CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
CP031812	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0
CP031813	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0	0
CP031811	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence	0 crisprs	cas3	0	0	1
CP031810	Klebsiella pneumoniae strain INF014-sc-2279884 chromosome, complete genome	2 crisprs	DEDDh,DinG,cas3,csa3,WYL,RT	5	29	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1728 : 65118

Enterobacteria_phage(14.29%)

integrase,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXS38556.1\|1728_2469_-\|integrase	site-specific integrase	I3WFA4	Macacine_betaherpesvirus	5.4e-25	58.6
AXS38557.1\|2837_2951_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AXS38558.1\|3189_4113_-\|transposase	IS5 family transposase	Q1MVF0	Enterobacteria_phage	2.8e-172	97.7
AXS38701.1\|4565_5474_+	HNH endonuclease	NA	NA	NA	NA
AXS38559.1\|5882_6233_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	1.9e-20	54.3
AXS38560.1\|6376_6808_-	silver-binding protein SilE	NA	NA	NA	NA
AXS38561.1\|7058_8534_-	Cu(+)/Ag(+) sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-27	30.1
AXS38562.1\|8526_9207_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.1e-31	36.0
AXS38563.1\|9396_10782_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
AXS38564.1\|10810_11164_+	copper ABC transporter substrate-binding protein	NA	NA	NA	NA
AXS38565.1\|11277_12570_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AXS38566.1\|12580_15727_+	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	4.0e-61	22.5
AXS38567.1\|15813_16254_+	hypothetical protein	NA	NA	NA	NA
AXS38568.1\|16380_18828_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	7.6e-84	35.8
AXS38569.1\|18868_19066_+	DUF2933 domain-containing protein	NA	NA	NA	NA
AXS38570.1\|19099_19837_-	peptidase M23	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
AXS38571.1\|20125_20575_-	copper resistance protein	NA	NA	NA	NA
AXS38572.1\|20809_22627_+	multicopper oxidase PcoA	NA	NA	NA	NA
AXS38573.1\|22626_23523_+	copper resistance protein B	NA	NA	NA	NA
AXS38574.1\|23562_23943_+	copper resistance system chaperone PcoC	NA	NA	NA	NA
AXS38575.1\|23947_24877_+	copper resistance protein D	NA	NA	NA	NA
AXS38576.1\|24931_25612_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AXS38577.1\|25608_27009_+	sensor histidine kinase	W8CYF6	Bacillus_phage	4.1e-18	26.3
AXS38578.1\|27224_27659_+	copper-binding protein	NA	NA	NA	NA
AXS38702.1\|27890_28070_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AXS38579.1\|29812_30322_+	porin	NA	NA	NA	NA
AXS38703.1\|30371_30869_-	N-acetyltransferase	NA	NA	NA	NA
AXS38580.1\|31200_31527_+	transcriptional regulator	NA	NA	NA	NA
AXS38704.1\|31526_32237_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.9e-92	77.0
AXS38581.1\|32245_32791_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AXS38582.1\|32866_33229_+	arsenical resistance operon transcriptional repressor ArsD	NA	NA	NA	NA
AXS38583.1\|35125_35662_+	N-acetyltransferase	NA	NA	NA	NA
AXS38584.1\|36062_39068_-\|transposase	Tn3-like element Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	100.0
AXS38585.1\|39231_39789_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	7.0e-94	100.0
AXS38586.1\|39971_40832_+	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
AXS38587.1\|41041_41581_+\|transposase	IS91 family transposase	NA	NA	NA	NA
AXS38588.1\|41552_42389_-	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AXS38589.1\|42388_43192_-	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
AXS38590.1\|43252_44068_-	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
AXS38591.1\|44397_44574_+	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
AXS38592.1\|44755_45760_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AXS38593.1\|47568_48273_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXS38594.1\|48263_48581_+	hypothetical protein	NA	NA	NA	NA
AXS38706.1\|49286_49613_-	hypothetical protein	NA	NA	NA	NA
AXS38705.1\|49664_49751_+	ABC transporter	NA	NA	NA	NA
AXS38595.1\|50375_51080_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXS38596.1\|52071_53460_-	His-Xaa-Ser system radical SAM maturase HxsB	S5VT21	Leptospira_phage	6.3e-51	29.0
AXS38707.1\|53459_53690_-	His-Xaa-Ser system protein HxsD	NA	NA	NA	NA
AXS38597.1\|53714_54419_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AXS38598.1\|54936_55788_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.1e-11	27.2
AXS38599.1\|55717_55897_-	hypothetical protein	NA	NA	NA	NA
AXS38600.1\|56132_56948_+	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	4.3e-161	98.9
AXS38601.1\|58276_58834_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
AXS38602.1\|58871_59195_-\|transposase	transposase	NA	NA	NA	NA
AXS38603.1\|59139_60153_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AXS38604.1\|60308_60782_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
AXS38605.1\|61002_61269_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AXS38606.1\|61411_62176_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AXS38607.1\|62217_62430_+	resolvase	NA	NA	NA	NA
AXS38608.1\|62442_63651_+	restriction endonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
AXS38609.1\|63684_65118_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP031810

