ33136.1\|767122_767977_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.4e-47	39.5
AXQ33137.1\|768013_768823_-	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
AXQ33138.1\|768826_769219_-	SirB family protein	NA	NA	NA	NA
AXQ33139.1\|769215_770046_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
AXQ33140.1\|770045_771128_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	1.5e-07	41.6

DBSCAN-SWA_56

774230 : 776982

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36551.1\|774230_775178_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	3.9e-44	37.8
AXQ33144.1\|775302_776982_+	C4-dicarboxylic acid transporter DauA	A0A2H4J153	uncultured_Caudovirales_phage	1.5e-22	23.6

DBSCAN-SWA_57

787829 : 809611

Ralstonia_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33157.1\|787829_792254_-	type IV secretion protein Rhs	A0A2H4JHK7	uncultured_Caudovirales_phage	2.5e-29	49.3
AXQ33158.1\|792257_792698_-	DUF1795 domain-containing protein	NA	NA	NA	NA
AXQ33159.1\|792906_793425_-	hypothetical protein	NA	NA	NA	NA
AXQ33160.1\|793414_795997_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.3e-45	25.9
AXQ33161.1\|796156_797257_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	6.0e-57	43.0
AXQ33162.1\|797295_797676_-	hypothetical protein	NA	NA	NA	NA
AXQ33163.1\|797756_798071_-	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	6.4e-20	54.7
AXQ33164.1\|798143_799217_-	hypothetical protein	NA	NA	NA	NA
AXQ33165.1\|799239_799689_-	hypothetical protein	NA	NA	NA	NA
AXQ33166.1\|799698_800754_-	flagellar biosynthesis protein FlgH	NA	NA	NA	NA
AXQ33167.1\|800776_802735_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.0e-43	27.0
AXQ33168.1\|802818_803274_-	hypothetical protein	NA	NA	NA	NA
AXQ33169.1\|803287_804049_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
AXQ33170.1\|804045_805512_-	phospholipase	NA	NA	NA	NA
AXQ33171.1\|805537_806971_-	serine/threonine protein kinase	M1HKB5	Acanthocystis_turfacea_Chlorella_virus	6.1e-09	27.0
AXQ33172.1\|806995_809611_-	type VI secretion system ATPase TssH	A0A248SJW6	Salicola_phage	8.4e-81	31.4

DBSCAN-SWA_58

818014 : 819004

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33180.1\|818014_819004_-	hypothetical protein	A0A2H4J6N0	uncultured_Caudovirales_phage	5.1e-31	29.4

DBSCAN-SWA_59

856027 : 863269

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33213.1\|856027_857746_-	long-chain-fatty-acid--CoA ligase FadD	A0A2H4PQM9	Staphylococcus_phage	1.7e-34	26.0
AXQ33214.1\|857915_858497_-	Slp family lipoprotein	NA	NA	NA	NA
AXQ33215.1\|858534_859230_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AXQ33216.1\|859296_861207_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	8.0e-89	32.0
AXQ33217.1\|861340_861685_+	RidA family protein	NA	NA	NA	NA
AXQ33218.1\|861690_861873_-	YoaH family protein	NA	NA	NA	NA
AXQ33219.1\|861934_863269_+	aminodeoxychorismate synthase component 1	S4VNU7	Pandoravirus	2.2e-45	42.3

DBSCAN-SWA_60

867127 : 868687

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33223.1\|867127_868687_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	6.0e-42	45.4

DBSCAN-SWA_61

876119 : 876329

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33231.1\|876119_876329_-	cold-shock protein CspC	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1

DBSCAN-SWA_62

881593 : 883642

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33239.1\|881593_883642_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	7.8e-82	32.6

DBSCAN-SWA_63

890860 : 891505

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33246.1\|890860_891505_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	3.3e-55	49.8

DBSCAN-SWA_64

894756 : 894987

Pectobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33252.1\|894756_894987_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	7.0e-16	61.8

DBSCAN-SWA_65

903369 : 904845

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33260.1\|903369_904845_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	6.0e-76	36.2

DBSCAN-SWA_66

908759 : 914942

Listeria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33264.1\|908759_910079_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	1.2e-14	40.9
AXQ36555.1\|910094_911054_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
AXQ33265.1\|911116_911872_+	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	2.3e-15	30.2
AXQ33266.1\|911868_912654_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
AXQ33267.1\|912706_913717_-	Holliday junction branch migration DNA helicase RuvB	B3GAM6	uncultured_virus	2.4e-07	29.9
AXQ33268.1\|913725_914340_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AXQ33269.1\|914420_914942_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1

DBSCAN-SWA_67

918787 : 925420

Escherichia_coli_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33274.1\|918787_919606_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.8e-58	81.1
AXQ33275.1\|919657_920053_+	hypothetical protein	NA	NA	NA	NA
AXQ33276.1\|920093_920837_+	carboxy-S-adenosyl-L-methionine synthase CmoA	A0A1S6L2V9	Erwinia_phage	6.1e-29	30.2
AXQ33277.1\|920833_921805_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AXQ33278.1\|921701_922085_-	hypothetical protein	NA	NA	NA	NA
AXQ33279.1\|922065_922809_-	copper homeostasis protein CutC	NA	NA	NA	NA
AXQ33280.1\|922887_923448_-	VOC family protein	NA	NA	NA	NA
AXQ33281.1\|923686_925420_+\|tRNA	arginine--tRNA ligase	A0A1V0SIS8	Klosneuvirus	8.8e-87	37.0

DBSCAN-SWA_68

932860 : 938513

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33287.1\|932860_933250_-	two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.3e-06	31.3
AXQ33288.1\|933267_934317_-	chemotaxis response regulator protein-glutamate methylesterase	Q56AR1	Bacillus_thuringiensis_phage	2.3e-05	32.0
AXQ33289.1\|934313_935180_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
AXQ33290.1\|935199_936801_-	methyl-accepting chemotaxis protein IV	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-07	77.3
AXQ33291.1\|936845_938513_-	methyl-accepting chemotaxis protein II	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-11	34.7

DBSCAN-SWA_69

955551 : 957066

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33308.1\|955551_957066_-	L-arabinose ABC transporter ATP-binding protein AraG	A0A285PWH2	Cedratvirus	3.1e-11	28.7

DBSCAN-SWA_70

973373 : 974090

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33326.1\|973373_974090_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-12	28.5

DBSCAN-SWA_71

981708 : 982461

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33336.1\|981708_982461_-	L-cystine ABC transporter ATP-binding protein YecC	G3M9Y6	Bacillus_virus	2.2e-26	35.4

DBSCAN-SWA_72

1010645 : 1014747

Burkholderia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33369.1\|1010645_1011137_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	1.0e-32	47.6
AXQ33370.1\|1011117_1012551_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	1.8e-101	55.7
AXQ33371.1\|1012594_1013296_-	phosphohydrolase	S4W232	Pandoravirus	1.1e-06	28.5
AXQ33372.1\|1013580_1014747_+	porin	Q1MVN1	Enterobacteria_phage	1.4e-115	57.6

DBSCAN-SWA_73

1019153 : 1021934

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33377.1\|1019153_1021934_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	7.3e-67	29.2

DBSCAN-SWA_74

1028299 : 1029601

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33382.1\|1028299_1029601_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.9e-62	36.5

DBSCAN-SWA_75

1045423 : 1053216

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33395.1\|1045423_1048117_-	cation-transporting P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.4e-70	27.3
AXQ33396.1\|1048164_1048596_-	universal stress protein UspG	NA	NA	NA	NA
AXQ36557.1\|1049158_1050154_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AXQ33397.1\|1050153_1053216_+	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	1.9e-23	20.7

DBSCAN-SWA_76

1062259 : 1063426

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33406.1\|1062259_1063426_-	serine-type D-Ala-D-Ala carboxypeptidase DacD	B6DZZ7	Stx2-converting_phage	1.2e-196	86.0

DBSCAN-SWA_77

1068976 : 1069876

Cellulophaga_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33411.1\|1068976_1069876_+	ATP phosphoribosyltransferase	A0A0F7Q4B0	Cellulophaga_phage	4.8e-12	97.4

DBSCAN-SWA_78

1075386 : 1083132

Bodo_saltans_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33418.1\|1075386_1075998_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	2.1e-14	29.3
AXQ33419.1\|1076036_1077017_-	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
AXQ33420.1\|1077209_1078214_+	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	1.1e-33	29.3
AXQ33421.1\|1078262_1079429_-	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	4.1e-112	54.0
AXQ33422.1\|1079668_1080550_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.8e-103	62.0
AXQ33423.1\|1080550_1081636_-	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	3.7e-99	52.6
AXQ33424.1\|1081725_1083132_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	3.1e-37	28.3

DBSCAN-SWA_79

1088748 : 1092900

Enterobacteria_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33431.1\|1088748_1089672_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	1.5e-173	98.4
AXQ33432.1\|1090440_1091334_-	GalU regulator GalF	A0A127AW70	Bacillus_phage	8.1e-44	40.6
AXQ33433.1\|1091508_1092900_-	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	5.7e-20	32.4

DBSCAN-SWA_80

1098428 : 1105140

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33438.1\|1098428_1099799_-	phosphomannomutase CpsG	A0A127AWJ1	Bacillus_phage	3.4e-33	27.2
AXQ33439.1\|1099908_1101345_-	mannose-1-phosphate guanyltransferase	A0A1V0SH58	Hokovirus	1.4e-53	31.6
AXQ33440.1\|1101348_1102572_-	colanic acid biosynthesis glycosyltransferase WcaI	NA	NA	NA	NA
AXQ36560.1\|1102568_1103048_-	GDP-mannose mannosyl hydrolase	NA	NA	NA	NA
AXQ33441.1\|1103050_1104016_-	GDP-L-fucose synthase	D1LW79	Prochlorococcus_phage	1.9e-86	50.6
AXQ33442.1\|1104018_1105140_-	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	2.4e-133	66.3

DBSCAN-SWA_81

1110386 : 1119717

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33449.1\|1110386_1112549_-	tyrosine-protein kinase Wzc	A0A1X9I5D6	Streptococcus_phage	3.2e-17	29.8
AXQ33450.1\|1112551_1112995_-	low molecular weight protein-tyrosine-phosphatase Wzb	NA	NA	NA	NA
AXQ33451.1\|1113001_1114138_-	polysaccharide export protein	NA	NA	NA	NA
AXQ33452.1\|1114831_1116415_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	8.2e-39	44.9
AXQ33453.1\|1116528_1118379_-	outer membrane assembly protein AsmA	NA	NA	NA	NA
AXQ33454.1\|1118402_1118984_-	dCTP deaminase	I4AZP2	Saccharomonospora_phage	1.4e-33	43.2
AXQ33455.1\|1119075_1119717_-	uridine kinase	A0A1V0SAA3	Catovirus	1.7e-35	38.3

DBSCAN-SWA_82

1134740 : 1138831

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33463.1\|1134740_1136144_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	2.5e-31	27.9
AXQ33464.1\|1136140_1136863_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	3.2e-30	32.4
AXQ33465.1\|1137469_1138831_+	U32 family peptidase	Q6DW11	Phage_TP	4.7e-200	91.0

DBSCAN-SWA_83

1150015 : 1151392

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33475.1\|1150015_1151392_+	diaminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-26	26.4

DBSCAN-SWA_84

1159287 : 1167134

Enterobacteria_phage(60.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33482.1\|1159287_1161321_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	1.6e-55	28.2
AXQ33483.1\|1161430_1161901_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	3.4e-65	79.4
AXQ33484.1\|1161947_1162667_-	two-component system response regulator YehT	NA	NA	NA	NA
AXQ33485.1\|1162660_1164346_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	5.3e-270	88.2
AXQ33486.1\|1164564_1165305_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	4.6e-93	82.9
AXQ33487.1\|1165374_1165488_+	protein YohO	NA	NA	NA	NA
AXQ33488.1\|1165462_1166200_-	ABC transporter permease	NA	NA	NA	NA
AXQ33489.1\|1166183_1167134_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	2.6e-08	29.0

DBSCAN-SWA_85

1173697 : 1174252

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33494.1\|1173697_1174252_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	7.3e-19	37.2

DBSCAN-SWA_86

1186404 : 1187925

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33509.1\|1186404_1187925_-	galactose/methyl galactoside ABC transporter ATP-binding protein MglA	F2Y2R6	Organic_Lake_phycodnavirus	2.6e-10	33.0

DBSCAN-SWA_87

1191652 : 1196791

Cellulophaga_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33513.1\|1191652_1192321_-	GTP cyclohydrolase I FolE	M1Q6X8	Cellulophaga_phage	9.0e-56	56.3
AXQ33514.1\|1192423_1193572_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
AXQ33515.1\|1193709_1194537_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AXQ33516.1\|1194805_1196791_+	ligand-gated channel protein	A0A0P0I887	Acinetobacter_phage	2.2e-09	31.9

DBSCAN-SWA_88

1200560 : 1201418

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33520.1\|1200560_1201418_+	deoxyribonuclease IV	A0A1V0SBL9	Catovirus	8.1e-25	32.7

DBSCAN-SWA_89

1209275 : 1213584

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33528.1\|1209275_1210742_+	fructuronate reductase	E5EQS6	Micromonas_sp._RCC1109_virus	2.0e-39	28.6
AXQ33529.1\|1210865_1211852_+	GTP-binding protein	NA	NA	NA	NA
AXQ33530.1\|1211885_1212599_+	phosphatase PAP2 family protein	NA	NA	NA	NA
AXQ33531.1\|1213014_1213584_+	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	1.8e-12	36.8

DBSCAN-SWA_90

1219275 : 1226793

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33536.1\|1219275_1220865_+	microcin C ABC transporter ATP-binding protein YejF	G9BWD6	Planktothrix_phage	2.1e-18	32.1
AXQ33537.1\|1220868_1221213_-	hypothetical protein	NA	NA	NA	NA
AXQ33538.1\|1221489_1222689_-	Bcr/CflA family drug resistance efflux transporter	S4TR35	Salmonella_phage	9.9e-21	23.0
AXQ33539.1\|1222704_1223412_-	16S rRNA pseudouridine(516) synthase RsuA	NA	NA	NA	NA
AXQ33540.1\|1223563_1225324_+	DEAD/DEAH box helicase	M4Q3N1	Vibrio_phage	2.9e-101	42.0
AXQ33541.1\|1225449_1225734_+	50S ribosomal protein L25	NA	NA	NA	NA
AXQ33542.1\|1225785_1226793_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	4.5e-83	48.6

DBSCAN-SWA_91

1232095 : 1240700

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36562.1\|1232095_1233391_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.7e-80	49.3
AXQ33548.1\|1233353_1234790_-	magnesium transporter	NA	NA	NA	NA
AXQ33549.1\|1234930_1236574_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.7e-10	23.2
AXQ33550.1\|1236650_1237301_-	DNA oxidative demethylase AlkB	A0A2K9L3R7	Tupanvirus	3.7e-06	32.7
AXQ33551.1\|1238435_1239491_-	FAD:protein FMN transferase ApbE	NA	NA	NA	NA
AXQ33552.1\|1239605_1240700_-	porin	Q1MVN1	Enterobacteria_phage	5.2e-117	60.1

DBSCAN-SWA_92

1244894 : 1256591

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33555.1\|1244894_1247741_-	two-component system sensor histidine kinase RcsC	A0A1V0SGX0	Hokovirus	8.9e-44	26.4
AXQ33556.1\|1247876_1250513_-	DNA topoisomerase (ATP-hydrolyzing) subunit A	G3M9Z5	Bacillus_virus	9.6e-93	31.0
AXQ33557.1\|1250659_1251388_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AXQ33558.1\|1251736_1254022_+	ribonucleoside-diphosphate reductase subunit alpha	I3UMG3	Colwellia_phage	3.8e-287	64.3
AXQ33559.1\|1254130_1255261_+	ribonucleotide-diphosphate reductase subunit beta	G9IAA3	Pseudomonas_phage	1.0e-176	79.1
AXQ33560.1\|1255260_1255515_+	2Fe-2S ferredoxin-like protein	G9IAA2	Pseudomonas_phage	3.0e-28	67.9
AXQ33561.1\|1255538_1256591_-	glycerophosphodiester phosphodiesterase	A0A220BYK6	Staphylococcus_phage	7.7e-09	50.9

DBSCAN-SWA_93

1278363 : 1279368

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33583.1\|1278363_1279368_+	chemotaxis signal transduction protein CheV	Q56AR1	Bacillus_thuringiensis_phage	7.5e-30	26.5

DBSCAN-SWA_94

1298310 : 1301531

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33599.1\|1298310_1298910_+	5'-deoxynucleotidase	A0A2L0V156	Salmonella_phage	1.5e-06	38.6
AXQ33600.1\|1298963_1300796_-	SLC13 family permease	NA	NA	NA	NA
AXQ33601.1\|1300871_1301531_-	sugar phosphatase	M1IMD4	Acanthocystis_turfacea_Chlorella_virus	1.7e-06	26.6

DBSCAN-SWA_95

1310667 : 1311687

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33611.1\|1310667_1311687_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	5.5e-20	26.8

DBSCAN-SWA_96

1316371 : 1317145

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33619.1\|1316371_1317145_-	histidine ABC transporter ATP-binding protein HisP	M1I0T9	Acanthocystis_turfacea_Chlorella_virus	3.6e-08	28.2

DBSCAN-SWA_97

1321380 : 1322898

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33625.1\|1321380_1322898_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.4e-88	43.8

DBSCAN-SWA_98

1329328 : 1330465

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33633.1\|1329328_1330465_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	3.0e-19	27.3

DBSCAN-SWA_99

1338820 : 1339906

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33642.1\|1338820_1339906_-	chorismate synthase	A0A291AU41	Pandoravirus	1.5e-87	46.6

DBSCAN-SWA_100

1349075 : 1352734

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33651.1\|1349075_1350005_+	hypothetical protein	E7DYY8	Enterobacteria_phage	4.4e-141	83.9
AXQ33652.1\|1350165_1351545_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.1e-15	37.0
AXQ36564.1\|1351813_1352734_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	4.9e-76	54.7

DBSCAN-SWA_101

1356556 : 1357288

Clostridioides_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33655.1\|1356556_1357288_+	DNA-binding response regulator	A0A2R2ZGH8	Clostridioides_phage	2.2e-15	25.5