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP031810_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP031810_1

944144-944243

Orphan

Consensus_repeat	Method
GCTGCGCCTTACCGGGCCTACGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP031810_1

>merge|CP031810|1|944144-944243|CRISPRCasFinder
GCTGCGCCTTACCGGGCCTACGAACTCGACAGGAAGCGGAAGGGCTGCAGGCTATGCAGTTCGAGGCCGCTGCAAGCGCCGCGCCTTACCGGGCCTACGA

>CP031810|1|1|944144-944243|CRISPRCasFinder
GCTGCGCCTTACCGGGCCTACGA	ACTCGACAGGAAGCGGAAGGGCTGCAGGCTATGCAGTTCGAGGCCGCTGCAAGC
GCCGCGCCTTACCGGGCCTACGA

Protein	Signature genes	Signature genes Name	Protein_function
CP031810.1\|AXS34332.1\|952707_953472_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
CP031810.1\|AXS34328.1\|948865_949918_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP031810.1\|AXS34329.1\|949931_950885_+\|iron-siderophore-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238566
CP031810.1\|AXS34326.1\|947025_947847_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
CP031810.1\|AXS34317.1\|934714_936295_-\|rhodanese-related-sulfurtransferase	unknown	unknown	gnl\|CDD\|238793
CP031810.1\|AXS34330.1\|950881_951784_+\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
CP031810.1\|AXS34319.1\|937009_937903_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
CP031810.1\|AXS34321.1\|940286_941249_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270276
CP031810.1\|AXS34324.1\|943252_944026_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
CP031810.1\|AXS34318.1\|936300_936903_-\|cysteine-dioxygenase	unknown	unknown	gnl\|CDD\|227840
CP031810.1\|AXS34331.1\|951876_952644_+\|basic-amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270342
CP031810.1\|AXS34333.1\|954452_955067_+\|DUF1062-domain-containing-protein	unknown	unknown	gnl\|CDD\|226782
CP031810.1\|AXS34320.1\|938047_939133_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|238527
CP031810.1\|AXS34322.1\|941245_942283_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|223787
CP031810.1\|AXS34327.1\|947843_948869_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP031810.1\|AXS34325.1\|944447_946520_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
CP031810.1\|AXS34323.1\|942263_943259_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223673
CP031810.1\|AXS38384.1\|953458_954181_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
CP031810.1\|AXS38383.1\|939186_940281_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
CP031810.1\|AXS34316.1\|933976_934702_+\|laccase-domain-containing-protein	unknown	unknown	gnl\|CDD\|319354

Protein	Function_ID	Function_description	E-value
CP031810.1\|AXS34332.1\|952707_953472_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	2.43641e-77
CP031810.1\|AXS34328.1\|948865_949918_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.52854e-69
CP031810.1\|AXS34329.1\|949931_950885_+\|iron-siderophore-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	5.66347e-44
CP031810.1\|AXS34326.1\|947025_947847_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	8.32036e-120
CP031810.1\|AXS34317.1\|934714_936295_-\|rhodanese-related-sulfurtransferase	gnl\|CDD\|238793	cd01535, 4RHOD_Repeat_4, Member of the Rhodanese Homology Domain superfamily, repeat 4. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 4th repeat which, in general, contains the putative catalytic Cys residue.	2.79233e-65
CP031810.1\|AXS34330.1\|950881_951784_+\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	5.19519e-49
CP031810.1\|AXS34319.1\|937009_937903_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.98053e-36
CP031810.1\|AXS34321.1\|940286_941249_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270276	cd13558, PBP2_SsuA_like_2, Putative substrate binding domain of sulfonate binding protein, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	6.99128e-105
CP031810.1\|AXS34324.1\|943252_944026_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.04308e-109
CP031810.1\|AXS34318.1\|936300_936903_-\|cysteine-dioxygenase	gnl\|CDD\|227840	COG5553, COG5553, Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only].	2.22933e-53
CP031810.1\|AXS34331.1\|951876_952644_+\|basic-amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270342	cd13624, PBP2_Arg_Lys_His, Substrate binding domain of the arginine-, lysine-, histidine-binding protein ArtJ; the type 2 periplasmic binding protein fold. This group includes the periplasmic substrate-binding protein ArtJ of the ATP-binding cassette (ABC) transport system from the thermophilic bacterium Geobacillus stearothermophilus, which is specific for arginine, lysine, and histidine. ArtJ belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.91098e-97
CP031810.1\|AXS34333.1\|954452_955067_+\|DUF1062-domain-containing-protein	gnl\|CDD\|226782	COG4332, COG4332, Uncharacterized protein conserved in bacteria [Function unknown].	1.87662e-70
CP031810.1\|AXS34320.1\|938047_939133_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|238527	cd01094, Alkanesulfonate_monoxygenase, Alkanesulfonate monoxygenase is the monoxygenase of a two-component system that catalyzes the conversion of alkanesulfonates to the corresponding aldehyde and sulfite. Alkanesulfonate monoxygenase (SsuD) has an absolute requirement for reduced flavin mononucleotide (FMNH2), which is provided by the NADPH-dependent FMN oxidoreductase (SsuE).	1.09183e-91
CP031810.1\|AXS34322.1\|941245_942283_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|223787	COG0715, TauA, ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism].	2.4514e-27
CP031810.1\|AXS34327.1\|947843_948869_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.65175e-70
CP031810.1\|AXS34325.1\|944447_946520_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	2.62169e-100
CP031810.1\|AXS34323.1\|942263_943259_+\|ABC-transporter-permease-subunit	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	1.42279e-38
CP031810.1\|AXS38384.1\|953458_954181_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.77528e-153
CP031810.1\|AXS38383.1\|939186_940281_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	6.17908e-50
CP031810.1\|AXS34316.1\|933976_934702_+\|laccase-domain-containing-protein	gnl\|CDD\|319354	cd16833, YfiH, protein of unknown function YfiH. This subfamily contains YfiH, a protein of unknown function from Shigella flexneri, E. coli, and many similar proteins which collectively are often called DUF152. The structure of YfiH reveals a distant homology to Rho-activating toxins cytotoxic necrotizing factor 1 (CNF1) as well as chemotaxis protein CheD that stimulates methylation of methyl-accepting chemotaxis proteins (MCPs), all having an invariant Cys-His pair forming a catalytic dyad, and is required by the CNF-1 toxins for deamidation activity.	4.58134e-50