DBSCAN-SWA_102

1372030 : 1391800

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33668.1\|1372030_1372972_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.1e-06	24.9
AXQ33669.1\|1373061_1374057_+	bile acid:sodium symporter	NA	NA	NA	NA
AXQ33670.1\|1374053_1374269_-	hypothetical protein	NA	NA	NA	NA
AXQ33671.1\|1374270_1376286_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	2.0e-151	43.3
AXQ33672.1\|1376353_1377349_-	cell division protein ZipA	NA	NA	NA	NA
AXQ33673.1\|1377578_1378340_+	sulfate transporter CysZ	NA	NA	NA	NA
AXQ33674.1\|1378503_1379475_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	5.1e-76	51.3
AXQ33675.1\|1379482_1379605_+	transcriptional regulator	NA	NA	NA	NA
AXQ33676.1\|1379535_1379721_-	hypothetical protein	NA	NA	NA	NA
AXQ33677.1\|1379792_1380050_+	phosphocarrier protein HPr	NA	NA	NA	NA
AXQ33678.1\|1380095_1381823_+	phosphoenolpyruvate-protein phosphotransferase PtsI	A0A1V0SGR7	Hokovirus	5.6e-17	31.6
AXQ33679.1\|1381863_1382373_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AXQ33680.1\|1382417_1383254_-	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AXQ33681.1\|1383259_1384171_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.7e-55	42.0
AXQ33682.1\|1384238_1385333_-	sulfate/thiosulfate ABC transporter ATP-binding protein CysA	G9BWD6	Planktothrix_phage	1.6e-30	38.9
AXQ33683.1\|1385322_1386198_-	sulfate/thiosulfate ABC transporter permease CysW	NA	NA	NA	NA
AXQ33684.1\|1386197_1387031_-	sulfate/thiosulfate ABC transporter permease CysT	NA	NA	NA	NA
AXQ33685.1\|1387030_1388044_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ33686.1\|1388219_1389119_-	Dyp-type peroxidase	S4VVJ7	Pandoravirus	1.5e-24	32.4
AXQ33687.1\|1389211_1389787_-	RpoE-regulated lipoprotein	NA	NA	NA	NA
AXQ33688.1\|1389850_1390300_-	DUF2919 domain-containing protein	NA	NA	NA	NA
AXQ33689.1\|1390286_1390712_-	GNAT family acetyltransferase	NA	NA	NA	NA
AXQ33690.1\|1390924_1391800_+	N-acetylmuramoyl-L-alanine amidase AmiA	E5DV68	Deep-sea_thermophilic_phage	1.6e-12	26.9

DBSCAN-SWA_103

1413352 : 1414066

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33706.1\|1413352_1414066_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	9.1e-38	35.2

DBSCAN-SWA_104

1423738 : 1431630

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33717.1\|1423738_1425157_+	leucyl aminopeptidase family protein	Q6GYZ8	Mycoplasma_phage	2.3e-40	33.1
AXQ33718.1\|1425243_1425960_-	DnaA inactivator Hda	NA	NA	NA	NA
AXQ33719.1\|1426041_1427331_-	uracil permease	Q9KX94	Enterobacteria_phage	4.1e-65	36.9
AXQ33720.1\|1427413_1428040_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AXQ33721.1\|1428016_1428202_+	hypothetical protein	NA	NA	NA	NA
AXQ33722.1\|1428257_1429688_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AXQ33723.1\|1429954_1430992_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	7.4e-73	45.1
AXQ33724.1\|1430988_1431630_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	2.0e-28	40.0

DBSCAN-SWA_105

1438056 : 1438245

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33728.1\|1438056_1438245_+	DUF2633 family protein	G9L6F2	Escherichia_phage	1.9e-19	76.7

DBSCAN-SWA_106

1452473 : 1458719

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33741.1\|1452473_1453940_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.0e-88	39.1
AXQ33742.1\|1454099_1455473_+	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	1.3e-40	34.7
AXQ33743.1\|1455531_1456551_+	peptidase M4 family protein	NA	NA	NA	NA
AXQ33744.1\|1456550_1456901_+	hypothetical protein	NA	NA	NA	NA
AXQ33745.1\|1456897_1457119_-	hypothetical protein	NA	NA	NA	NA
AXQ33746.1\|1457177_1458719_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	4.4e-162	57.8

DBSCAN-SWA_107

1467541 : 1472776

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33754.1\|1467541_1467973_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	7.4e-19	39.4
AXQ33755.1\|1468097_1468973_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
AXQ33756.1\|1468972_1469752_-	dimethyl sulfoxide reductase	NA	NA	NA	NA
AXQ33757.1\|1469744_1470374_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	2.3e-61	55.4
AXQ33758.1\|1470370_1472776_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	1.3e-136	38.0

DBSCAN-SWA_108

1485907 : 1492213

Mycoplasma_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33766.1\|1485907_1487194_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	4.9e-34	39.4
AXQ33767.1\|1487254_1487455_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
AXQ33768.1\|1487456_1487792_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AXQ33769.1\|1487793_1489644_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	2.2e-107	43.0
AXQ33770.1\|1489658_1490174_-	co-chaperone HscB	NA	NA	NA	NA
AXQ33771.1\|1490250_1490574_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	4.5e-21	46.7
AXQ33772.1\|1490587_1490974_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	77.3
AXQ33773.1\|1490998_1492213_-	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	1.2e-34	32.6

DBSCAN-SWA_109

1499562 : 1510743

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33782.1\|1499562_1500816_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.0e-100	53.4
AXQ33783.1\|1500802_1501048_-	hypothetical protein	NA	NA	NA	NA
AXQ33784.1\|1501120_1502311_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
AXQ33785.1\|1502387_1502726_-	nitrogen regulatory protein P-II	NA	NA	NA	NA
AXQ33786.1\|1502806_1504144_-	two-component system response regulator GlrR	W8CYM9	Bacillus_phage	2.0e-09	33.0
AXQ33787.1\|1504140_1504893_-	two-component system QseEF-associated lipoprotein QseG	NA	NA	NA	NA
AXQ36569.1\|1504889_1506323_-	two component system sensor histidine kinase QseE/GlrK	W8CYF6	Bacillus_phage	8.8e-16	26.8
AXQ33788.1\|1506855_1510743_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	5.9e-131	59.0

DBSCAN-SWA_110

1516945 : 1534005

uncultured_Mediterranean_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33795.1\|1516945_1517206_+	4Fe-4S dicluster domain-containing protein	A0A1B1IWY9	uncultured_Mediterranean_phage	1.4e-17	51.2
AXQ33796.1\|1517202_1517583_-	holo-ACP synthase	NA	NA	NA	NA
AXQ33797.1\|1517582_1518314_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
AXQ33798.1\|1518389_1519097_-	DNA repair protein RecO	NA	NA	NA	NA
AXQ33799.1\|1519114_1520020_-	GTPase Era	NA	NA	NA	NA
AXQ33800.1\|1520016_1520697_-	ribonuclease III	A0A2P0VNZ5	Tetraselmis_virus	9.6e-21	39.0
AXQ33801.1\|1520920_1521895_-	signal peptidase I	NA	NA	NA	NA
AXQ33802.1\|1521910_1523716_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.1e-23	25.9
AXQ33803.1\|1523901_1524378_-	SoxR-reducing system protein RseC	NA	NA	NA	NA
AXQ33804.1\|1524374_1525328_-	sigma-E factor regulatory protein RseB	NA	NA	NA	NA
AXQ33805.1\|1525327_1525978_-	anti-sigma-E factor RseA	NA	NA	NA	NA
AXQ33806.1\|1526009_1526585_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	8.2e-05	28.1
AXQ33807.1\|1527012_1528632_+	L-aspartate oxidase	NA	NA	NA	NA
AXQ33808.1\|1528616_1529354_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
AXQ33809.1\|1529486_1530815_+	ATP-dependent RNA helicase SrmB	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.7e-48	33.5
AXQ33810.1\|1530867_1531251_-	autonomous glycyl radical cofactor GrcA	A0A193GZ98	Escherichia_phage	2.1e-33	71.8
AXQ33811.1\|1531566_1532256_+	uracil-DNA glycosylase	A0A076JX67	Equid_alphaherpesvirus	7.9e-55	48.8
AXQ33812.1\|1532295_1533381_-\|tRNA	tRNA/rRNA methyltransferase	NA	NA	NA	NA
AXQ33813.1\|1533585_1534005_+	thioredoxin TrxC	A0A0K2FIM3	Achromobacter_phage	1.2e-13	37.2

DBSCAN-SWA_111

1539304 : 1541216

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33818.1\|1539304_1540612_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.7e-43	29.6
AXQ33819.1\|1540763_1541216_-	DUF4385 domain-containing protein	M4QHR1	Cyanophage	3.9e-34	50.0

DBSCAN-SWA_112

1546866 : 1549440

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33820.1\|1546866_1549440_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	2.6e-127	35.5

DBSCAN-SWA_113

1556238 : 1559799

Escherichia_coli_O157_typing_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33828.1\|1556238_1557309_-	3-deoxy-7-phosphoheptulonate synthase AroF	A0A0F6R6T6	Escherichia_coli_O157_typing_phage	4.5e-89	51.5
AXQ33829.1\|1557521_1557896_+	DUF2799 domain-containing protein	NA	NA	NA	NA
AXQ33830.1\|1558049_1558586_+	YfiR family protein	NA	NA	NA	NA
AXQ33831.1\|1558578_1559799_+	diguanylate cyclase	A0A2K8I9Y5	Pseudomonas_phage	1.2e-05	39.8

DBSCAN-SWA_114

1572785 : 1573268

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33848.1\|1572785_1573268_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	6.8e-29	46.8

DBSCAN-SWA_115

1597151 : 1603252

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33869.1\|1597151_1599860_+	PAS domain-containing sensor histidine kinase	A0A1V0SGX0	Hokovirus	1.5e-64	34.4
AXQ33870.1\|1599828_1602027_+	glycoside hydrolase family 2	NA	NA	NA	NA
AXQ33871.1\|1602529_1603252_-	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	2.0e-08	27.1

DBSCAN-SWA_116

1618067 : 1622348

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33875.1\|1618067_1620260_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.6e-32	30.7
AXQ36573.1\|1620279_1621440_+	secretion protein HlyD	NA	NA	NA	NA
AXQ33876.1\|1621756_1621990_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	1.5e-21	65.8
AXQ33877.1\|1622000_1622348_+	addiction module antidote protein, HigA family	A0A222YWD7	Escherichia_phage	2.5e-33	64.2

DBSCAN-SWA_117

1638133 : 1638739

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33891.1\|1638133_1638739_-	ankyrin repeat domain-containing protein	Q6VZ28	Canarypox_virus	1.6e-06	25.2

DBSCAN-SWA_118

1643597 : 1648866

Lactobacillus_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33900.1\|1643597_1643837_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	3.7e-12	41.9
AXQ33901.1\|1643833_1644244_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	3.0e-17	44.3
AXQ33902.1\|1644216_1646361_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.3e-201	48.8
AXQ33903.1\|1646370_1647330_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	2.0e-136	72.4
AXQ33904.1\|1647663_1648866_+	proline/glycine betaine ABC transporter ATP-binding protein ProV	G3M9Y6	Bacillus_virus	2.5e-27	38.3

DBSCAN-SWA_119

1663117 : 1671052

Vibrio_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33916.1\|1663117_1663303_-	carbon storage regulator	A0A2I7RT00	Vibrio_phage	4.9e-12	66.7
AXQ33917.1\|1663544_1666172_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.2
AXQ33918.1\|1666303_1666804_-	recombination regulator RecX	NA	NA	NA	NA
AXQ33919.1\|1666872_1667931_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	1.5e-113	63.1
AXQ33920.1\|1668020_1668518_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	9.1e-29	47.1
AXQ33921.1\|1668648_1669527_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ33922.1\|1669541_1670402_-	metal ABC transporter permease	NA	NA	NA	NA
AXQ33923.1\|1670398_1671052_-	ATP-binding cassette domain-containing protein	A0A2H4UU96	Bodo_saltans_virus	4.0e-08	25.7

DBSCAN-SWA_120

1676615 : 1677581

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33931.1\|1676615_1677581_+	arabinose-5-phosphate isomerase GutQ	A0A2P0VNK5	Tetraselmis_virus	2.0e-35	33.8

DBSCAN-SWA_121

1685908 : 1686922

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33938.1\|1685908_1686922_-	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	9.3e-28	28.0

DBSCAN-SWA_122

1706043 : 1711472

Phaeocystis_globosa_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33958.1\|1706043_1706805_+	ABC transporter ATP-binding protein	R4TX06	Phaeocystis_globosa_virus	3.7e-13	29.8
AXQ33959.1\|1706820_1708041_+	MFS transporter	NA	NA	NA	NA
AXQ33960.1\|1708046_1708418_-	nitrous oxide-stimulated promoter family protein	NA	NA	NA	NA
AXQ33961.1\|1708566_1708797_+	type I toxin-antitoxin system SymE family toxin	NA	NA	NA	NA
AXQ33962.1\|1708910_1711472_+	DNA mismatch repair protein MutS	E3T5Q7	Cafeteria_roenbergensis_virus	3.7e-33	21.1

DBSCAN-SWA_123

1717015 : 1720690

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33970.1\|1717015_1718008_-	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.1e-32	37.6
AXQ33971.1\|1718067_1719192_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	3.8e-06	35.1
AXQ33972.1\|1719308_1719935_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.7e-36	50.0
AXQ33973.1\|1719928_1720690_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.9e-55	47.2

DBSCAN-SWA_124

1723701 : 1725737

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33979.1\|1723701_1724307_-	adenylyl-sulfate kinase	A0A2K9L4R9	Tupanvirus	1.2e-27	38.1
AXQ33980.1\|1724306_1725737_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	2.2e-35	28.0

DBSCAN-SWA_125

1739906 : 1740578

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33991.1\|1739906_1740578_-	7-carboxy-7-deazaguanine synthase QueE	A0A2I7S8X1	Vibrio_phage	1.1e-11	31.4

DBSCAN-SWA_126

1743942 : 1746961

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33994.1\|1743942_1745241_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.4e-129	57.9
AXQ33995.1\|1745323_1746961_-	CTP synthase (glutamine hydrolyzing)	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.7e-154	50.9

DBSCAN-SWA_127

1750326 : 1758409

Erysipelothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ33998.1\|1750326_1751625_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	2.0e-38	28.0
AXQ33999.1\|1751682_1754442_+	two-component sensor histidine kinase BarA	A0A1V0SGX0	Hokovirus	1.3e-55	29.7
AXQ34000.1\|1754492_1755638_-	glycerate kinase	W6LM47	Streptococcus_phage	9.7e-50	41.8
AXQ34001.1\|1755715_1757053_-	glucarate dehydratase	NA	NA	NA	NA
AXQ36577.1\|1757068_1758409_-	glucarate dehydratase	Q6A202	Oenococcus_phage	4.5e-06	24.0

DBSCAN-SWA_128

1762895 : 1763738

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34008.1\|1762895_1763738_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	8.8e-40	36.0

DBSCAN-SWA_129

1768555 : 1769311

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34012.1\|1768555_1769311_+	flap endonuclease Xni	F8WQ40	Bacillus_phage	2.7e-08	28.1

DBSCAN-SWA_130

1772583 : 1788033

environmental_halophage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34017.1\|1772583_1773789_+	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	4.6e-74	38.0
AXQ34018.1\|1773788_1774235_+	cysteine desulfurase sulfur acceptor subunit CsdE	NA	NA	NA	NA
AXQ34019.1\|1774225_1775032_-\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.1e-15	33.7
AXQ34020.1\|1775107_1776205_-	murein transglycosylase A	NA	NA	NA	NA
AXQ34021.1\|1776948_1778202_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.4e-12	28.0
AXQ34022.1\|1778429_1779761_+	amino-acid N-acetyltransferase	NA	NA	NA	NA
AXQ34023.1\|1779794_1781615_-	exodeoxyribonuclease V subunit alpha	A0A2P0VMS9	Tetraselmis_virus	1.2e-22	27.1
AXQ34024.1\|1781611_1785154_-	exodeoxyribonuclease V subunit beta	A7KV33	Bacillus_phage	3.3e-11	21.0
AXQ34025.1\|1785150_1788033_-	pitrilysin	A0A1V0SJA4	Klosneuvirus	1.4e-60	23.9

DBSCAN-SWA_131

1793462 : 1797613

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34031.1\|1793462_1794257_-	thymidylate synthase	R4IFY1	Cronobacter_phage	2.0e-118	62.9
AXQ34032.1\|1794263_1795139_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AXQ34033.1\|1795366_1797613_-	phosphoenolpyruvate-protein phosphotransferase PtsP	A0A1V0SGR7	Hokovirus	5.4e-12	23.9

DBSCAN-SWA_132

1802331 : 1804491

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34039.1\|1802331_1804491_-	bifunctional acyl-ACP--phospholipid O-acyltransferase/long-chain-fatty-acid--ACP ligase	A0A2H4PQU7	Staphylococcus_phage	1.3e-18	26.8

DBSCAN-SWA_133

1810470 : 1811508

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34045.1\|1810470_1811508_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.8e-27	27.0

DBSCAN-SWA_134

1818445 : 1823445

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34054.1\|1818445_1819573_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.8e-11	24.5
AXQ34055.1\|1819586_1820873_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ34056.1\|1820955_1822371_-	sugar porter family MFS transporter	O13311	Aichi_virus	3.2e-26	26.5
AXQ34057.1\|1822683_1823445_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	Q06VL0	Trichoplusia_ni_ascovirus	3.5e-19	32.1

DBSCAN-SWA_135

1841495 : 1842380

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34079.1\|1841495_1842380_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	4.5e-79	56.3

DBSCAN-SWA_136

1851107 : 1858696

Microcystis_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34087.1\|1851107_1851848_-	LysM peptidoglycan-binding domain-containing protein	A0A7K9	Microcystis_virus	2.2e-10	35.7
AXQ34088.1\|1852011_1852554_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
AXQ34089.1\|1852602_1854120_-\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	7.7e-87	37.5
AXQ34090.1\|1854129_1855228_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.1e-05	39.0
AXQ34091.1\|1855318_1857052_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	7.1e-60	28.5
AXQ34092.1\|1857057_1857771_-	bifunctional protein-disulfide isomerase/oxidoreductase DsbC	NA	NA	NA	NA
AXQ34093.1\|1857799_1858696_-	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.5e-29	29.3

DBSCAN-SWA_137

1863112 : 1864546

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34100.1\|1863112_1864546_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	5.7e-31	26.2

DBSCAN-SWA_138

1868998 : 1871872

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34106.1\|1868998_1871872_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	5.3e-262	51.1

DBSCAN-SWA_139

1879661 : 1880894

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34114.1\|1879661_1880894_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.4e-102	47.9

DBSCAN-SWA_140

1896268 : 1897817

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34128.1\|1896268_1897063_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.7e-06	25.7
AXQ34129.1\|1897046_1897817_-	alpha/beta hydrolase	A0A249XTU1	Mycobacterium_phage	9.6e-09	36.6

DBSCAN-SWA_141

1910587 : 1911742

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34141.1\|1910587_1911742_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	3.1e-128	63.2

DBSCAN-SWA_142

1942035 : 1943820

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34174.1\|1942035_1943820_-	hybrid sensor histidine kinase/response regulator	A0A2K9L0Z8	Tupanvirus	1.8e-13	23.3

DBSCAN-SWA_143

1953767 : 1960871

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34180.1\|1953767_1955099_+	poly-beta-1,6 N-acetyl-D-glucosamine synthase	B9UDL7	Salmonella_phage	8.5e-05	34.8
AXQ34181.1\|1955095_1955530_+	poly-beta-1,6-N-acetyl-D-glucosamine biosynthesis protein PgaD	NA	NA	NA	NA
AXQ34182.1\|1955582_1957445_-	bifunctional glutathionylspermidine amidase/synthase	Q56ES0	Aeromonas_virus	5.9e-20	23.8
AXQ34183.1\|1957628_1958495_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
AXQ34184.1\|1958571_1959321_+	L-fucose operon activator	NA	NA	NA	NA
AXQ34185.1\|1959323_1960871_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-10	41.9

DBSCAN-SWA_144

1969982 : 1978354

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34197.1\|1969982_1970810_+	2,5-didehydrogluconate reductase DkgA	A0A2H4PQR8	Staphylococcus_phage	1.5e-63	44.9
AXQ34198.1\|1970896_1973071_-	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	3.1e-105	71.7
AXQ34199.1\|1973201_1974614_-	cell division protein FtsP	NA	NA	NA	NA
AXQ34200.1\|1974675_1975413_-	1-acylglycerol-3-phosphate O-acyltransferase	NA	NA	NA	NA
AXQ34201.1\|1975575_1977834_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	2.2e-85	35.1
AXQ34202.1\|1977952_1978354_-	YgiW/YdeI family stress tolerance OB fold protein	A0A1I9LJU6	Stx_converting_phage	1.6e-20	44.4

DBSCAN-SWA_145

1988133 : 1996243

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34213.1\|1988133_1990026_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	3.8e-91	34.8
AXQ34214.1\|1990054_1990636_-	esterase YqiA	NA	NA	NA	NA
AXQ34215.1\|1990635_1991463_-	3',5'-cyclic-AMP phosphodiesterase	NA	NA	NA	NA
AXQ34216.1\|1991490_1991913_-	DUF1249 family protein	NA	NA	NA	NA
AXQ34217.1\|1991909_1992542_-	ADP-ribose diphosphatase	A0A1S6L1P8	Vibrio_phage	1.5e-20	36.2
AXQ34218.1\|1992745_1994224_+	outer membrane channel protein TolC	NA	NA	NA	NA
AXQ34219.1\|1994414_1995080_+	DUF1190 family protein	A0A173GEW8	Erwinia_phage	1.5e-39	47.5
AXQ34220.1\|1995082_1996243_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	7.7e-87	43.4

DBSCAN-SWA_146

2003227 : 2006062

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34227.1\|2003227_2003881_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.4e-45	45.5
AXQ34228.1\|2004257_2004554_+	hypothetical protein	NA	NA	NA	NA
AXQ34229.1\|2004631_2006062_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A1B1IUK5	uncultured_Mediterranean_phage	1.5e-39	29.0

DBSCAN-SWA_147

2011199 : 2012441

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34233.1\|2011199_2012441_+	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	6.1e-90	50.1

DBSCAN-SWA_148

2024752 : 2033291

Moraxella_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34247.1\|2024752_2025766_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.3e-109	58.9
AXQ34248.1\|2026002_2026218_+	30S ribosomal protein S21	NA	NA	NA	NA
AXQ34249.1\|2026333_2028079_+	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.4e-76	39.0
AXQ34250.1\|2028231_2030076_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	8.4e-35	33.7
AXQ34251.1\|2030176_2030683_-	G/U mismatch-specific DNA glycosylase	NA	NA	NA	NA
AXQ34252.1\|2031179_2031824_-	hypothetical protein	NA	NA	NA	NA
AXQ34253.1\|2032991_2033291_+	hypothetical protein	A5X9F3	Aeromonas_virus	2.0e-10	68.2

DBSCAN-SWA_149

2039381 : 2044503

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34260.1\|2039381_2040941_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-08	31.9
AXQ34261.1\|2041180_2042701_-	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	2.5e-32	36.7
AXQ34262.1\|2043096_2044503_+	putrescine aminotransferase	A0A1V0SKB7	Klosneuvirus	3.9e-32	27.4

DBSCAN-SWA_150

2050215 : 2051703

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34270.1\|2050215_2051703_-	autoinducer 2 ABC transporter ATP-binding protein LsrA	W5SAS9	Pithovirus	2.4e-08	29.6

DBSCAN-SWA_151

2059746 : 2060712

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34277.1\|2059746_2060712_+	TerC family protein	A0A291LBC5	Escherichia_phage	5.2e-36	33.4

DBSCAN-SWA_152

2077899 : 2080194

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34297.1\|2077899_2080194_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.2e-157	41.4

DBSCAN-SWA_153

2085878 : 2087024

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34301.1\|2085878_2087024_-	glycerate 2-kinase	W6LM47	Streptococcus_phage	4.1e-48	39.0

DBSCAN-SWA_154

2104448 : 2112240

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34317.1\|2104448_2105312_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.3e-50	44.2
AXQ34318.1\|2105373_2107512_+	penicillin-binding protein activator	NA	NA	NA	NA
AXQ34319.1\|2107469_2107865_+	YraN family protein	NA	NA	NA	NA
AXQ34320.1\|2107886_2108477_+	DnaA initiator-associating protein DiaA	A0A067XQR2	Caulobacter_phage	4.1e-12	31.8
AXQ34321.1\|2108486_2109062_+	osmotically-inducible protein OsmY	NA	NA	NA	NA
AXQ34322.1\|2109112_2110150_-	permease	NA	NA	NA	NA
AXQ34323.1\|2110190_2110835_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
AXQ34324.1\|2110963_2111482_+	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.8e-11	29.3
AXQ34325.1\|2111461_2111896_-	hypothetical protein	NA	NA	NA	NA
AXQ34326.1\|2111910_2112240_+	GIY-YIG nuclease family protein	S6DF82	Invertebrate_iridovirus	8.8e-12	46.8

DBSCAN-SWA_155

2117924 : 2119820

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34333.1\|2117924_2119820_-	DEAD/DEAH family ATP-dependent RNA helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	5.4e-53	31.5

DBSCAN-SWA_156

2125261 : 2136925

Cafeteria_roenbergensis_virus(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34340.1\|2125261_2127949_-	translation initiation factor IF-2	E3T4N3	Cafeteria_roenbergensis_virus	1.9e-27	27.0
AXQ34341.1\|2127973_2129476_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AXQ34342.1\|2129504_2129969_-	ribosome maturation factor RimP	NA	NA	NA	NA
AXQ34343.1\|2130527_2131874_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	3.7e-64	94.4
AXQ34344.1\|2132158_2132491_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AXQ34345.1\|2132713_2134051_-	phosphoglucosamine mutase	NA	NA	NA	NA
AXQ34346.1\|2134043_2134892_-	dihydropteroate synthase	S4W084	Pandoravirus	9.8e-23	29.0
AXQ34347.1\|2134990_2136925_-\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	2.0e-116	43.5

DBSCAN-SWA_157

2140367 : 2142070

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34352.1\|2140367_2141030_+	two-component system response regulator PmrA	W8CYM9	Bacillus_phage	9.0e-32	38.1
AXQ34353.1\|2141026_2142070_+	two-component system sensor histidine kinase PmrB	W8CYF6	Bacillus_phage	4.3e-12	23.3

DBSCAN-SWA_158

2145201 : 2146689

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34358.1\|2145201_2146173_+	octaprenyl diphosphate synthase	A0A1V0SE37	Indivirus	3.5e-08	26.2
AXQ34359.1\|2146401_2146689_+	DNA-binding transcriptional regulator SfsB	A0A2I7S995	Vibrio_phage	1.0e-16	69.8

DBSCAN-SWA_159

2150733 : 2266112

107

uncultured_Caudovirales_phage(32.26%)

tail,protease,head,integrase,capsid,tRNA,terminase,portal

attL 2228951:2228998|attR 2245823:2245870

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34365.1\|2150733_2151546_-	phospholipid ABC transporter ATP-binding protein MlaF	G3M9Y6	Bacillus_virus	2.4e-18	29.8
AXQ34366.1\|2151631_2151832_+	hypothetical protein	NA	NA	NA	NA
AXQ34367.1\|2151773_2152751_+	calcium/sodium antiporter	NA	NA	NA	NA
AXQ34368.1\|2152764_2153751_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	1.1e-38	31.7
AXQ34369.1\|2153765_2154332_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	8.5e-55	75.6
AXQ34370.1\|2154328_2154904_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AXQ34371.1\|2154872_2155427_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
AXQ34372.1\|2155433_2156159_+	lipopolysaccharide ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.1e-22	27.4
AXQ34373.1\|2156206_2157640_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
AXQ34374.1\|2157662_2157950_+	ribosome hibernation promoting factor	NA	NA	NA	NA
AXQ34375.1\|2158032_2158524_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
AXQ34376.1\|2158569_2159424_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4
AXQ34377.1\|2159420_2159693_+	HPr family phosphocarrier protein	NA	NA	NA	NA
AXQ34378.1\|2159732_2160458_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AXQ34379.1\|2160454_2161108_-	isoprenoid biosynthesis protein ElbB	NA	NA	NA	NA
AXQ34380.1\|2161340_2163674_-	aerobic respiration two-component sensor histidine kinase ArcB	A0A1V0SGX0	Hokovirus	8.4e-40	30.7
AXQ34381.1\|2163811_2164894_-	LPS export ABC transporter permease LptG	NA	NA	NA	NA
AXQ34382.1\|2164893_2165994_-	LPS export ABC transporter permease LptF	NA	NA	NA	NA
AXQ34383.1\|2166259_2167771_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.2e-47	36.2
AXQ34384.1\|2167839_2168283_+	DNA polymerase III subunit chi	NA	NA	NA	NA
AXQ34385.1\|2168282_2171138_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.6e-141	36.9
AXQ34386.1\|2171261_2171765_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXQ34387.1\|2171848_2172868_+	NAD(P)-dependent alcohol dehydrogenase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	5.4e-44	30.7
AXQ34388.1\|2173015_2174662_-	DAK2 domain-containing protein	NA	NA	NA	NA
AXQ34389.1\|2174799_2176302_+	ATP-binding protein	A0A248XCZ8	Klebsiella_phage	5.7e-82	43.6
AXQ36587.1\|2176281_2177223_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	6.8e-17	34.4
AXQ34390.1\|2177910_2182371_+	glutamate synthase large subunit	NA	NA	NA	NA
AXQ34391.1\|2182380_2183799_+	glutamate synthase small subunit	NA	NA	NA	NA
AXQ34392.1\|2183855_2184527_-	DUF1120 domain-containing protein	NA	NA	NA	NA
AXQ34393.1\|2184725_2185391_-	DUF1120 domain-containing protein	NA	NA	NA	NA
AXQ34394.1\|2185559_2186132_-	hypothetical protein	NA	NA	NA	NA
AXQ34395.1\|2186122_2188540_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AXQ34396.1\|2188554_2189259_-	fimbrial chaperone protein	NA	NA	NA	NA
AXQ34397.1\|2189387_2190065_-	DUF1120 domain-containing protein	NA	NA	NA	NA
AXQ36588.1\|2190435_2190933_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	2.9e-27	54.6
AXQ34398.1\|2190938_2191577_-	stringent starvation protein A	NA	NA	NA	NA
AXQ34399.1\|2191575_2191758_+	hypothetical protein	NA	NA	NA	NA
AXQ34400.1\|2191884_2192277_-	30S ribosomal protein S9	NA	NA	NA	NA
AXQ34401.1\|2192292_2192721_-	50S ribosomal protein L13	NA	NA	NA	NA
AXQ34402.1\|2193013_2194138_-	cell division protein ZapE	NA	NA	NA	NA
AXQ34403.1\|2194327_2194726_+	DUF1043 family protein	NA	NA	NA	NA
AXQ34404.1\|2194896_2196264_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-21	26.4
AXQ34405.1\|2196356_2197424_+\|protease	serine endoprotease DegS	NA	NA	NA	NA
AXQ34406.1\|2197475_2198414_-	malate dehydrogenase	NA	NA	NA	NA
AXQ34407.1\|2198811_2199282_+	transcriptional regulator ArgR	NA	NA	NA	NA
AXQ34408.1\|2199660_2199924_+	DUF1471 domain-containing protein	NA	NA	NA	NA
AXQ34409.1\|2199983_2200256_-	hypothetical protein	NA	NA	NA	NA
AXQ34410.1\|2200301_2201756_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AXQ34411.1\|2201842_2203810_-	p-hydroxybenzoic acid efflux pump subunit AaeB	NA	NA	NA	NA
AXQ34412.1\|2203815_2204748_-	p-hydroxybenzoic acid efflux pump subunit AaeA	NA	NA	NA	NA
AXQ34413.1\|2204755_2204959_-	DUF1656 domain-containing protein	NA	NA	NA	NA
AXQ34414.1\|2205138_2206065_+	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
AXQ34415.1\|2206114_2207560_-\|protease	metalloprotease TldD	NA	NA	NA	NA
AXQ34416.1\|2207643_2211450_-	AsmA2 domain-containing protein	NA	NA	NA	NA
AXQ34417.1\|2211492_2212962_-	ribonuclease G	NA	NA	NA	NA
AXQ34418.1\|2212951_2213545_-	septum formation inhibitor Maf	NA	NA	NA	NA
AXQ34419.1\|2213554_2214043_-	rod shape-determining protein MreD	NA	NA	NA	NA
AXQ34420.1\|2214042_2215059_-	rod shape-determining protein MreC	NA	NA	NA	NA
AXQ34421.1\|2215121_2216165_-	rod shape-determining protein	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3
AXQ34422.1\|2216447_2218388_-	RNase E specificity factor CsrD	NA	NA	NA	NA
AXQ34423.1\|2218570_2219545_+	oxidoreductase	NA	NA	NA	NA
AXQ34424.1\|2219622_2220624_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
AXQ34425.1\|2220624_2221224_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
AXQ34426.1\|2221458_2221911_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
AXQ34427.1\|2221932_2222397_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AXQ34428.1\|2222407_2223757_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AXQ34429.1\|2223865_2224108_+	DUF997 family protein	NA	NA	NA	NA
AXQ34430.1\|2224097_2225549_+	sodium/pantothenate symporter	NA	NA	NA	NA
AXQ34431.1\|2225560_2226442_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AXQ34432.1\|2226579_2227320_+	carbonic anhydrase family protein	NA	NA	NA	NA
AXQ34433.1\|2227649_2228615_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AXQ34434.1\|2228638_2228935_+	Fis family transcriptional regulator	NA	NA	NA	NA
2228951:2228998	attL	NA	NA	NA	NA
AXQ34435.1\|2229286_2229880_-\|tail	tail assembly protein	F1C572	Cronobacter_phage	5.9e-51	51.8
AXQ34436.1\|2229912_2231574_-\|terminase	terminase large subunit	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	97.8
AXQ34437.1\|2231557_2231914_-\|terminase	phage terminase small subunit P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	4.6e-59	95.8
AXQ34438.1\|2232187_2232631_-	HNH endonuclease	A0A2H4JAS8	uncultured_Caudovirales_phage	1.1e-49	63.3
AXQ34439.1\|2232630_2232924_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JD08	uncultured_Caudovirales_phage	2.7e-44	85.6
AXQ34440.1\|2232920_2233259_-\|head,tail	head-tail adaptor protein	A0A2H4JHK5	uncultured_Caudovirales_phage	1.8e-52	90.2
AXQ36589.1\|2233255_2234482_-\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	1.5e-234	97.1
AXQ34441.1\|2234492_2235053_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	3.5e-101	98.9
AXQ34442.1\|2235104_2236271_-\|capsid	phage major capsid protein	A0A2H4JED2	uncultured_Caudovirales_phage	4.4e-215	99.5
AXQ34443.1\|2236513_2236996_-	hypothetical protein	NA	NA	NA	NA
AXQ34444.1\|2236997_2238059_-	hypothetical protein	U5P4L0	Shigella_phage	6.6e-69	40.1
AXQ34445.1\|2238199_2238460_-	hypothetical protein	NA	NA	NA	NA
AXQ34446.1\|2238735_2240505_-	DNA primase	Q7M2A8	Enterobacteria_phage	6.2e-128	51.6
AXQ34447.1\|2240488_2240680_-	DUF4222 domain-containing protein	NA	NA	NA	NA
AXQ34448.1\|2240666_2240882_-	hypothetical protein	NA	NA	NA	NA
AXQ34449.1\|2240878_2241073_-	hypothetical protein	NA	NA	NA	NA
AXQ36590.1\|2241051_2241900_-	host cell division inhibitor Icd-like protein	A0A2H4JGN8	uncultured_Caudovirales_phage	4.9e-06	42.0
AXQ34450.1\|2242846_2243131_-	AlpA family phage regulatory protein	NA	NA	NA	NA
AXQ34451.1\|2243751_2244402_-	hypothetical protein	NA	NA	NA	NA
AXQ34452.1\|2244401_2245622_-\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	1.6e-154	63.0
AXQ34453.1\|2245985_2246150_+	DUF2556 domain-containing protein	NA	NA	NA	NA
2245823:2245870	attR	NA	NA	NA	NA
AXQ34454.1\|2246290_2248375_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	7.0e-22	34.8
AXQ34455.1\|2248369_2249017_-	acrEF/envCD operon transcriptional regulator	NA	NA	NA	NA
AXQ34456.1\|2249415_2250555_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AXQ34457.1\|2250566_2253680_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AXQ34458.1\|2253928_2254150_+	hypothetical protein	NA	NA	NA	NA
AXQ34459.1\|2260189_2260744_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
AXQ34460.1\|2260719_2260968_-	DUF1488 domain-containing protein	NA	NA	NA	NA
AXQ34461.1\|2260964_2261783_-	shikimate dehydrogenase	NA	NA	NA	NA
AXQ34462.1\|2261787_2262360_-	L-threonylcarbamoyladenylate synthase type 1 TsaC	S4VW33	Pandoravirus	1.9e-09	25.7
AXQ34463.1\|2262352_2262907_-	hypothetical protein	NA	NA	NA	NA
AXQ34464.1\|2262933_2263407_-	DUF494 domain-containing protein	NA	NA	NA	NA
AXQ34465.1\|2263378_2264503_-	DNA-protecting protein DprA	NA	NA	NA	NA
AXQ34466.1\|2264630_2265140_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.3e-18	40.3
AXQ34467.1\|2265164_2266112_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.1e-06	30.5