>CP031810.1|AXS34324.1|943252_944026_+|ABC-transporter-ATP-binding-protein
MVTETIARGAAVSISHLHHAFTLGKQTVPVLENISLQLRPGESVALLGPSGCGKSTLLRLLAGLEAPQSGQMQIDGAALGAPGPERILVFQDPTLYPWLTVRQNVLLGPQAQGKKGLEAKADALIDRIGLQAFSEAWPRQLSGGMAQRAALARALLNEPRLLLLDEPLGKLDSLTRISMQRELIALWQQQGYTSLLVTHDIEEALLLCERVLVMSPRPGRIIAEFALPLAFPRHRDNPQLLQHRQDILRILGQEADW
>CP031810.1|AXS34323.1|942263_943259_+|ABC-transporter-permease-subunit
MPTYSPEQALAHPTGRAPLWGEGLLAAALWLLGGLFTLTWPDAGRRWPFSEGWALAQFTLGGGLLLLALSYRYWRARGARVLHAGKWLALLPVLFAVWEGLTAKTAVLPVPFFAPPQALIEVLHDDWPRLLDSLLHSLGLLGLGVLLGTSSGFITGLAIGWSQRIGYWVHPVLRLLGPVPSTALLPLCLFIFPSSFGASVFLIALSTWFPVTVLTWSGVMGIDKAWYDVARTLGASQRFLILRVAIPAALPNVFVGLFMGLGASFSVLIVAEMVGVKSGIGFYLQWAQGWAAYPNMYAALLVMALLCSGLISGLFMLRDRLLSWQRGGMQW
>CP031810.1|AXS34322.1|941245_942283_+|ABC-transporter-substrate-binding-protein
MTRTPFSRRRFLQLSGGLALAGVSLPLWAHDMADMAGGDAHPALRLPQPYKIKLAINKSAVCLAPVAVAEQQKIFSKYNLDVEFVNFGSSTDVLLEAIATGKADAGVGMALRWLKALEQGFDVKLTAGTHGGCLNLLTAKDSPFGGLESLKGQTIGVTDMAGPDKNFFAILLKRHGIDPISDVQWKVYPADLLSVALDKREIAAISGSEPFSYRLLETGKYQLIASNMTGDYANLSCCVLGVSGSLARDHKPAAAALTQAILEAHSYAAAHPESVAQSFLAHALNTSEAEVSGILHGQGHGHHAVGEAFVKELTQYAVDLQRVQVIKPGTDPHQFAESIYANVFA
>CP031810.1|AXS34321.1|940286_941249_+|ABC-transporter-substrate-binding-protein
MRLSFSGRVAAALMLLALGGYATAQERLTLRIADQKGGMRSQLEAANALQNLPYDIKWAEFPAAAPLAEALNAGAVDAGIIGDAPLLFALANGAPVKAIAVDKSNPAGTAVLVSPGSTLKSGADLKGKRIATGKGSIGHFVALKALEQAGISPKEVQWVFLGPVDAKVALLNGSVDAWATWEPYTTQMVKTNEGQLLVSGKGLLPGNTFLAATDSALNDPQKRAALQDYLQRLAGAERWAYANLDSYGKTLGEIIRFPAEIARAQFANRQSQWQPLAEETVAQQQATADFYLANGLIRTRLDVKPTFDRRFSVPAAEVTP
>CP031810.1|AXS38383.1|939186_940281_+|acyl-CoA-dehydrogenase
MAEQAASLDASGEFPWRNIDHLRAGGWLSLAVPPSCGGAGASLAQLQQVIAAIAWGEPATALIVCMQYLHHLRLAENDAWHAPLRQQVFHDAVEHGGLINSLRVEPELGSPARGGLPDTVATRRAEGWDISGHKINTTGIEGLRWLAVWARSDDNPPLVGTWLVPGDSPGITVVKSWDHAGMRATGSHEVIFNHVRVAAEHAVDVWPADAPPAAQAEPFRLFANRQTALLAAIYDSIAHAAHDWLVRWLAGRVPAGLGHPLSRLPRVQEKVGQIAGLLLVNRSLLEQAAALRFSAIEANLAKVTITDNAIQAVNIALELTGNHGLSRQNPLERHYRNVLCGRVHTPQSDSAWLAAGNFVFQSQG
>CP031810.1|AXS34320.1|938047_939133_+|LLM-class-flavin-dependent-oxidoreductase