DBSCAN-SWA_160

2285998 : 2289367

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34504.1\|2285998_2287183_-	elongation factor Tu	A0A2K9L516	Tupanvirus	4.4e-13	26.1
AXQ34505.1\|2287252_2289367_-	elongation factor G	E4ZFJ7	Streptococcus_phage	1.8e-57	27.5

DBSCAN-SWA_161

2297174 : 2302542

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34518.1\|2297174_2299079_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	5.9e-76	33.5
AXQ34519.1\|2299094_2300027_+	LysR family transcriptional regulator	NA	NA	NA	NA
AXQ34520.1\|2300066_2300963_-	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
AXQ34521.1\|2300962_2301580_-	malonate decarboxylase holo-ACP synthase	NA	NA	NA	NA
AXQ34522.1\|2301582_2302542_-	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	6.4e-55	92.7

DBSCAN-SWA_162

2308360 : 2314906

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34529.1\|2308360_2308579_+	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	1.1e-05	39.1
AXQ34530.1\|2308609_2309479_+	phosphoribulokinase	NA	NA	NA	NA
AXQ34531.1\|2309545_2309950_-	OsmC family protein	NA	NA	NA	NA
AXQ36592.1\|2309876_2310098_+	hypothetical protein	NA	NA	NA	NA
AXQ34532.1\|2310260_2310893_+	cAMP-activated global transcriptional regulator CRP	NA	NA	NA	NA
AXQ34533.1\|2310950_2313038_+	hypothetical protein	H9YQA8	environmental_Halophage	2.0e-64	84.8
AXQ34534.1\|2313034_2314270_-	aspartate aminotransferase family protein	NA	NA	NA	NA
AXQ34535.1\|2314342_2314906_-	aminodeoxychorismate synthase component 2	A0A0P0IKJ1	Acinetobacter_phage	5.1e-60	56.5

DBSCAN-SWA_163

2325151 : 2325964

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34547.1\|2325151_2325964_-	adenine-specific DNA-methyltransferase	A0A1S6L1V5	Vibrio_phage	2.7e-70	50.2

DBSCAN-SWA_164

2342746 : 2346526

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34564.1\|2342746_2344366_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	5.5e-139	51.7
AXQ34565.1\|2344463_2345810_-	two-component system sensor histidine kinase EnvZ	W8CYF6	Bacillus_phage	2.5e-12	24.1
AXQ34566.1\|2345806_2346526_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.5e-29	34.7

DBSCAN-SWA_165

2352763 : 2353546

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34571.1\|2352763_2353546_-	pimeloyl-ACP methyl ester esterase BioH	A0A0M3UKI8	Mycobacterium_phage	3.1e-07	32.0

DBSCAN-SWA_166

2358698 : 2361092

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34576.1\|2358698_2361092_-	maltodextrin phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.8e-13	41.4

DBSCAN-SWA_167

2364432 : 2365191

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34578.1\|2364432_2365191_-	DeoR/GlpR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.8e-21	30.3

DBSCAN-SWA_168

2368270 : 2370718

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34582.1\|2368270_2370718_-	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	1.2e-33	83.3

DBSCAN-SWA_169

2387838 : 2389646

Enterococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34596.1\|2387838_2388579_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	9.2e-09	24.1
AXQ34597.1\|2388575_2389646_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	5.2e-21	32.5

DBSCAN-SWA_170

2393018 : 2394498

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34601.1\|2393018_2393732_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF	G9BWD6	Planktothrix_phage	1.1e-14	31.2
AXQ34602.1\|2393733_2394498_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.8e-13	26.0

DBSCAN-SWA_171

2400074 : 2404298

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34608.1\|2400074_2401340_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.7e-26	27.8
AXQ34609.1\|2401476_2402334_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	9.2e-45	42.3
AXQ34610.1\|2402584_2403640_-	cell division protein FtsX	NA	NA	NA	NA
AXQ34611.1\|2403626_2404298_-	cell division ATP-binding protein FtsE	A0A2H4PQG7	Staphylococcus_phage	3.9e-14	26.6

DBSCAN-SWA_172

2407302 : 2410177

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34616.1\|2407302_2407929_+	lysoplasmalogenase	A0A140XAH6	Dickeya_phage	2.9e-32	63.7
AXQ34617.1\|2408005_2410177_+	zinc/cadmium/mercury/lead-transporting ATPase	E4ZFI9	Streptococcus_phage	4.5e-120	37.3

DBSCAN-SWA_173

2413291 : 2414369

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34621.1\|2413291_2413534_-	sulfurtransferase TusA	A0A140XB86	Dickeya_phage	6.0e-10	80.6
AXQ34622.1\|2413703_2414369_+	7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter	A0A2I7SAW6	Vibrio_phage	3.3e-58	55.3

DBSCAN-SWA_174

2433559 : 2434585

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34646.1\|2433559_2434585_-	TerC/Alx family metal homeostasis membrane protein	K7QKE8	Escherichia_phage	2.1e-75	47.7

DBSCAN-SWA_175

2439565 : 2441608

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34652.1\|2439565_2441608_-	oligopeptidase A	A0A1V0SD92	Indivirus	4.0e-46	22.9

DBSCAN-SWA_176

2487857 : 2488472

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34682.1\|2487857_2488472_-	IMPACT family protein	A0A1X9I5T8	Streptococcus_phage	6.2e-19	34.0

DBSCAN-SWA_177

2497199 : 2498195

Escherichia_coli_O157_typing_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34689.1\|2497199_2498195_+	acyltransferase	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	1.4e-12	24.3

DBSCAN-SWA_178

2502520 : 2504062

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34691.1\|2502520_2504062_+	xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.8e-15	29.3

DBSCAN-SWA_179

2527323 : 2529162

Tupanvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34712.1\|2527323_2529162_-\|tRNA	selenocysteinyl-tRNA-specific translation elongation factor SelB	A0A2K9KZ60	Tupanvirus	6.9e-13	25.1

DBSCAN-SWA_180

2554862 : 2556509

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34734.1\|2554862_2556509_-	acetolactate synthase 2 catalytic subunit	A0A0P0CRC5	Ostreococcus_lucimarinus_virus	1.2e-64	31.8

DBSCAN-SWA_181

2566587 : 2568438

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34740.1\|2566587_2568438_-	TonB-dependent vitamin B12 receptor BtuB	A0A0P0I887	Acinetobacter_phage	1.0e-11	28.4

DBSCAN-SWA_182

2596741 : 2601205

Erwinia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34764.1\|2596741_2598073_+	HslU--HslV peptidase ATPase subunit	A0A173GE36	Erwinia_phage	1.9e-44	29.7
AXQ34765.1\|2598141_2599062_+	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
AXQ34766.1\|2599154_2599640_+	ribonuclease E activity regulator RraA	NA	NA	NA	NA
AXQ34767.1\|2599720_2599960_-	septal ring assembly protein ZapB	NA	NA	NA	NA
AXQ34768.1\|2600359_2601205_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	7.5e-15	28.7

DBSCAN-SWA_183

2613062 : 2616545

Feldmannia_irregularis_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34780.1\|2613062_2613761_+	DNA-binding transcriptional regulator CpxR	Q6XM27	Feldmannia_irregularis_virus	2.4e-06	30.3
AXQ34781.1\|2613757_2615131_+	two-component system sensor histidine kinase CpxA	W8CYF6	Bacillus_phage	7.2e-15	25.6
AXQ34782.1\|2615183_2615858_-	6-N-hydroxylaminopurine resistance protein	NA	NA	NA	NA
AXQ34783.1\|2615924_2616545_-	superoxide dismutase [Mn]	Q56AR7	Bacillus_thuringiensis_phage	2.2e-64	59.8

DBSCAN-SWA_184

2624725 : 2626228

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34792.1\|2624725_2626228_+	sugar ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-11	25.7

DBSCAN-SWA_185

2647332 : 2650110

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34815.1\|2647332_2648133_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	7.1e-23	30.5
AXQ34816.1\|2648167_2649064_-	sugar kinase	NA	NA	NA	NA
AXQ34817.1\|2649219_2650110_+	sulfolactaldehyde 3-reductase	D2K0C8	Staphylococcus_phage	1.6e-63	94.6

DBSCAN-SWA_186

2661814 : 2664288

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34826.1\|2661814_2662864_+	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	3.4e-09	26.1
AXQ34827.1\|2662875_2664288_+	nitrogen regulation protein NR(I)	Q56AR1	Bacillus_thuringiensis_phage	1.1e-05	27.9

DBSCAN-SWA_187

2668159 : 2670952

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34832.1\|2668159_2670952_-	DNA polymerase I	A0A1B1IWN2	uncultured_Mediterranean_phage	1.4e-54	27.7

DBSCAN-SWA_188

2683084 : 2691033

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34840.1\|2683084_2684077_-	transcriptional regulator RbsR	C6ZCU4	Enterobacteria_phage	1.1e-36	33.7
AXQ34841.1\|2684080_2685010_-	ribokinase	NA	NA	NA	NA
AXQ34842.1\|2685118_2686009_-	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	3.3e-05	23.7
AXQ34843.1\|2686036_2687002_-	ribose ABC transporter permease	NA	NA	NA	NA
AXQ34844.1\|2687006_2688512_-	ribose ABC transporter ATP-binding protein RbsA	A0A2K9L0W2	Tupanvirus	7.6e-18	21.7
AXQ34845.1\|2688519_2688939_-	D-ribose pyranase	NA	NA	NA	NA
AXQ34846.1\|2689164_2691033_-	low affinity potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	2.3e-64	29.7

DBSCAN-SWA_189

2694197 : 2695190

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34849.1\|2694197_2695190_-	aspartate--ammonia ligase	A0A1C9C5F0	Heterosigma_akashiwo_virus	3.5e-48	37.0

DBSCAN-SWA_190

2706973 : 2710414

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34863.1\|2706973_2708344_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7P8	Chrysochromulina_ericina_virus	2.9e-32	33.2
AXQ34864.1\|2708584_2710414_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.2e-131	42.9

DBSCAN-SWA_191

2716046 : 2722900

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34869.1\|2716046_2717087_+	phosphate ABC transporter substrate-binding protein PstS	E3SKK5	Synechococcus_phage	1.3e-48	38.7
AXQ34870.1\|2717214_2718174_+	phosphate ABC transporter permease PstC	NA	NA	NA	NA
AXQ34871.1\|2718173_2719064_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
AXQ34872.1\|2719111_2719885_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	3.4e-14	30.6
AXQ34873.1\|2719911_2720637_+	phosphate transport system regulator PhoU	NA	NA	NA	NA
AXQ34874.1\|2720731_2721397_-	6-phosphogluconate phosphatase	NA	NA	NA	NA
AXQ34875.1\|2721559_2722900_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.6e-65	37.6

DBSCAN-SWA_192

2729768 : 2737156

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34882.1\|2729768_2730026_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	5.4e-17	56.7
AXQ34883.1\|2729989_2730349_-	ribonuclease P protein component	NA	NA	NA	NA
AXQ34884.1\|2730365_2730506_-	50S ribosomal protein L34	NA	NA	NA	NA
AXQ34885.1\|2730617_2730818_+	hypothetical protein	NA	NA	NA	NA
AXQ34886.1\|2731143_2732538_+	chromosomal replication initiator protein DnaA	NA	NA	NA	NA
AXQ34887.1\|2732542_2733643_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.5e-52	35.0
AXQ34888.1\|2733642_2734716_+	DNA replication/repair protein RecF	NA	NA	NA	NA
AXQ34889.1\|2734744_2737156_+	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	9.0e-114	34.1

DBSCAN-SWA_193

2742577 : 2743726

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34895.1\|2742577_2743726_+	galactonate dehydratase	Q6A202	Oenococcus_phage	9.4e-53	33.1

DBSCAN-SWA_194

2747169 : 2748145

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34899.1\|2747169_2747580_+	heat shock chaperone IbpA	A0A218MKI2	uncultured_virus	5.4e-19	39.2
AXQ34900.1\|2747716_2748145_+	heat shock chaperone IbpB	A0A1D8KPX5	Synechococcus_phage	1.1e-14	37.3

DBSCAN-SWA_195

2759531 : 2760716

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36603.1\|2759531_2760716_-	multidrug transporter EmrD	S4TR35	Salmonella_phage	1.6e-15	25.6

DBSCAN-SWA_196

2764933 : 2766622

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34916.1\|2764933_2766622_+	acetolactate synthase large subunit	E5EQ70	Micromonas_sp._RCC1109_virus	2.6e-59	31.5

DBSCAN-SWA_197

2772079 : 2773084

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34922.1\|2772079_2773084_+	alpha/beta hydrolase	A0A2K9KZN8	Tupanvirus	3.4e-06	28.4

DBSCAN-SWA_198

2784051 : 2785209

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34935.1\|2784051_2785209_-	MFS transporter	S4TR35	Salmonella_phage	1.6e-28	26.6

DBSCAN-SWA_199

2811599 : 2813696

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34960.1\|2811599_2813696_+	peptidase domain-containing ABC transporter	F2Y1V5	Organic_Lake_phycodnavirus	6.6e-12	23.9

DBSCAN-SWA_200

2818989 : 2823165

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34967.1\|2818989_2820078_-	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	3.9e-125	62.2
AXQ34968.1\|2820225_2821185_-	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
AXQ34969.1\|2821287_2821698_-	hydroxyisourate hydrolase	NA	NA	NA	NA
AXQ34970.1\|2821797_2822523_-	helix-turn-helix-type transcriptional regulator	Q9EYF2	Enterobacteria_phage	4.0e-41	42.7
AXQ34971.1\|2822640_2823165_+	hypothetical protein	A0A1W6JNX6	Morganella_phage	9.9e-50	58.9

DBSCAN-SWA_201

2832923 : 2833961

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34982.1\|2832923_2833961_-	hydroxyacid dehydrogenase	Q9JMN3	Wolbachia_phage	8.5e-69	43.0

DBSCAN-SWA_202

2844695 : 2846087

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34990.1\|2844695_2846087_-	xanthine permease XanP	H9YQ34	environmental_Halophage	3.9e-69	96.5

DBSCAN-SWA_203

2850297 : 2855306

Bordetella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ34994.1\|2850297_2852412_-	bifunctional GTP diphosphokinase/guanosine-3',5'-bis(diphosphate) 3'-diphosphatase	A0A291L9W9	Bordetella_phage	4.8e-10	34.5
AXQ34995.1\|2852431_2852707_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AXQ34996.1\|2852761_2853385_-	guanylate kinase	K4JYM5	Abalone_herpesvirus	9.7e-20	35.0
AXQ34997.1\|2853432_2853618_-	hypothetical protein	NA	NA	NA	NA
AXQ34998.1\|2853635_2855306_+	NAD-dependent DNA ligase LigB	A0A218MKC8	uncultured_virus	1.1e-20	23.3

DBSCAN-SWA_204

2867772 : 2875371

Xanthomonas_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35011.1\|2867772_2868228_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	9.5e-49	60.8
AXQ35012.1\|2868208_2869423_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	2.3e-41	32.8
AXQ35013.1\|2869593_2870259_+	JAB domain-containing protein	NA	NA	NA	NA
AXQ35014.1\|2870476_2870713_+	50S ribosomal protein L28	NA	NA	NA	NA
AXQ35015.1\|2870735_2870903_+	50S ribosomal protein L33	NA	NA	NA	NA
AXQ35016.1\|2870975_2871785_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	F8WPX6	Bacillus_phage	1.2e-25	32.6
AXQ35017.1\|2871787_2872267_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	4.1e-26	43.9
AXQ35018.1\|2872270_2873041_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AXQ35019.1\|2873040_2874315_-	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AXQ35020.1\|2874381_2875371_-	glycosyltransferase	A0A1V0SAH6	Catovirus	7.2e-09	27.3

DBSCAN-SWA_205

2885063 : 2888444

Prochlorococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35030.1\|2885063_2885996_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.8e-36	36.4
AXQ35031.1\|2886209_2887406_+	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	2.7e-34	27.8
AXQ35032.1\|2887415_2888444_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	80.8

DBSCAN-SWA_206

2892559 : 2904485

Planktothrix_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35037.1\|2892559_2893843_-	murein hydrolase activator EnvC	G9BW84	Planktothrix_phage	4.6e-08	35.4
AXQ35038.1\|2893852_2895397_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
AXQ35039.1\|2895645_2896077_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
AXQ35040.1\|2896088_2896340_+	glutaredoxin 3	V9QKN6	Rhizobium_phage	1.1e-14	52.1
AXQ35041.1\|2896371_2896839_+	protein-export chaperone SecB	NA	NA	NA	NA
AXQ35042.1\|2896838_2897858_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AXQ36606.1\|2897933_2898755_+	serine O-acetyltransferase	NA	NA	NA	NA
AXQ35043.1\|2898809_2899091_-	peptidylprolyl isomerase C	NA	NA	NA	NA
AXQ35044.1\|2899176_2901201_+	ATP-dependent DNA helicase Rep	A7KV33	Bacillus_phage	5.8e-114	37.5
AXQ35045.1\|2901251_2902736_-	guanosine-5'-triphosphate,3'-diphosphate diphosphatase	NA	NA	NA	NA
AXQ35046.1\|2902742_2904011_-	ATP-dependent RNA helicase RhlB	E3T5E1	Cafeteria_roenbergensis_virus	2.2e-42	31.4
AXQ35047.1\|2904155_2904485_+	thioredoxin TrxA	A0A1V0SD63	Indivirus	2.5e-14	38.5

DBSCAN-SWA_207

2908549 : 2912748

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35051.1\|2908549_2909680_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	1.4e-27	30.2
AXQ35052.1\|2909676_2910939_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HPJ2	Paramecium_bursaria_Chlorella_virus	1.5e-22	26.4
AXQ35053.1\|2910935_2911613_+	dTDP-4-amino-4,6-dideoxy-D-galactose acyltransferase	NA	NA	NA	NA
AXQ35054.1\|2911617_2912748_+	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A0F7LAY0	uncultured_marine_virus	5.1e-19	33.5

DBSCAN-SWA_208

2930497 : 2934358

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35071.1\|2930497_2931400_+	tyrosine recombinase XerC	A0A1B1IQT7	uncultured_Mediterranean_phage	2.0e-18	29.4
AXQ35072.1\|2931399_2932116_+	5-amino-6-(5-phospho-D-ribitylamino)uracil phosphatase YigB	NA	NA	NA	NA
AXQ35073.1\|2932195_2934358_+	DNA helicase II	A7KV33	Bacillus_phage	2.5e-115	37.2

DBSCAN-SWA_209

2938284 : 2940114

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35079.1\|2938284_2940114_+	ATP-dependent DNA helicase RecQ	A0A1V0SBK0	Catovirus	1.3e-83	37.4

DBSCAN-SWA_210

2952459 : 2955750

Ostreococcus_lucimarinus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35092.1\|2952459_2954100_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	1.7e-42	28.4
AXQ35093.1\|2954176_2954431_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
AXQ35094.1\|2954434_2954977_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
AXQ35095.1\|2954979_2955750_+	Sec-independent protein translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.1e-25	31.7

DBSCAN-SWA_211

2959685 : 2964161

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35100.1\|2959685_2961305_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	2.9e-23	27.2
AXQ35101.1\|2961343_2961631_-	HTH-type transcriptional regulator	NA	NA	NA	NA
AXQ35102.1\|2961961_2962672_+	DUF3053 domain-containing protein	NA	NA	NA	NA
AXQ35103.1\|2962915_2963128_+	RNA chaperone/antiterminator CspA	A0A1W6JNX5	Morganella_phage	1.2e-22	74.3
AXQ35104.1\|2963186_2964161_-	glyoxylate/hydroxypyruvate reductase GhrB	M1HTA3	Paramecium_bursaria_Chlorella_virus	2.8e-21	27.7

DBSCAN-SWA_212

2969339 : 2971709

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35110.1\|2969339_2971709_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	1.9e-71	30.2

DBSCAN-SWA_213

2981255 : 2986304

Planktothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35119.1\|2981255_2982239_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-14	28.9
AXQ35120.1\|2982235_2983249_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-17	29.4
AXQ35121.1\|2983291_2984242_-	type I pantothenate kinase	A0A1B1ISL9	uncultured_Mediterranean_phage	1.1e-27	32.0
AXQ35122.1\|2985119_2986304_+	elongation factor Tu	A0A2K9L516	Tupanvirus	4.4e-13	26.1

DBSCAN-SWA_214

2990293 : 3001026

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35129.1\|2990293_2994322_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	3.6e-22	29.4
AXQ35130.1\|2994398_2998622_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	4.5e-68	27.4
AXQ35131.1\|2998678_2998996_-	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
AXQ35132.1\|2998995_2999304_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
AXQ35133.1\|2999484_3001026_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.3e-12	34.4

DBSCAN-SWA_215

3009446 : 3014857

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35143.1\|3009446_3010118_+	deoxyribonuclease V	A0A1V0SJW5	Klosneuvirus	1.3e-22	30.1
AXQ35144.1\|3010159_3010750_+	DUF416 family protein	NA	NA	NA	NA
AXQ35145.1\|3010936_3011209_+	DNA-binding protein HU-alpha	A7KV42	Bacillus_phage	1.2e-19	56.7
AXQ35146.1\|3011220_3011913_+	DUF1481 domain-containing protein	NA	NA	NA	NA
AXQ35147.1\|3011959_3013252_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AXQ35148.1\|3013267_3014857_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.4e-68	48.4

DBSCAN-SWA_216

3027457 : 3033482

Brucella_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35154.1\|3027457_3031141_+	methionine synthase	A0A140XBC7	Dickeya_phage	2.2e-26	91.8
AXQ36607.1\|3031257_3032889_+	Na/Pi cotransporter family protein	NA	NA	NA	NA
AXQ36608.1\|3032885_3033173_-	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	1.5e-12	44.3
AXQ35155.1\|3033179_3033482_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	2.9e-22	53.8

DBSCAN-SWA_217

3048230 : 3049340

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35169.1\|3048230_3049340_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	Q6GZ03	Mycoplasma_phage	6.2e-17	47.2

DBSCAN-SWA_218

3056439 : 3057048

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35175.1\|3056439_3057048_+	repressor LexA	Q9G0C2	Lactococcus_phage	2.7e-14	40.7

DBSCAN-SWA_219

3064108 : 3066617

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35184.1\|3064108_3065521_+	replicative DNA helicase DnaB	O80281	Escherichia_phage	8.2e-200	78.3
AXQ35185.1\|3065537_3066617_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	3.6e-30	28.6

DBSCAN-SWA_220

3069781 : 3073380

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35190.1\|3069781_3072604_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	55.8
AXQ35191.1\|3072855_3073380_+	single-stranded DNA-binding protein SSB1	A0A0A0P1Q9	Enterobacteria_phage	5.1e-54	96.3

DBSCAN-SWA_221

3079564 : 3080914

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35198.1\|3079564_3080914_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	8.8e-159	71.8

DBSCAN-SWA_222

3086931 : 3095574

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35205.1\|3086931_3088890_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.0e-91	41.1
AXQ35206.1\|3089313_3090627_+	glutamate/aspartate:proton symporter GltP	NA	NA	NA	NA
AXQ35207.1\|3090710_3091385_-	sel1 repeat family protein	NA	NA	NA	NA
AXQ35208.1\|3091506_3091659_-	Hok/Gef family protein	NA	NA	NA	NA
AXQ35209.1\|3091759_3093129_-\|transposase	IS3-like element ISKpn8 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	9.4e-108	95.5
AXQ35210.1\|3093426_3095574_-	formate dehydrogenase subunit alpha	A0A077SK27	Escherichia_phage	9.4e-30	24.2

DBSCAN-SWA_223

3101137 : 3102652

Amsacta_moorei_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35217.1\|3101137_3102652_-	sugar ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	7.2e-08	24.0

DBSCAN-SWA_224

3108433 : 3109879

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35224.1\|3108433_3109114_-	phosphonate C-P lyase system protein PhnL	F2Y1V6	Organic_Lake_phycodnavirus	3.5e-07	26.0
AXQ35225.1\|3109123_3109879_-	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	6.1e-16	26.7

DBSCAN-SWA_225

3115429 : 3116218

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35233.1\|3115429_3116218_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	5.9e-14	28.7

DBSCAN-SWA_226

3122734 : 3124237

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35239.1\|3122734_3124237_+	proline/glycine betaine transporter ProP	Q6JIH2	Burkholderia_virus	5.9e-55	32.0

DBSCAN-SWA_227

3141195 : 3143176

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35250.1\|3141195_3141489_+	co-chaperone GroES	K4F9I2	Cronobacter_phage	2.1e-12	43.3
AXQ35251.1\|3141529_3143176_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	6.9e-190	69.3

DBSCAN-SWA_228

3149433 : 3149964

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35262.1\|3149433_3149964_-	hypothetical protein	A0A1W6JNX6	Morganella_phage	3.3e-45	51.6

DBSCAN-SWA_229

3155857 : 3156835

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35269.1\|3155857_3156835_+	elongation factor P--(R)-beta-lysine ligase	A0A2K9KZX5	Tupanvirus	5.8e-27	28.8

DBSCAN-SWA_230

3164117 : 3164663

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35273.1\|3164117_3164663_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.6e-29	41.0

DBSCAN-SWA_231

3168579 : 3181562

Vibrio_phage(20.0%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35277.1\|3168579_3169920_+	N-acetylmuramoyl-L-alanine amidase AmiB	A0A067ZJB6	Vibrio_phage	2.6e-17	30.1
AXQ35278.1\|3169929_3171774_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	1.7e-59	30.8
AXQ35279.1\|3171766_3172717_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AXQ35280.1\|3172802_3173114_+	RNA-binding protein Hfq	NA	NA	NA	NA
AXQ35281.1\|3173188_3174469_+	GTPase HflX	NA	NA	NA	NA
AXQ35282.1\|3174525_3175785_+\|protease	FtsH protease activity modulator HflK	A0A1L2CVV0	Pectobacterium_phage	3.6e-05	25.5
AXQ35283.1\|3175787_3176792_+\|protease	protease modulator HflC	NA	NA	NA	NA
AXQ35284.1\|3176863_3177061_+	DUF2065 domain-containing protein	NA	NA	NA	NA
AXQ36611.1\|3177165_3178464_+	adenylosuccinate synthase	W5S5V7	Pithovirus	8.4e-66	35.4
AXQ35285.1\|3178656_3179082_+	HTH-type transcriptional repressor NsrR	NA	NA	NA	NA
AXQ35286.1\|3179120_3181562_+	ribonuclease R	Q0GXV6	Lactococcus_phage	8.4e-67	32.2

DBSCAN-SWA_232

3185537 : 3187469

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35290.1\|3185537_3187469_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.5e-10	35.8

DBSCAN-SWA_233

3203474 : 3205124

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35312.1\|3203474_3205124_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-10	30.7

DBSCAN-SWA_234

3221733 : 3225165

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35327.1\|3221733_3222264_-	inorganic pyrophosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.6e-55	62.7
AXQ35328.1\|3222573_3223530_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ35329.1\|3223662_3225165_+	sugar ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	3.4e-10	30.6

DBSCAN-SWA_235

3228891 : 3229890

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35333.1\|3228891_3229890_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	3.7e-69	43.0

DBSCAN-SWA_236

3242968 : 3245714

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35348.1\|3242968_3243433_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	K4F9T1	Cronobacter_phage	2.3e-50	55.2
AXQ35349.1\|3243575_3245714_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.7e-268	64.9

DBSCAN-SWA_237

3250927 : 3261104

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35356.1\|3250927_3251875_-	HTH-type transcriptional regulator TreR	C6ZCU4	Enterobacteria_phage	1.0e-12	21.5
AXQ36613.1\|3252262_3254971_+	magnesium-translocating P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	4.5e-37	25.1
AXQ35357.1\|3254866_3255097_-	hypothetical protein	NA	NA	NA	NA
AXQ35358.1\|3255171_3257556_+	beta-N-acetylhexosaminidase	NA	NA	NA	NA
AXQ35359.1\|3257650_3259099_-	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.4e-21	36.1
AXQ35360.1\|3259237_3259624_-	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
AXQ35361.1\|3259697_3260159_-	aspartate carbamoyltransferase regulatory subunit	NA	NA	NA	NA
AXQ35362.1\|3260171_3261104_-	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.3e-52	40.2

DBSCAN-SWA_238

3284650 : 3285895

Pseudoalteromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35385.1\|3284650_3285895_+	hypothetical protein	A0A1W5PTH8	Pseudoalteromonas_phage	6.1e-05	26.5

DBSCAN-SWA_239

3290399 : 3293805

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35392.1\|3290399_3291520_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AXQ35393.1\|3293130_3293805_+	hypothetical protein	A0A291LAA9	Escherichia_phage	3.3e-74	73.9

DBSCAN-SWA_240

3304351 : 3307257

Acidithiobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35403.1\|3304351_3306304_-	AAA family ATPase	K4I1H4	Acidithiobacillus_phage	2.6e-26	30.2
AXQ35404.1\|3306435_3307257_-	alpha/beta hydrolase	A0A249XMC3	Mycobacterium_phage	3.9e-16	28.8

DBSCAN-SWA_241

3313042 : 3320155

IC4_retrovirus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35412.1\|3313042_3318628_+	GAF domain-containing protein	Q67624	IC4_retrovirus	3.4e-07	33.3
AXQ35413.1\|3318631_3319249_-	DNA-binding response regulator	NA	NA	NA	NA
AXQ35414.1\|3319549_3320155_+\|protease	ATP-dependent Clp protease proteolytic subunit	G3M9Z8	Bacillus_virus	9.4e-28	39.8

DBSCAN-SWA_242

3357247 : 3358912

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35452.1\|3357247_3358912_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-14	30.4

DBSCAN-SWA_243

3362643 : 3363923

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35456.1\|3362643_3363381_-	DNA replication protein DnaC	A0A1W6JP39	Morganella_phage	7.1e-62	48.1
AXQ35457.1\|3363377_3363923_-	primosomal protein DnaT	T1SA92	Salmonella_phage	4.4e-24	56.4

DBSCAN-SWA_244

3371187 : 3372252

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35467.1\|3371187_3372252_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.4e-20	36.9

DBSCAN-SWA_245

3375990 : 3378788

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35473.1\|3375990_3377580_+	peptide chain release factor 3	D0R0F5	Streptococcus_phage	7.0e-30	26.0
AXQ35474.1\|3377884_3378502_+	molecular chaperone OsmY	NA	NA	NA	NA
AXQ35475.1\|3378626_3378788_+	DUF1328 domain-containing protein	A0A0N7CBR2	Salmonella_phage	3.0e-13	69.8

DBSCAN-SWA_246

3384248 : 3385571

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35480.1\|3384248_3385571_+	thymidine phosphorylase	A0A0H3UZD4	Geobacillus_virus	6.8e-79	39.8

DBSCAN-SWA_247

3394517 : 3401781

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35488.1\|3394517_3395750_+	multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR	A0A0C5K935	Enterococcus_phage	4.4e-88	44.4
AXQ35489.1\|3395847_3396849_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
AXQ35490.1\|3396957_3397857_+	LysR family transcriptional regulator	NA	NA	NA	NA
AXQ35491.1\|3397949_3399617_-	energy-dependent translational throttle protein EttA	A0A1V0SKJ1	Klosneuvirus	1.1e-41	26.6
AXQ35492.1\|3399843_3401781_+	murein transglycosylase	A0A1P8CWQ1	Bacillus_phage	3.6e-12	36.2

DBSCAN-SWA_248

3415155 : 3428983

Cyanophage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35507.1\|3415155_3416109_+	transaldolase	A0A127KNC6	Cyanophage	5.7e-11	32.1
AXQ35508.1\|3416219_3416807_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AXQ35509.1\|3416929_3418252_+	MFS transporter	NA	NA	NA	NA
AXQ35510.1\|3418228_3418795_-	acetate uptake transporter	NA	NA	NA	NA
AXQ35511.1\|3419090_3421004_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	6.4e-147	50.6
AXQ35512.1\|3421091_3422237_+	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	4.1e-24	35.3
AXQ35513.1\|3422410_3423586_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	4.7e-84	53.7
AXQ35514.1\|3423644_3424544_+	transcriptional activator NhaR	NA	NA	NA	NA
AXQ35515.1\|3424602_3424866_-	30S ribosomal protein S20	NA	NA	NA	NA
AXQ35516.1\|3425094_3425187_+	DUF2575 domain-containing protein	NA	NA	NA	NA
AXQ35517.1\|3425194_3426121_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AXQ35518.1\|3426166_3428983_+\|tRNA	isoleucine--tRNA ligase	K7YVP8	Megavirus	1.1e-78	25.4

DBSCAN-SWA_249

3432482 : 3433631

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35523.1\|3432482_3433631_+	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	5.4e-48	31.9

DBSCAN-SWA_250

3443167 : 3444535

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35528.1\|3443167_3443647_+	type 3 dihydrofolate reductase	A0A219UQN5	Bacillus_phage	2.6e-28	46.4
AXQ35529.1\|3443686_3444535_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A0A0YWI7	Pseudomonas_phage	4.9e-06	42.3

DBSCAN-SWA_251

3452173 : 3457565

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35537.1\|3452173_3455080_-	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	4.9e-21	36.6
AXQ35538.1\|3455207_3457565_-	DNA polymerase II	A0A0P0YM26	Yellowstone_lake_phycodnavirus	1.4e-29	25.7

DBSCAN-SWA_252

3463815 : 3464514

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35544.1\|3463815_3464514_-	thiamine ABC transporter ATP-binding protein ThiQ	G9BWD6	Planktothrix_phage	4.0e-22	34.7

DBSCAN-SWA_253

3477299 : 3479024

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35556.1\|3477299_3479024_+	acetolactate synthase 3 large subunit	E5ERI2	Ostreococcus_lucimarinus_virus	4.9e-37	26.7

DBSCAN-SWA_254

3504975 : 3506019

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35579.1\|3504975_3506019_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	4.1e-103	56.2

DBSCAN-SWA_255

3521708 : 3523133

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35592.1\|3521708_3523133_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.5e-41	27.3

DBSCAN-SWA_256

3531373 : 3537913

Mamastrovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35599.1\|3531373_3532933_+	multicopper oxidase CueO	A0A0C6DWA2	Mamastrovirus	2.1e-18	49.6
AXQ35600.1\|3533019_3535410_-	glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase	NA	NA	NA	NA
AXQ35601.1\|3535616_3536153_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.3e-17	33.1
AXQ35602.1\|3536216_3536879_-	carbonate dehydratase	NA	NA	NA	NA
AXQ35603.1\|3536986_3537913_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.3e-22	32.3

DBSCAN-SWA_257

3550490 : 3557264

unidentified_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36623.1\|3550490_3551915_-	polynucleotide adenylyltransferase	H7BUW3	unidentified_phage	1.6e-25	31.5
AXQ35617.1\|3551930_3552821_-\|tRNA	tRNA glutamyl-Q(34) synthetase GluQRS	NA	NA	NA	NA
AXQ35618.1\|3552880_3553336_-	RNA polymerase-binding transcription factor DksA	NA	NA	NA	NA
AXQ35619.1\|3553512_3554217_-	DNA/RNA nuclease SfsA	NA	NA	NA	NA
AXQ35620.1\|3554206_3554761_-	RNA 2',3'-cyclic phosphodiesterase	NA	NA	NA	NA
AXQ35621.1\|3554834_3557264_+	ATP-dependent helicase HrpB	A0A0G2Y9F4	Acanthamoeba_polyphaga_mimivirus	4.0e-37	30.6

DBSCAN-SWA_258

3562432 : 3563230

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35625.1\|3562432_3563230_+	Fe3+-hydroxamate ABC transporter ATP-binding protein FhuC	G9BWD6	Planktothrix_phage	4.6e-14	27.4

DBSCAN-SWA_259

3569136 : 3569481

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35630.1\|3569136_3569481_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.5e-27	51.4