MSIQFLGMIGHRLSSETIAPVGPIFDRDYIVRFAQTHEAAGFDRLLVGHWSDQPDGFLVTALAGLSTQKIQYLLAHRPGFVSPTLAARKFATLEHLLGGRLAVHIISGGNDAEQRRDGDYLDHDQRYARTDAFLDTVRQVWTSEQPVDIHNDFYQAEQAWSAIRPLQKPHLPIYFGGSSEAAITVAGKHADVFALWGESLAQTGETIQRVRAEAAKHQRDIGFSVSFRPIIADSEAEAWEKAEHILHVATEQAAQRGGGFKAKPDSIGAQRLRATAAQGRVVDKRLWTGIAQLVGGGHNSTALVGTPEQVADALLDYYDLGVRNFLIRGFDPLNDAADYGRALLPIAREKAARRAVAERAS
>CP031810.1|AXS34319.1|937009_937903_+|LysR-family-transcriptional-regulator
MRIDDIDALLATVQFSSLNQAAEYLGITQSAITRRLQRLEQELNVTLLERQTRPLTLTAAGHRVYEQCLSIKRETKKLYSLLDPEGEPRGALRLGVPQSLSEIALPAALSALSQQFPGLSPQITCGWSGQLQRRLENGELDGMLAMGPAQQSFAESYSGRLLCPLEVVPIVGRRLNLRASSLRECAERGWILNPDGCGLRAGLIRELQSQGLRLTLNVESAGAQLQIALVAQGLGLGLVPRAALASSPWRDEIAVLSLSDFQPAVSLWLIHAQYLANLQPPLTFFASKVVQQLTVSD
>CP031810.1|AXS34318.1|936300_936903_-|cysteine-dioxygenase
MTAPRLEKLRHFIHEVDRLHREHHQTAPLLDAVAQRLAALVRYDDWLPEEYTLPHPHHYQQYLLHADSGERFSIVSFVWGPGQATPIHDHRVWGAIGMLRGAEENQRYQLDADGIPRALGAATLLEAGQVEKVSADDGDIHRVSNALADRVSISIHVYGGNIGAVKRAVYTPEGQQKPFISGYSNRHLPNIWDSSREHQG
>CP031810.1|AXS34317.1|934714_936295_-|rhodanese-related-sulfurtransferase
MPTYAYRQAAGIRQALLDRRELALIDVREEADFATAHPLFAVNLPLSKLELEVRRRIPRFTTPLTVYDNGEGLAEIAVERLRSWGYQDVALLAEGLAGWRRSGGELFQDVNSASKAFGELVESVRHTPSLSAQEVQALIDSRQEVVIVDARRFDEYQTMSIPGSISVPGGELALRVESLTPSPQTPVIVNCAGRTRSIIGTQSLINAGVPNPVHALRNGTIGWTLAGQTLAHQQQRQYDPSARASGARAAEVAHFAERAGVAVIDEATLQHWLQQSDRTTFLFDVRSPEEYAAGHYPGSLSAPGGQLVQETDHFASVRGARIVLLDDDGIRAAITGSWLAQMGWETARLSALSTSQLSERGVPAAEVPPGPQAEEISPAQLAQQLEEPGTVVLDFTTSANFVARHIPGAWWLTRSQLRQALEAIPPAQRYVVTCGSSLLARYAVPEVAALTGKPVQLLTGGTLAWIAAGLPLAHGDSGLAVERRDRYRRPYEGTDNSAEAMQAYLEWEYGLVDQLARDGTHGFRVL
>CP031810.1|AXS34316.1|933976_934702_+|laccase-domain-containing-protein
MAYTSRLLNAIPGIRHAFLDVHETAAFPYAELAPVKLVHGNEVHHYQQPLPTRPHADAVFTAVAGQKVGVVTADCLPLLIASRDGRYVCSVHAGWQGLVSGIVDNSLACFRQQGVALADLVIAVGPHIHPCCYEVSAGFYQQLLDQPGGDRVARHRQRLFHSRSGPVSDPLKAAARGSDNLWFDLRAFAEAIFAEAGVAPASVEWLGSCTYCTPQSLGSYRRRTHFPAPKSFQYSWIMREA
>CP031810.1|AXS34325.1|944447_946520_-|TonB-dependent-siderophore-receptor
MAADNRAAKSTNDAEETITVVADGAQQSATSGYQPLSSATATLTSMPLLDIPQVVNTVSDRVLEDQHATSLDEALYNVANVVQTNTLGGTQDAFTRRGFGANRDGSIMTNGLRTVLPRSFNAATERVEVLKGPASTLYGILDPGGLINVITKRPERQFSGSVSGTSTSFGGGTGSVDITGPIEGTNLAYRLIGEYQNEDYWRNFGKNKSSFIAPSLTWFGERATVTASYSHRDYSAPFDRGTIFDLNTGYAVNVDRKTRFDEAFNITDGYSDLAQLNAEYRLNDAWTARFDYSYSQDHYNDNQARVMAYDSATGNLTRRVDGTHGSTQKMHSTRADLQGNVVVGGFYNELLTGVAYENYDLLRTDMLRCKNVKGFNIYHPVYGTLDTCNTVSASDSDQRIQQESYAAYVQDALYLTDNWIAVAGVRYQYYTQYAGKGRPFNVNTDSRDEKWTPKAGLVYKVTPNVSLFANVAQSFMPQSSIASYIGELPPEESTSYEVGAKFDLLNGITANIALFDIHKRNVLYTESIGDETVAKTAGKVRSQGVEVDLAGSITDNLSVIASYGYTDAKVLEDPDYAGKPLPNVPKHTGSLFLTYDIHNVYNSNTLTVGGGGHAVSKRSGTNGADYYLQGYAVADVFAAYKMKLQYPVTLQVNVKNLFDKTYYTSSIGTNNLGNQIGDPREVQFTVKMDF