DBSCAN-SWA_260

3573416 : 3574850

uncultured_Mediterranean_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35635.1\|3573416_3574850_+\|protease	serine endoprotease DegP	A0A1B1IT49	uncultured_Mediterranean_phage	2.5e-26	29.2

DBSCAN-SWA_261

3586208 : 3586967

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35645.1\|3586208_3586967_+	(2E,6E)-farnesyl-diphosphate-specific ditrans,polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	1.4e-25	43.0

DBSCAN-SWA_262

3595808 : 3599926

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35654.1\|3595808_3596405_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	4.6e-27	40.8
AXQ35655.1\|3596443_3599926_+	DNA polymerase III subunit alpha	Q8W6C3	Saccharomonospora_phage	7.7e-207	36.5

DBSCAN-SWA_263

3611890 : 3612922

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35669.1\|3611890_3612922_-	D-methionine ABC transporter, ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-36	40.2

DBSCAN-SWA_264

3619470 : 3620274

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35671.1\|3619470_3620274_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.6e-38	36.2

DBSCAN-SWA_265

3624330 : 3628535

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35675.1\|3624330_3625695_-	murein transglycosylase D	A0A2H4J9N7	uncultured_Caudovirales_phage	9.9e-09	36.0
AXQ35676.1\|3625763_3626522_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AXQ35677.1\|3626554_3627271_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AXQ35678.1\|3627271_3627739_-	ribonuclease HI	J9Q745	Salmonella_phage	4.0e-50	58.4
AXQ35679.1\|3627794_3628535_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.0e-39	39.5

DBSCAN-SWA_266

3632407 : 3632986

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35682.1\|3632407_3632986_+	D-sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.5e-14	31.4

DBSCAN-SWA_267

3646189 : 3653784

Enterobacteria_phage(30.0%)

integrase

attL 3638605:3638619|attR 3664291:3664305

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3638605:3638619	attL	NA	NA	NA	NA
AXQ35697.1\|3646189_3647242_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.6e-118	60.9
AXQ35698.1\|3647547_3648651_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.7e-59	39.9
AXQ35699.1\|3648662_3649916_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.3e-97	46.6
AXQ35700.1\|3650117_3651113_-\|integrase	site-specific integrase	A0A2H5BFK7	Salmonella_phage	1.8e-188	95.8
AXQ35701.1\|3651157_3651508_-	DNA-binding protein	Q5G8V4	Enterobacteria_phage	1.5e-57	95.7
AXQ35702.1\|3651510_3651720_-	hypothetical protein	A0A220IH74	Escherichia_phage	2.1e-11	59.3
AXQ35703.1\|3651756_3652302_-	hypothetical protein	E5AGD3	Erwinia_phage	2.2e-20	35.0
AXQ35704.1\|3652313_3652514_-	hypothetical protein	G8C7S1	Escherichia_phage	1.1e-20	71.2
AXQ35705.1\|3652522_3653323_-	hypothetical protein	K7P7Q8	Enterobacteria_phage	5.1e-138	85.0
AXQ35706.1\|3653322_3653784_-	VUT family protein	A0A2H4N7D9	Pectobacterium_phage	4.1e-39	55.7
3664291:3664305	attR	NA	NA	NA	NA

DBSCAN-SWA_268

3663194 : 3664979

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35713.1\|3663194_3664979_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.9e-18	33.9

DBSCAN-SWA_269

3669826 : 3670594

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35718.1\|3669826_3670594_+	taurine ABC transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	4.7e-24	38.0

DBSCAN-SWA_270

3679107 : 3680268

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35726.1\|3679107_3680268_-	D-alanyl-D-alanine- carboxypeptidase/endopeptidase AmpH	A0A2H4JAN9	uncultured_Caudovirales_phage	6.7e-06	22.9

DBSCAN-SWA_271

3688181 : 3689285

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35736.1\|3688181_3689285_+	diguanylate cyclase AdrA	A0A127AWB9	Bacillus_phage	9.5e-18	31.4

DBSCAN-SWA_272

3692892 : 3701461

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35743.1\|3692892_3693807_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	2.2e-100	62.4
AXQ35744.1\|3693930_3694836_+	fructokinase	NA	NA	NA	NA
AXQ35745.1\|3694933_3698065_-	exonuclease subunit SbcC	M1U9H5	Synechococcus_phage	3.0e-08	30.1
AXQ35746.1\|3698061_3699267_-	exonuclease subunit SbcD	A0A0A0PQ58	Bacillus_phage	2.0e-08	24.9
AXQ35747.1\|3699454_3700144_+	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	9.7e-37	37.6
AXQ35748.1\|3700165_3701461_+	two-component system sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.7e-26	30.3

DBSCAN-SWA_273

3713279 : 3724118

uncultured_Mediterranean_phage(50.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35757.1\|3713279_3714407_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.2e-89	46.3
AXQ35758.1\|3714429_3714762_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	2.8e-10	33.0
AXQ35759.1\|3714789_3716637_+	protein translocase subunit SecD	NA	NA	NA	NA
AXQ35760.1\|3716647_3717619_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	2.5e-46	40.2
AXQ35761.1\|3717757_3718123_+	VOC family protein	NA	NA	NA	NA
AXQ35762.1\|3718709_3719829_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AXQ36627.1\|3720157_3721042_-	nucleoside-specific channel-forming protein Tsx	NA	NA	NA	NA
AXQ36628.1\|3721310_3721850_-	DUF3251 domain-containing protein	NA	NA	NA	NA
AXQ35763.1\|3722002_3722452_+	transcriptional regulator NrdR	NA	NA	NA	NA
AXQ35764.1\|3722456_3723560_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.5e-51	33.4
AXQ35765.1\|3723647_3724118_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.0e-29	48.0

DBSCAN-SWA_274

3740403 : 3741903

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35782.1\|3740403_3741903_-	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-20	30.0

DBSCAN-SWA_275

3755878 : 3760926

Agrobacterium_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35795.1\|3755878_3756502_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	2.2e-64	63.9
AXQ35796.1\|3756629_3757904_+\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.9e-132	56.6
AXQ35797.1\|3758088_3760443_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.5e-225	52.7
AXQ35798.1\|3760653_3760926_+	DNA-binding protein HU-beta	A3E2K9	Sodalis_phage	8.5e-21	61.8

DBSCAN-SWA_276

3764082 : 3765448

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35802.1\|3764082_3764433_+	addiction module killer protein	A4JWV2	Burkholderia_virus	7.6e-14	47.6
AXQ35803.1\|3764419_3764749_+	DNA-binding protein	NA	NA	NA	NA
AXQ35804.1\|3764752_3765448_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	9.3e-88	68.4

DBSCAN-SWA_277

3769826 : 3773355

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35809.1\|3769826_3771581_+	SmdA family multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	3.1e-47	30.0
AXQ35810.1\|3771573_3773355_+	SmdB family multidrug efflux ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-41	27.8

DBSCAN-SWA_278

3780504 : 3784768

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35820.1\|3780504_3781575_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.9e-88	53.1
AXQ35821.1\|3781678_3784768_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	66.2

DBSCAN-SWA_279

3787807 : 3794861

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35826.1\|3787807_3789268_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.2e-15	26.4
AXQ35827.1\|3789239_3789707_-	hypothetical protein	NA	NA	NA	NA
AXQ35828.1\|3789823_3790375_-	maltose O-acetyltransferase	NA	NA	NA	NA
AXQ35829.1\|3790583_3790802_-	hemolysin expression modulator Hha	NA	NA	NA	NA
AXQ35830.1\|3790829_3791204_-	Hha toxicity modulator TomB	NA	NA	NA	NA
AXQ35831.1\|3791714_3794861_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.4e-52	23.1

DBSCAN-SWA_280

3801630 : 3807175

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35839.1\|3801630_3802182_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	45.9
AXQ35840.1\|3802270_3804199_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	7.9e-44	42.9
AXQ35841.1\|3804252_3804585_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AXQ35842.1\|3804584_3805190_+	recombination protein RecR	NA	NA	NA	NA
AXQ35843.1\|3805300_3807175_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-111	36.1

DBSCAN-SWA_281

3817174 : 3819673

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35852.1\|3817174_3819673_-	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	2.6e-108	37.3

DBSCAN-SWA_282

3822703 : 3823375

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35857.1\|3822703_3823375_+	iron ABC transporter ATP-binding protein FetA	G3M9Y6	Bacillus_virus	2.7e-23	33.3

DBSCAN-SWA_283

3826507 : 3827194

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35862.1\|3826507_3827194_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-32	35.9

DBSCAN-SWA_284

3835301 : 3836687

Moumouvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35870.1\|3835301_3836687_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.5e-44	34.8

DBSCAN-SWA_285

3840424 : 3841291

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35875.1\|3840424_3841291_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.2e-30	34.8

DBSCAN-SWA_286

3861100 : 3862072

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35891.1\|3861100_3862072_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.7e-24	31.4

DBSCAN-SWA_287

3866071 : 3866359

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35895.1\|3866071_3866359_+	XRE family transcriptional regulator	A0A088CD40	Shigella_phage	6.9e-05	38.1

DBSCAN-SWA_288

3874452 : 3877161

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35904.1\|3874452_3877161_+	cation-transporting P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.7e-68	27.9

DBSCAN-SWA_289

3892281 : 3893809

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35918.1\|3892281_3892986_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-21	34.8
AXQ35919.1\|3892972_3893809_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-13	32.0

DBSCAN-SWA_290

3898289 : 3906947

Catovirus(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35924.1\|3898289_3899954_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	8.8e-60	31.4
AXQ35925.1\|3899967_3901440_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
AXQ35926.1\|3901453_3902041_-	transcriptional regulator BetI	NA	NA	NA	NA
AXQ35927.1\|3902169_3904203_+\|holin	choline BCCT transporter BetT	A0A2I7QNT1	Vibrio_phage	3.4e-21	27.6
AXQ36632.1\|3904341_3904728_+	addiction module toxin RelE	NA	NA	NA	NA
AXQ35928.1\|3904730_3905015_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AXQ35929.1\|3905226_3906138_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ35930.1\|3906140_3906947_+	manganese/iron ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	6.7e-13	27.0

DBSCAN-SWA_291

3913221 : 3917968

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35937.1\|3913221_3917079_+	enterobactin non-ribosomal peptide synthetase EntF	A0A2K9KZV5	Tupanvirus	4.1e-60	28.7
AXQ35938.1\|3917167_3917968_-	iron-enterobactin ABC transporter ATP-binding protein	M1I1A6	Acanthocystis_turfacea_Chlorella_virus	2.2e-08	25.5

DBSCAN-SWA_292

3926165 : 3934314

Mollivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35944.1\|3926165_3926921_+	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase	A0A0M4JSW6	Mollivirus	3.2e-09	26.8
AXQ35945.1\|3926920_3927334_+	proofreading thioesterase EntH	NA	NA	NA	NA
AXQ35946.1\|3927483_3929589_+	carbon starvation protein CstA	NA	NA	NA	NA
AXQ35947.1\|3929703_3929901_+	DUF466 domain-containing protein	NA	NA	NA	NA
AXQ35948.1\|3929897_3930302_-	XRE family transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	2.3e-06	34.1
AXQ35949.1\|3930276_3930579_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AXQ35950.1\|3930762_3931506_-	3-oxoacyl-ACP reductase FabG	NA	NA	NA	NA
AXQ35951.1\|3931563_3932652_-	oxidoreductase	NA	NA	NA	NA
AXQ35952.1\|3932811_3934314_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.4e-17	26.5

DBSCAN-SWA_293

3943688 : 3950053

uncultured_marine_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35963.1\|3943688_3944315_-	hypothetical protein	A0A0F7L444	uncultured_marine_virus	3.2e-55	51.3
AXQ35964.1\|3944299_3945523_-	phosphoadenosine phosphosulfate reductase	A0A220GKF8	Streptococcus_phage	2.6e-61	34.5
AXQ35965.1\|3945651_3946572_-	LysR family transcriptional regulator	NA	NA	NA	NA
AXQ35966.1\|3947193_3947757_+	alkyl hydroperoxide reductase subunit C	NA	NA	NA	NA
AXQ35967.1\|3947999_3949565_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.4e-43	34.0
AXQ35968.1\|3949624_3950053_-	universal stress protein UspG	A0A1W6JNV4	Morganella_phage	5.3e-17	36.4

DBSCAN-SWA_294

3970127 : 3970970

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35986.1\|3970127_3970367_+	cold shock-like protein CspE	A0A1W6JNX5	Morganella_phage	8.0e-23	72.9
AXQ35987.1\|3970586_3970970_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.4e-24	54.6

DBSCAN-SWA_295

3975760 : 3978217

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ35994.1\|3975760_3976972_-	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.0e-101	49.4
AXQ35995.1\|3977110_3978217_-	endolytic peptidoglycan transglycosylase RlpA	F5B3X9	Synechococcus_phage	1.8e-08	51.6

DBSCAN-SWA_296

3984608 : 3989731

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36002.1\|3984608_3987215_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	2.2e-182	42.1
AXQ36636.1\|3987405_3987888_+	zinc ribbon-containing protein	NA	NA	NA	NA
AXQ36003.1\|3987944_3988886_-	pyrimidine-specific ribonucleoside hydrolase RihA	NA	NA	NA	NA
AXQ36004.1\|3989005_3989731_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.1e-30	36.8

DBSCAN-SWA_297

3995561 : 3996608

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36010.1\|3995561_3996608_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	6.4e-48	45.6

DBSCAN-SWA_298

4000534 : 4002199

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36013.1\|4000534_4002199_-	asparagine synthase B	A9YVS6	Ostreococcus_tauri_virus	1.6e-85	39.0

DBSCAN-SWA_299

4006805 : 4010592

Vibrio_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36018.1\|4006805_4008755_+	PTS N-acetyl glucosamine transporter subunit IIABC	A0A2I7SAJ6	Vibrio_phage	1.9e-08	48.6
AXQ36019.1\|4008924_4010592_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	0.0e+00	94.0

DBSCAN-SWA_300

4022159 : 4022837

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36031.1\|4022159_4022837_-	two-component system response regulator KdpE	W8CYM9	Bacillus_phage	2.0e-26	29.7

DBSCAN-SWA_301

4026109 : 4032473

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36034.1\|4026109_4028158_-	K(+)-transporting ATPase subunit B	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.1e-27	22.6
AXQ36035.1\|4028176_4029856_-	potassium-transporting ATPase subunit KdpA	NA	NA	NA	NA
AXQ36036.1\|4029855_4029945_-	potassium-transporting ATPase subunit F	NA	NA	NA	NA
AXQ36037.1\|4030255_4030462_+	DUF2517 family protein	NA	NA	NA	NA
AXQ36038.1\|4031060_4032473_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	8.9e-61	33.1

DBSCAN-SWA_302

4035569 : 4036361

Kaumoebavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36041.1\|4035569_4036361_+	endonuclease VIII	A0A1V0CNR6	Kaumoebavirus	2.0e-09	27.7

DBSCAN-SWA_303

4065014 : 4068485

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36066.1\|4065014_4065734_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	5.8e-24	36.0
AXQ36067.1\|4065730_4066669_-	CDF family zinc transporter ZitB	A0A1V0SED0	Indivirus	5.8e-24	28.4
AXQ36068.1\|4066768_4067128_-	hypothetical protein	NA	NA	NA	NA
AXQ36069.1\|4067432_4068485_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	5.2e-82	48.3

DBSCAN-SWA_304

4072808 : 4079337

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36074.1\|4072808_4073825_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.8e-79	45.4
AXQ36075.1\|4074026_4075499_-	molybdate ABC transporter ATP-binding protein ModF	A0A1M7XV31	Cedratvirus	2.3e-11	29.5
AXQ36076.1\|4075566_4076355_-	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
AXQ36077.1\|4076482_4076635_+	multidrug efflux pump-associated protein, AcrZ family	NA	NA	NA	NA
AXQ36078.1\|4076813_4077590_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AXQ36079.1\|4077586_4078279_+	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AXQ36080.1\|4078278_4079337_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	1.4e-18	33.3

DBSCAN-SWA_305

4087605 : 4091024

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36088.1\|4087605_4089126_+	histidine ammonia-lyase	A0A1V0S940	Catovirus	2.8e-84	39.6
AXQ36089.1\|4089192_4089669_-	kinase inhibitor	NA	NA	NA	NA
AXQ36641.1\|4089716_4091024_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	7.0e-20	30.2

DBSCAN-SWA_306

4098249 : 4099158

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36097.1\|4098249_4099158_-	uridine diphosphate-N-acetylglucosamine-binding protein YvcK	A1IMD5	Streptococcus_phage	3.9e-25	28.9

DBSCAN-SWA_307

4108776 : 4116040

Anomala_cuprea_entomopoxvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36110.1\|4108776_4110516_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.1e-19	30.0
AXQ36111.1\|4110508_4111504_-	secretion protein HlyD	NA	NA	NA	NA
AXQ36112.1\|4111500_4112178_-	transcriptional regulator	NA	NA	NA	NA
AXQ36113.1\|4112382_4113765_+	ATP-dependent RNA helicase RhlE	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.7e-51	33.2
AXQ36114.1\|4113862_4116040_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	1.5e-43	26.1

DBSCAN-SWA_308

4123274 : 4123927

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36122.1\|4123274_4123541_-	DksA/TraR family C4-type zinc finger protein	E5E4B1	Acinetobacter_phage	4.9e-13	50.6
AXQ36123.1\|4123663_4123927_-	DUF1471 domain-containing protein	A0A142IIN6	Enterobacteria_phage	1.3e-05	43.8

DBSCAN-SWA_309

4127455 : 4132595

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36127.1\|4127455_4128178_-	glutamine ABC transporter ATP-binding protein GlnQ	G9BWD6	Planktothrix_phage	4.7e-34	42.7
AXQ36128.1\|4128174_4128834_-	glutamine ABC transporter permease GlnP	NA	NA	NA	NA
AXQ36129.1\|4128927_4129671_-	glutamine ABC transporter substrate-binding protein GlnH	NA	NA	NA	NA
AXQ36130.1\|4130032_4130536_-	DNA starvation/stationary phase protection protein Dps	A0A222YYG6	Streptomyces_phage	9.3e-05	24.4
AXQ36131.1\|4130834_4131722_-	threonine/homoserine exporter RhtA	NA	NA	NA	NA
AXQ36132.1\|4132076_4132595_+	outer membrane protein X	K7PJP9	Enterobacteria_phage	3.2e-16	31.4

DBSCAN-SWA_310

4146712 : 4148308

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36145.1\|4146712_4148308_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	9.4e-59	28.4

DBSCAN-SWA_311

4155819 : 4159946

Citrobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36151.1\|4155819_4158252_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A076YHZ7	Citrobacter_phage	1.0e-08	49.1
AXQ36152.1\|4158256_4159156_-	glycyl-radical enzyme activating protein	NA	NA	NA	NA
AXQ36153.1\|4159283_4159946_+	fructose-6-phosphate aldolase	A0A0E3HJ81	Synechococcus_phage	1.6e-25	32.7

DBSCAN-SWA_312

4163161 : 4165033

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36157.1\|4163161_4165033_+	glutathione ABC transporter ATP-binding protein GsiA	G3M9Y6	Bacillus_virus	6.5e-19	31.1

DBSCAN-SWA_313

4172518 : 4174569

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36642.1\|4172518_4173724_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-98	47.2
AXQ36165.1\|4173810_4174569_-	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	1.8e-12	26.1

DBSCAN-SWA_314

4180583 : 4196747

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36172.1\|4180583_4181009_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	8.9e-49	66.4
AXQ36173.1\|4181021_4182311_-	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	5.3e-169	71.7
AXQ36643.1\|4182351_4182672_-	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	4.1e-22	53.7
AXQ36644.1\|4183162_4184848_-	transporter	NA	NA	NA	NA
AXQ36174.1\|4185122_4185497_+	hypothetical protein	NA	NA	NA	NA
AXQ36175.1\|4185527_4185797_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	7.9e-27	71.8
AXQ36176.1\|4185982_4186705_+	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AXQ36177.1\|4186769_4187672_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	2.8e-36	33.6
AXQ36178.1\|4187735_4188212_+	YbjN domain-containing protein	NA	NA	NA	NA
AXQ36179.1\|4188208_4188397_-	hypothetical protein	NA	NA	NA	NA
AXQ36180.1\|4188562_4189675_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AXQ36181.1\|4189818_4190952_+	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	6.5e-30	34.4
AXQ36182.1\|4190961_4191915_+	putrescine ABC transporter permease PotH	NA	NA	NA	NA
AXQ36183.1\|4191911_4192757_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AXQ36184.1\|4192799_4193297_+	DUF2593 family protein	NA	NA	NA	NA
AXQ36185.1\|4193337_4194465_+	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	2.5e-29	27.5
AXQ36186.1\|4194586_4195294_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.4e-35	36.3
AXQ36187.1\|4195277_4196747_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	3.1e-24	30.1

DBSCAN-SWA_315

4199869 : 4200598

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36192.1\|4199869_4200598_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.8e-28	36.2

DBSCAN-SWA_316

4217003 : 4219706

Orgyia_leucostigma_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36211.1\|4217003_4219706_+	PKD domain-containing protein	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	4.9e-193	61.1

DBSCAN-SWA_317

4236567 : 4266282

uncultured_Mediterranean_phage(14.29%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36223.1\|4236567_4238508_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	3.8e-38	40.5
AXQ36224.1\|4238578_4238800_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
AXQ36225.1\|4239067_4239388_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	44.9
AXQ36226.1\|4239415_4241695_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.0
AXQ36647.1\|4242132_4242585_+	hypothetical protein	NA	NA	NA	NA
AXQ36227.1\|4242656_4242875_-	translation initiation factor IF-1	NA	NA	NA	NA
AXQ36228.1\|4243159_4243864_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AXQ36229.1\|4243909_4245631_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	F2Y2R6	Organic_Lake_phycodnavirus	2.7e-19	27.8
AXQ36230.1\|4245630_4247397_-	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	F2Y302	Organic_Lake_phycodnavirus	1.6e-11	27.4
AXQ36231.1\|4247511_4248480_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	7.9e-61	42.7
AXQ36232.1\|4249023_4249518_+	leucine-responsive regulatory protein	NA	NA	NA	NA
AXQ36233.1\|4249653_4253322_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	2.6e-88	49.2
AXQ36234.1\|4253449_4254064_+	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AXQ36235.1\|4254073_4255417_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-80	40.3
AXQ36236.1\|4255509_4256802_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.7e-93	45.2
AXQ36237.1\|4257013_4259458_+	dimethylsulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	6.8e-218	49.4
AXQ36238.1\|4259468_4260086_+	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.4e-74	59.1
AXQ36239.1\|4260087_4260951_+	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
AXQ36240.1\|4261002_4261185_-	hypothetical protein	NA	NA	NA	NA
AXQ36241.1\|4261225_4262374_+	MFS transporter	NA	NA	NA	NA
AXQ36242.1\|4262497_4263019_+	hypothetical protein	NA	NA	NA	NA
AXQ36243.1\|4263055_4263796_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.4e-20	26.1
AXQ36244.1\|4263999_4266282_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	1.1e-161	41.9

DBSCAN-SWA_318

4270339 : 4271428

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36247.1\|4270339_4271428_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	7.8e-81	45.6

DBSCAN-SWA_319

4275604 : 4280154

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36251.1\|4275604_4275892_+	integration host factor subunit beta	A7KV42	Bacillus_phage	5.5e-10	40.2
AXQ36252.1\|4276104_4278369_+	ComEC family protein	NA	NA	NA	NA
AXQ36253.1\|4278405_4280154_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	6.7e-58	30.5

DBSCAN-SWA_320

4297351 : 4305526

Enterobacteria_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36269.1\|4297351_4298410_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	1.3e-96	52.3
AXQ36270.1\|4299016_4300417_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	8.5e-80	37.3
AXQ36271.1\|4300585_4301788_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.8e-45	31.9
AXQ36272.1\|4302042_4304655_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.0e-18	21.8
AXQ36273.1\|4304755_4305526_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.5e-30	39.0

DBSCAN-SWA_321

4310961 : 4316198

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36280.1\|4310961_4312071_-	MOSC domain-containing protein	A0A0E3FP00	Synechococcus_phage	4.1e-05	35.1
AXQ36649.1\|4312169_4314278_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
AXQ36281.1\|4314290_4316198_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.5e-50	28.5

DBSCAN-SWA_322

4328687 : 4330742

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36292.1\|4328687_4330742_+	DNA helicase IV	A7KV33	Bacillus_phage	6.7e-17	27.5

DBSCAN-SWA_323

4334972 : 4339613

uncultured_Caudovirales_phage(66.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36299.1\|4334972_4335632_-\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	2.0e-47	53.9
AXQ36300.1\|4335630_4335816_+	hypothetical protein	NA	NA	NA	NA
AXQ36301.1\|4335902_4337531_+	oligopeptide ABC transporter substrate-binding protein OppA	NA	NA	NA	NA
AXQ36302.1\|4337823_4338585_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.1e-12	30.4
AXQ36303.1\|4338581_4339613_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	4.5e-14	23.2

DBSCAN-SWA_324

4347837 : 4350994

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36312.1\|4347837_4348008_+	stress-induced protein	Q9KX95	Enterobacteria_phage	1.4e-05	92.6
AXQ36313.1\|4348124_4349045_+	DMT family transporter	NA	NA	NA	NA
AXQ36314.1\|4349155_4350478_-	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	2.6e-211	89.2
AXQ36315.1\|4350499_4350994_-	pyrimidine utilization flavin reductase protein F	Q9KX93	Enterobacteria_phage	1.6e-41	83.3

DBSCAN-SWA_325

4367333 : 4368398

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36331.1\|4367333_4368398_+	phosphate starvation-inducible protein PhoH	A0A1B2ICF6	Erwinia_phage	1.4e-90	69.5

DBSCAN-SWA_326

4374883 : 4375717

Pelagibacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36339.1\|4374883_4375717_-	curli production assembly/transport protein CsgG	M1ICK2	Pelagibacter_phage	2.3e-40	39.9

DBSCAN-SWA_327

4379867 : 4380404

Red_sea_bream_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36347.1\|4379867_4380404_+	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	1.2e-26	42.5

DBSCAN-SWA_328

4388065 : 4388992

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36355.1\|4388065_4388992_-	LpxL/LpxP family Kdo(2)-lipid IV(A) lauroyl/palmitoleoyl acyltransferase	A0A1W6JP29	Morganella_phage	3.1e-54	41.5

DBSCAN-SWA_329

4393594 : 4393840

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36362.1\|4393594_4393840_-	DNA damage-inducible protein I	K7PM44	Enterobacteria_phage	4.5e-13	50.0

DBSCAN-SWA_330

4408940 : 4409894

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36380.1\|4408940_4409894_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A160LKR7	Bacillus_phage	2.8e-10	38.0

DBSCAN-SWA_331

4424158 : 4425284

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36393.1\|4424158_4424893_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	6.5e-15	33.3
AXQ36394.1\|4425047_4425284_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	3.4e-10	45.2

DBSCAN-SWA_332

4428561 : 4430204

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36398.1\|4428561_4429203_+	dTMP kinase	Q2Z0N0	Pseudomonas_phage	1.8e-29	39.6
AXQ36399.1\|4429199_4430204_+	DNA polymerase III subunit delta'	A0A2H4IBD4	Erwinia_phage	1.5e-06	28.4

DBSCAN-SWA_333

4442448 : 4442706

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36411.1\|4442448_4442706_+	DUF1471 domain-containing protein	A0A1B2IFR9	Erwinia_phage	5.6e-06	37.1

DBSCAN-SWA_334

4447486 : 4457569

Gordonia_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36414.1\|4447486_4448560_-	hypothetical protein	A0A142KBN9	Gordonia_phage	1.1e-07	25.9
AXQ36415.1\|4448816_4450016_+	lipoprotein-releasing ABC transporter permease subunit LolC	NA	NA	NA	NA
AXQ36416.1\|4450008_4450710_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.4e-37	42.3
AXQ36417.1\|4450709_4451954_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
AXQ36418.1\|4452008_4452920_+	N-acetylglucosamine kinase	NA	NA	NA	NA
AXQ36419.1\|4452934_4453756_+	NAD-dependent protein deacylase	A0A2I7S9Y2	Vibrio_phage	1.2e-22	34.6
AXQ36420.1\|4453790_4454825_-	spermidine/putrescine ABC transporter substrate-binding protein PotD	NA	NA	NA	NA
AXQ36421.1\|4454821_4455613_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
AXQ36422.1\|4455609_4456467_-	spermidine/putrescine ABC transporter permease PotB	Q6GZ02	Mycoplasma_phage	4.6e-12	24.8
AXQ36423.1\|4456450_4457569_-	spermidine/putrescine ABC transporter ATP-binding protein PotA	G3M9Y6	Bacillus_virus	6.4e-30	34.1

DBSCAN-SWA_335

4463375 : 4464746

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36429.1\|4463375_4464746_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.2e-108	45.8

DBSCAN-SWA_336

4467828 : 4473043

Phage_21(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ36434.1\|4467828_4469079_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	7.9e-21	94.4
AXQ36435.1\|4469154_4469400_+	DUF2543 family protein	NA	NA	NA	NA
AXQ36436.1\|4469404_4470904_-	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
AXQ36437.1\|4471028_4471121_-	stress response membrane protein YncL	NA	NA	NA	NA
AXQ36655.1\|4471279_4471465_+	hypothetical protein	NA	NA	NA	NA
AXQ36438.1\|4471493_4471742_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AXQ36656.1\|4471795_4471870_-	protein YoaJ	NA	NA	NA	NA
AXQ36439.1\|4471870_4471969_-	hypothetical protein	NA	NA	NA	NA
AXQ36440.1\|4472014_4473043_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	5.0e-13	32.1

DBSCAN-SWA_337

4481638 : 4535571

Enterobacterial_phage(24.59%)

tail,head,transposase,integrase,capsid,tRNA,holin,terminase,portal

attL 4477194:4477208|attR 4484004:4484018

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4477194:4477208	attL	NA	NA	NA	NA
AXQ36451.1\|4481638_4482139_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
AXQ36452.1\|4482358_4483501_-\|integrase	integrase	O21929	Phage_21	2.4e-93	49.0
AXQ36453.1\|4483475_4483739_-	hypothetical protein	NA	NA	NA	NA
AXQ36454.1\|4483771_4484041_-	hypothetical protein	K7PKM4	Enterobacterial_phage	1.6e-32	79.8
4484004:4484018	attR	NA	NA	NA	NA
AXQ36455.1\|4484241_4484967_-	hypothetical protein	M9NZE4	Enterobacteria_phage	9.2e-30	40.4
AXQ36456.1\|4484963_4485791_-	chromosome partitioning protein ParB	K7PKM7	Enterobacterial_phage	2.8e-123	86.3
AXQ36657.1\|4485790_4486204_-	hypothetical protein	K7PJS4	Enterobacterial_phage	6.8e-54	84.7
AXQ36457.1\|4486658_4487117_+	hypothetical protein	NA	NA	NA	NA
AXQ36458.1\|4487218_4487404_-	hypothetical protein	K7PGV8	Enterobacterial_phage	5.3e-06	73.5
AXQ36459.1\|4487501_4487702_+	hypothetical protein	NA	NA	NA	NA
AXQ36460.1\|4488053_4488263_+	hypothetical protein	G8C7T7	Escherichia_phage	2.3e-18	73.4
AXQ36461.1\|4488298_4488655_-	hypothetical protein	G0ZNF1	Cronobacter_phage	2.0e-54	92.4
AXQ36462.1\|4488766_4489585_-	DUF3037 domain-containing protein	NA	NA	NA	NA
AXQ36463.1\|4489581_4490319_-	hypothetical protein	NA	NA	NA	NA
AXQ36464.1\|4490387_4491140_-	helix-turn-helix transcriptional regulator	A0A2I6PIE7	Escherichia_phage	1.1e-73	55.0
AXQ36465.1\|4491174_4491426_+	DNA-binding protein	A0A2I6PIE5	Escherichia_phage	1.0e-12	49.3
AXQ36466.1\|4491454_4492009_+	hypothetical protein	S5FXP0	Shigella_phage	5.4e-46	53.5
AXQ36467.1\|4492172_4492352_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	3.3e-13	69.2
AXQ36468.1\|4492341_4493220_+	GntR family transcriptional regulator	U5P0A0	Shigella_phage	7.7e-39	82.0
AXQ36469.1\|4493216_4493711_+	hypothetical protein	NA	NA	NA	NA
AXQ36470.1\|4493710_4494370_+	DNA methyltransferase	I6PDF5	Cronobacter_phage	7.2e-98	78.1
AXQ36471.1\|4494366_4494594_+	hypothetical protein	NA	NA	NA	NA
AXQ36472.1\|4494590_4494980_+	RusA family crossover junction endodeoxyribonuclease	K7PKN5	Enterobacterial_phage	1.2e-68	95.3
AXQ36473.1\|4494976_4495966_+	DUF968 domain-containing protein	K7PJS6	Enterobacterial_phage	9.6e-179	89.4
AXQ36474.1\|4495980_4496343_+	antitermination protein Q	K7PGW2	Enterobacterial_phage	1.2e-57	92.5
AXQ36475.1\|4496391_4497207_-	TIR domain-containing protein	K7PLZ9	Enterobacterial_phage	1.9e-87	60.3
AXQ36476.1\|4497538_4497964_+	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	6.6e-60	84.4
AXQ36477.1\|4497960_4498116_+	DUF3927 domain-containing protein	S4TRP5	Salmonella_phage	5.0e-10	68.8
AXQ36478.1\|4498844_4499234_+	hypothetical protein	G8C7V8	Escherichia_phage	1.1e-58	92.2
AXQ36479.1\|4499223_4499502_+\|holin	phage holin family protein	G8C7V9	Escherichia_phage	1.7e-37	85.9
AXQ36480.1\|4499501_4500131_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	2.1e-102	88.5
AXQ36658.1\|4500138_4500408_+	hypothetical protein	G8C7W1	Escherichia_phage	1.9e-25	71.9
AXQ36481.1\|4500364_4500547_+	hypothetical protein	K7PM01	Enterobacterial_phage	3.2e-16	86.4
AXQ36482.1\|4500546_4500924_+	hypothetical protein	A0A192Y658	Salmonella_phage	1.0e-27	57.9
AXQ36483.1\|4501069_4501273_+	hypothetical protein	A0A1W6JPG4	Morganella_phage	1.6e-11	52.9
AXQ36484.1\|4501338_4501527_+	hypothetical protein	A0A2I7RUD6	Vibrio_phage	2.7e-18	77.0
AXQ36485.1\|4501677_4501887_+	hypothetical protein	NA	NA	NA	NA
AXQ36486.1\|4501959_4502187_+	hypothetical protein	A0A1L6Z528	Klebsiella_phage	3.3e-18	73.3
AXQ36659.1\|4502548_4502710_+	transmembrane anchored protein	G9L6D9	Escherichia_phage	4.6e-14	77.4
AXQ36487.1\|4502853_4504311_+	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	1.1e-271	91.5
AXQ36488.1\|4504402_4504579_-	ATP-NAD kinase	NA	NA	NA	NA
AXQ36489.1\|4504697_4505267_+	HNH endonuclease	G8IDS8	Mycobacterium_phage	4.4e-19	38.9
AXQ36490.1\|4505263_4505842_+	hypothetical protein	S4TR53	Salmonella_phage	1.8e-92	82.7
AXQ36491.1\|4505834_4506203_+	HNH endonuclease	S4TTG9	Salmonella_phage	1.0e-56	88.5
AXQ36492.1\|4506308_4506803_+\|terminase	terminase small subunit	S4TNN3	Salmonella_phage	1.7e-83	100.0
AXQ36493.1\|4506799_4508461_+\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	0.0e+00	98.7
AXQ36494.1\|4508519_4510454_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	0.0e+00	93.3
AXQ36495.1\|4510657_4512019_+\|portal	phage portal protein	S4TTG7	Salmonella_phage	1.2e-243	92.7
AXQ36496.1\|4512015_4513233_+\|head,tail	phage gp6-like head-tail connector protein	S4TNN1	Salmonella_phage	6.8e-94	71.6
AXQ36497.1\|4513229_4513556_+\|head,tail	phage gp6-like head-tail connector protein	S4TSQ3	Salmonella_phage	7.5e-48	88.9
AXQ36498.1\|4513564_4513915_+\|head,tail	head-tail adaptor protein	S4TND9	Salmonella_phage	1.1e-52	89.7
AXQ36499.1\|4513911_4514361_+	HK97 gp10 family phage protein	K7P6X4	Enterobacteria_phage	4.9e-74	98.7
AXQ36500.1\|4514357_4514705_+	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	8.5e-58	97.4
AXQ36501.1\|4514764_4515208_+	hypothetical protein	K7PHL2	Enterobacterial_phage	1.0e-71	93.1
AXQ36502.1\|4515216_4515600_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	4.4e-63	93.7
AXQ36503.1\|4515608_4515887_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	1.2e-43	97.8
AXQ36504.1\|4515942_4516278_+	zinc ribbon domain-containing protein	S4TR42	Salmonella_phage	3.0e-52	94.6
AXQ36505.1\|4516324_4519816_+\|tail	phage tail tape measure protein	A0A2H4JHR1	uncultured_Caudovirales_phage	0.0e+00	86.1
AXQ36506.1\|4519818_4520157_+\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	1.1e-38	60.7
AXQ36507.1\|4520153_4520912_+\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	3.9e-95	63.6
AXQ36508.1\|4520914_4521625_+	peptidase P60	F1C573	Cronobacter_phage	1.7e-97	69.8
AXQ36509.1\|4521624_4522209_+\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	1.1e-54	53.1
AXQ36660.1\|4522255_4522441_-	hypothetical protein	NA	NA	NA	NA
AXQ36510.1\|4523031_4526877_+	DUF1983 domain-containing protein	Q9MCU0	Escherichia_phage	0.0e+00	63.3
AXQ36511.1\|4526920_4527235_+	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
AXQ36512.1\|4527235_4527907_+	hypothetical protein	A0A2P0WA07	Enterobacter_phage	1.2e-87	73.5
AXQ36513.1\|4528014_4528248_+	cor protein	E4WL42	Enterobacteria_phage	3.9e-30	78.9
AXQ36514.1\|4528306_4529551_+\|tail	phage tail protein	K7PM99	Enterobacterial_phage	5.6e-144	64.4
AXQ36661.1\|4529516_4530002_-	hypothetical protein	A0A220NRP2	Escherichia_phage	1.5e-71	81.2
AXQ36662.1\|4530444_4530993_+	DNA-invertase	A0A1S6L009	Salmonella_phage	2.6e-77	80.6
AXQ36515.1\|4532298_4533765_+	flagellin FliC	NA	NA	NA	NA
AXQ36516.1\|4533910_4534828_+\|transposase	transposase	A0A077SL42	Escherichia_phage	8.3e-68	43.6
AXQ36517.1\|4535271_4535571_+	hypothetical protein	K7PGV5	Enterobacterial_phage	6.5e-22	51.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP031722