>CP031810.1|AXS34326.1|947025_947847_+|ABC-transporter-ATP-binding-protein
MPQRVKPAEQGIVLDALSAGYGQTLIVDDINLTIPTGKMTVLAGANGSGKSTLLSTIARMLKPLGGCVRLDGQAIHQMPTKTVSRQLGILPQSPLTPEGLTVFELVSRGRYPWQGLMRQWSEADELAVEEALRLTGTAEFAHLPVDSLSGGQRQRCWIAMALAQQTATILLDEPTTWLDLRYQVDILELLQTLTREHGRTVVTVLHDLNFAVNYADLLVFLKQGRIAGTISDNDVCSPELIKRVFDVDVQMSINPQTGKPFFMPFRDRQAAAQ
>CP031810.1|AXS34327.1|947843_948869_+|iron-ABC-transporter-permease
MSVAILLSARRRPRPRLALLLLTLLLIAASLVHLGLGARWIAPQTVLRALLEYDPRNFEQRIIVDLRLVRLAAALLTGAALGVAGLLLQTVIRNPLGEPHILGLNAGASLAVVATSALGLSFGAFPAGRPLTAACGAGLLFGGVMALASAGRGGATPLRITLCGVALSGFASAVTAAILILDEQTLLAMRTWLAGDLAGMNWSTLQTALVPALIGLGVALLIAPRLNVLALGDKVALGLGVNLVQTRLLGLLAIALLCGAAVAVAGPIGFVGLVVPHVVRRLVTEDIRLALPLAAPVGALALVLADIAARTLVAPQELATGAMTALVGAPLFIFIAARFFK
>CP031810.1|AXS34328.1|948865_949918_+|iron-ABC-transporter-permease
MTRAVHRAGFRPLAFASRHLLLRPAALKIAASIVLTLLALGLYSLSRGSYPLPASTLARALLAPQEMGEQPRFILFDIRLPRILMALLCGAMLGLAGAAMQSITRNGLADPGLIGVKEGASIVVLALVLFFPAVGLVWRPLAGMVGGIAVALLVLTLARDCSRPRFILIGIGVSWSLAAAVGIFMTTADVRDVQTAMIWLAGSLQAATWPLLAVAFCWALPGAIILFCTARAADVALLGDRTAIGLGVRLQQLTVLRFFAPVLLTSASVSCVGSLGFVGLMAPHMARFVLRGGQVSLLCGSALIGALLVLATDTLGRLAFAPLQIPAGIVIALVGCPFFVVLLWRRRDAL
>CP031810.1|AXS34329.1|949931_950885_+|iron-siderophore-ABC-transporter-substrate-binding-protein
MRWFVSLLLLLTGAVSAAAPQTQTFTDDLGRTVTVPLHPQRIVSMHDLDITIPLIELGAPPIASHGRTRPDGSHYLRSSAQLTGVDFDNSDIRFIGTADIDLEAVAAARPDLIITEPSRHVSVEQLEKIAPTVSIDHLQGSAPEIYRKLAQLTGTQPRLAILERRYQEQIKQLKAMVNPPQYSVSVIQANNGKVTVHHSYHALGRVLRDAGFRFPPLIERIPDGQRIDVSAEQLPELDADFVFATWRSDTGGKPQDELQAMEGVMPGWCDFMRACRTGHYILLPREEVISNSYAALSLMVAQVQSHIAGRPIPAEAK
>CP031810.1|AXS34330.1|950881_951784_+|MurR/RpiR-family-transcriptional-regulator
MKSAVKKEKGKVDLFGERYRARAHQLSPRLRAVVSYINDNREVVLEHTAMEIATATQTSDATVVRAIQALGFAGLRELKQTMERWFGTSVTSAEKMRSTVTALSSDVNSSIDFVLEGHQRVCEVLSRADNRAAVAQAVALLSDARQVGIFGIGASGILAEYTARLFSRIGLPAYVMNRTGFSLAEQLIGLQRGDVLIMMGQKSPHREGLTTLREAKRLGIPTILLTQAVDSRFSQEAQVVIDVPRGGDSSRMPLHGTVLVCLEMIVLSVASTTPQKTVKSLKRINDLHRAIGKSGGKRGH
>CP031810.1|AXS34331.1|951876_952644_+|basic-amino-acid-ABC-transporter-substrate-binding-protein
MVKNLLKACCMIAALTAAGQAAAETYTVGSGGTYRPFEFENSQKQLEGFDIDIIKAIAKAEGFDVKLVNTPWEGIFATLNTGDRDIIISGITITDKRKQMVDFSAPYFPAEQSIVVAQDSQVDSLAALKNEKVGVVNSSTGDIVVSEVLGKNSAAIKRFDNTPLMLQELFEDGVSAAVGDVGVVKYYIKQHPEKQFKLVPDAKFERQYFGIAVAKGNSELLGKINAGLQKIVADGTYAKIYKTWFDDNVPTLPAQ
>CP031810.1|AXS34332.1|952707_953472_+|amino-acid-ABC-transporter-permease
MTGFRWEIIEEYGPLFVDGALMTIKCTIICVILGTLWGLTLGLGRMAKAEHGPWKYILRYLVQFPVRFYVSAFRGTPLFVQIMVVHFALVPLFINPRDGLLVTSGLMSADFARELRASYGAFLSCIVAITLNAGAYVSEIFRAGIQSIDKGQMEASRALGMPWWKTMRKVILPQAFRRILPPLGNNAIAIVKDSSLASAIGLADLAYAARTVSGAYATYWEPYLTISLVYWVITFMLAQLVNRLEKRFGKSDSH
>CP031810.1|AXS38384.1|953458_954181_+|amino-acid-ABC-transporter-ATP-binding-protein
MIHINNLHKRFGDSHVLRGISCDIKPQEVVCIIGPSGSGKSTFLRCMNALETVSEGEVVVNGFAAHDRTTDLNKMRESVGMVFQRFNLFPHMTVLENLIMAPMNLRNMPRQQAVDLAEALLAKVGLSDKRDAWPSSLSGGQQQRVAIARALAMKPSIMLFDEPTSALDPELVGDVLEVMKNLASEGMTMVIVTHEMGFAREVADRVIFIDQGVIQEEGKPGQIFSAPTNPRTAAFLSKVL
>CP031810.1|AXS34333.1|954452_955067_+|DUF1062-domain-containing-protein
MTVTWTVTPVGYQHIAKRCPACNVKRDFAPSGAIRVNSQKKLLDIWSIYKCTRCDYTWNIALFSRLHVSKINRELLQRLLQNDAAMVHYYAADLATLKRNRAEPSGQPDFRIHEQWSVTLMACQRITVRVRVSQPFRISLLSILKKQLKLSTAEIRWLVATGHIEGIPLKQLKTKKLKAMEYHFQLAAETLYARRRITLSLCGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP031810_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP031810_3

3165919-3166013

Orphan

Consensus_repeat	Method
ACTATGGTTTTTATGGTTTTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP031810_3

>merge|CP031810|3|3165919-3166013|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATGGTTTTTATTCGCTGAACTGCCCAGGAGTGATATATCTCTGATTTATGACTGTGGTTTTTATGGTTTTTATT

>CP031810|3|2|3165919-3166013|CRISPRCasFinder
TTAATGGTCACTATGGTTTTTATG	GTTTTTATTCGCTGAACTGCCCAGGAGTGATATATCTCTGATTTATG
ACTGTGGTTTTTATGGTTTTTATT

Protein	Signature genes	Signature genes Name	Protein_function
CP031810.1\|AXS36338.1\|3168500_3169328_-\|co-chaperone-DjlA	unknown	unknown	gnl\|CDD\|236512
CP031810.1\|AXS36329.1\|3155037_3156540_+\|L-arabinose-isomerase	unknown	unknown	gnl\|CDD\|179503
CP031810.1\