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 90848

109

Salmonella_phage(91.67%)

integrase,transposase,tail,capsid,terminase

attL 4728:4744|attR 51414:51430

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ31867.1\|0_1056_+	replication protein RepA	J9Q7H0	Salmonella_phage	1.0e-186	98.6
AXQ31868.1\|1625_1838_-	hypothetical protein	J9Q7S8	Salmonella_phage	3.1e-34	98.6
AXQ31869.1\|1837_2173_-	hypothetical protein	J9Q7Z5	Salmonella_phage	2.2e-55	98.2
AXQ31870.1\|2169_2349_-	hypothetical protein	J9Q6J1	Salmonella_phage	1.2e-20	100.0
AXQ31871.1\|2389_2665_-	hypothetical protein	J9Q738	Salmonella_phage	2.7e-46	97.8
AXQ31872.1\|2733_3144_-	hypothetical protein	J9Q7G9	Salmonella_phage	2.4e-75	97.8
AXQ31873.1\|3127_3499_-	DUF2591 domain-containing protein	J9Q7S7	Salmonella_phage	5.2e-69	98.4
AXQ31874.1\|3661_4492_-	SPFH/Band 7/PHB domain protein	J9Q7Z4	Salmonella_phage	1.1e-127	99.3
AXQ31875.1\|4495_4696_-	hypothetical protein	J9Q6J0	Salmonella_phage	2.5e-25	98.5
4728:4744	attL	NA	NA	NA	NA
AXQ31876.1\|4787_5864_-	recombinase	J9Q736	Salmonella_phage	1.2e-203	99.4
AXQ31877.1\|5866_6133_-	hypothetical protein	J9Q7G8	Salmonella_phage	1.6e-40	100.0
AXQ31878.1\|6132_7077_-	5'-3' exonuclease	J9Q7S6	Salmonella_phage	2.2e-180	98.7
AXQ31879.1\|7137_8154_-	regulator	J9Q7Z3	Salmonella_phage	2.4e-164	99.3
AXQ31880.1\|8273_8747_-	hypothetical protein	J9Q6I8	Salmonella_phage	1.9e-71	98.6
AXQ31881.1\|8926_9178_+	hypothetical protein	NA	NA	NA	NA
AXQ31882.1\|9248_9812_+	DNA-binding protein	J9Q7G7	Salmonella_phage	7.6e-64	65.6
AXQ31883.1\|9848_10283_-	hypothetical protein	J9Q7S4	Salmonella_phage	2.5e-67	96.4
AXQ31884.1\|10279_13798_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	99.4
AXQ31885.1\|13772_13976_-	hypothetical protein	J9Q6I7	Salmonella_phage	5.5e-33	100.0
AXQ31886.1\|13978_15214_-	porphyrin biosynthesis protein	J9Q733	Salmonella_phage	3.9e-238	99.3
AXQ31887.1\|15310_17683_-	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	0.0e+00	91.1
AXQ31888.1\|17792_18005_-	hypothetical protein	NA	NA	NA	NA
AXQ31889.1\|18268_18655_+	transcriptional regulator	NA	NA	NA	NA
AXQ31890.1\|18646_19753_-\|integrase	integrase	A0A1P8DTG6	Proteus_phage	5.6e-26	32.6
AXQ31891.1\|19926_20343_-	hypothetical protein	NA	NA	NA	NA
AXQ31892.1\|20333_20858_-	hypothetical protein	NA	NA	NA	NA
AXQ31893.1\|20954_21200_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	1.0e-12	44.9
AXQ31894.1\|21199_21559_-	hypothetical protein	K7PH35	Enterobacteria_phage	2.3e-37	67.2
AXQ31895.1\|21574_21778_-	hypothetical protein	A0A0B6VT64	Edwardsiella_phage	5.2e-07	50.8
AXQ31896.1\|21788_22622_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	1.4e-90	65.5
AXQ31897.1\|22769_24002_+	hypothetical protein	NA	NA	NA	NA
AXQ31898.1\|25006_25312_-	C-type natriuretic protein	J9Q7S1	Salmonella_phage	4.1e-48	97.0
AXQ31899.1\|25308_25461_-	hypothetical protein	J9Q7Z1	Salmonella_phage	4.0e-20	100.0
AXQ31996.1\|25460_25667_-	hypothetical protein	J9Q6I3	Salmonella_phage	6.2e-32	98.5
AXQ31900.1\|25656_25833_-	hypothetical protein	J9Q729	Salmonella_phage	2.6e-23	96.6
AXQ31901.1\|25832_27155_-	DNA ligase	J9Q7G5	Salmonella_phage	6.2e-258	99.1
AXQ31997.1\|27189_27447_-	hypothetical protein	J9Q7R9	Salmonella_phage	4.0e-36	97.6
AXQ31998.1\|27357_27699_+	hypothetical protein	NA	NA	NA	NA
AXQ31902.1\|27747_28542_-	hypothetical protein	J9Q7Z0	Salmonella_phage	9.9e-110	74.2
AXQ31903.1\|28728_29085_+	sel1 repeat family protein	NA	NA	NA	NA
AXQ31904.1\|29134_30254_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AXQ31905.1\|30325_31207_+	sel1 repeat family protein	NA	NA	NA	NA
AXQ31906.1\|31198_32410_-	DNA primase	J9Q720	Salmonella_phage	4.4e-210	94.6
AXQ31907.1\|32472_33813_-	DNA helicase	J9Q7G4	Salmonella_phage	1.3e-247	99.8
AXQ31908.1\|33873_34599_-	hypothetical protein	J9Q7R8	Salmonella_phage	1.1e-139	98.8
AXQ31909.1\|34862_35660_+	DUF2971 domain-containing protein	J9Q7Y9	Salmonella_phage	2.1e-11	26.1
AXQ31910.1\|35701_36061_-	hypothetical protein	J9Q7G3	Salmonella_phage	2.3e-45	100.0
AXQ31911.1\|36060_36726_-	plasmid stability protein	J9Q7R7	Salmonella_phage	4.7e-113	95.0
AXQ31912.1\|37142_37412_+	DUF1778 domain-containing protein	NA	NA	NA	NA
AXQ31913.1\|37415_37940_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXQ31914.1\|37967_38309_-	hypothetical protein	J9Q7G2	Salmonella_phage	2.6e-27	79.2
AXQ31915.1\|38377_39070_-	hypothetical protein	J9Q7Y7	Salmonella_phage	3.9e-126	96.1
AXQ31916.1\|39083_39407_-	hypothetical protein	J9Q6E7	Salmonella_phage	1.4e-46	92.5
AXQ31917.1\|39481_40270_-	receptor-recognizing protein	E5DHZ0	Enterobacter_phage	3.9e-58	63.5
AXQ31918.1\|40334_44516_-\|tail	phage tail protein	J9Q6E3	Salmonella_phage	0.0e+00	79.7
AXQ31919.1\|49289_49877_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	1.9e-102	92.3
AXQ31920.1\|49864_50662_-\|tail	phage tail protein	J9Q7R4	Salmonella_phage	8.6e-154	95.1
AXQ31921.1\|50654_51386_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	5.1e-137	100.0
AXQ31922.1\|51442_51778_-\|tail	phage tail protein	J9Q6E1	Salmonella_phage	5.7e-59	97.3
51414:51430	attR	NA	NA	NA	NA
AXQ31923.1\|51819_56400_-\|tail	phage tail tape measure protein	J9Q712	Salmonella_phage	0.0e+00	90.1
AXQ31924.1\|56407_56677_-	hypothetical protein	J9Q7F7	Salmonella_phage	8.4e-37	100.0
AXQ31925.1\|56757_57075_-	hypothetical protein	J9Q7R3	Salmonella_phage	6.0e-50	98.1
AXQ31926.1\|57135_57882_-	Ig domain-containing protein	J9Q7Y4	Salmonella_phage	8.7e-116	89.1
AXQ31927.1\|57956_58340_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.7e-67	100.0
AXQ31928.1\|58341_58815_-	hypothetical protein	J9Q711	Salmonella_phage	2.3e-82	100.0
AXQ31929.1\|58805_59150_-	hypothetical protein	J9Q7F6	Salmonella_phage	1.9e-57	100.0
AXQ31930.1\|59247_60081_-	hypothetical protein	J9Q7R2	Salmonella_phage	2.6e-153	100.0
AXQ31931.1\|60080_60515_-	hypothetical protein	J9Q7Y3	Salmonella_phage	2.1e-74	100.0
AXQ31932.1\|60558_61482_-	Ig domain-containing protein	J9Q6D6	Salmonella_phage	3.3e-157	100.0
AXQ31933.1\|61556_62432_-\|capsid	phage major capsid protein	J9Q710	Salmonella_phage	1.9e-162	99.7
AXQ31934.1\|62458_63355_-	hypothetical protein	J9Q7F4	Salmonella_phage	5.1e-147	98.0
AXQ31935.1\|63377_64952_-	hypothetical protein	J9Q7R1	Salmonella_phage	1.2e-300	99.0
AXQ31936.1\|64985_66242_-\|terminase	terminase	J9Q7Y2	Salmonella_phage	4.1e-251	99.8
AXQ31937.1\|66244_66886_-	DNA-binding protein	J9Q6D4	Salmonella_phage	7.5e-108	97.7
AXQ31938.1\|67083_67350_-	hypothetical protein	J9Q757	Salmonella_phage	1.3e-42	100.0
AXQ31939.1\|67359_68259_-	hypothetical protein	J9Q7I6	Salmonella_phage	3.1e-168	99.3
AXQ31940.1\|68255_68510_-	hypothetical protein	J9Q7U0	Salmonella_phage	4.1e-41	98.8
AXQ31941.1\|68502_69141_-	ATP-binding cassette domain-containing protein	J9Q807	Salmonella_phage	3.8e-112	100.0
AXQ31942.1\|69137_69806_-	chromosome partitioning protein ParB	J9Q6L1	Salmonella_phage	4.3e-114	99.1
AXQ31943.1\|69805_70504_-	chromosome partitioning protein ParB	J9Q756	Salmonella_phage	2.5e-125	99.1
AXQ31944.1\|70568_72128_+	DEAD/DEAH box helicase	J9Q7I4	Salmonella_phage	2.2e-294	99.4
AXQ31945.1\|72130_72409_+	hypothetical protein	J9Q7T9	Salmonella_phage	3.4e-41	98.9
AXQ31946.1\|72468_72891_+	hypothetical protein	J9Q806	Salmonella_phage	8.2e-63	85.7
AXQ31947.1\|72895_73423_+	transcriptional regulator	J9Q6L0	Salmonella_phage	2.6e-82	99.3
AXQ31948.1\|73745_74396_+	hypothetical protein	J9Q754	Salmonella_phage	2.1e-113	99.1
AXQ31949.1\|74446_74650_+	hypothetical protein	J9Q7I3	Salmonella_phage	1.3e-29	100.0
AXQ31950.1\|75293_75776_-	hypothetical protein	J9Q805	Salmonella_phage	2.5e-87	97.5
AXQ31951.1\|75788_76022_-	hypothetical protein	NA	NA	NA	NA
AXQ31999.1\|75981_76269_-	ABC transporter	J9Q753	Salmonella_phage	6.6e-48	97.8
AXQ31952.1\|76389_76785_-	hypothetical protein	J9Q7I1	Salmonella_phage	2.0e-42	66.2
AXQ31953.1\|76913_77225_-	hypothetical protein	J9Q7T7	Salmonella_phage	1.2e-47	97.1
AXQ31954.1\|77365_77584_-	hypothetical protein	J9Q804	Salmonella_phage	1.6e-33	95.8
AXQ31955.1\|77588_77810_-	hypothetical protein	J9Q6K7	Salmonella_phage	1.2e-33	95.8
AXQ31956.1\|77952_78198_+	hypothetical protein	J9Q751	Salmonella_phage	9.0e-38	93.8
AXQ31957.1\|79632_80823_-	hypothetical protein	J9Q803	Salmonella_phage	2.4e-120	54.8
AXQ31958.1\|80961_81798_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
AXQ31959.1\|81881_82199_-	hypothetical protein	J9Q750	Salmonella_phage	3.3e-48	81.9
AXQ31960.1\|82436_83557_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
AXQ31961.1\|83961_84165_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	6.8e-31	97.0
AXQ31962.1\|84220_84919_-	DUF1311 domain-containing protein	J9Q6K3	Salmonella_phage	2.7e-111	89.2
AXQ31963.1\|84957_85509_-	hypothetical protein	J9Q748	Salmonella_phage	6.7e-97	91.3
AXQ31964.1\|85505_86147_-	HD domain-containing protein	J9Q7H7	Salmonella_phage	6.5e-112	97.2
AXQ31965.1\|86238_86610_-	hypothetical protein	J9Q7T4	Salmonella_phage	2.0e-60	96.7
AXQ31966.1\|86612_86894_-	hypothetical protein	J9Q801	Salmonella_phage	6.5e-48	100.0
AXQ31967.1\|86890_87580_-	hypothetical protein	J9Q6K2	Salmonella_phage	6.1e-124	97.8
AXQ31968.1\|87638_89342_-	DUF4942 domain-containing protein	J9Q747	Salmonella_phage	0.0e+00	98.0
AXQ31969.1\|89465_90038_-	hypothetical protein	J9Q7H6	Salmonella_phage	4.5e-96	97.9
AXQ31970.1\|90155_90344_-	hypothetical protein	J9Q800	Salmonella_phage	1.3e-23	93.5
AXQ31971.1\|90353_90848_-	hypothetical protein	J9Q6J9	Salmonella_phage	6.2e-78	95.1

DBSCAN-SWA_2

93939 : 113956

Salmonella_phage(95.24%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXQ31975.1\|93939_95943_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.6e-21	26.2
AXQ31976.1\|96776_97007_-	hypothetical protein	J9Q7H5	Salmonella_phage	2.1e-36	100.0
AXQ31977.1\|97209_97803_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	2.1e-112	100.0
AXQ31978.1\|97988_98915_-	hypothetical protein	J9Q7Z9	Salmonella_phage	2.2e-108	93.2
AXQ31979.1\|98959_99517_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	7.0e-102	99.5
AXQ31980.1\|99526_99946_-	hypothetical protein	J9Q743	Salmonella_phage	6.4e-68	97.8
AXQ31981.1\|100009_100654_-	hypothetical protein	J9Q7H4	Salmonella_phage	5.2e-117	100.0
AXQ31982.1\|100653_101130_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	1.4e-90	100.0
AXQ31983.1\|101126_101540_-	hypothetical protein	J9Q7Z8	Salmonella_phage	3.3e-72	98.5
AXQ31984.1\|101541_102657_-	thymidylate synthase	J9Q6J6	Salmonella_phage	2.4e-218	98.9
AXQ31985.1\|102834_103704_-	phosphoribosyl-ATP pyrophosphohydrolase	J9Q742	Salmonella_phage	2.1e-161	99.0
AXQ31986.1\|103786_104929_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	4.9e-219	99.7
AXQ31987.1\|105036_107352_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	99.6
AXQ31988.1\|107429_107999_-	hypothetical protein	J9Q7Z7	Salmonella_phage	1.3e-103	99.5
AXQ31989.1\|108010_108757_-	hypothetical protein	J9Q6J5	Salmonella_phage	1.5e-136	98.4
AXQ31990.1\|108746_110663_-	exonuclease	J9Q741	Salmonella_phage	0.0e+00	98.6
AXQ31991.1\|110659_110896_-	hypothetical protein	J9Q7H1	Salmonella_phage	1.1e-29	98.4
AXQ31992.1\|110892_111978_-	exonuclease SbcCD subunit D	J9Q7S9	Salmonella_phage	1.6e-206	98.9
AXQ31993.1\|112206_112710_+	hypothetical protein	J9Q7Z6	Salmonella_phage	5.5e-90	98.2
AXQ31994.1\|112741_113236_-	N-acetyltransferase	J9Q6J3	Salmonella_phage	3.3e-87	97.0
AXQ31995.1\|113311_113956_-	hypothetical protein	J9Q739	Salmonella_phage	1.1e-122	98.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP031723

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP031724

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP031726

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP031722

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection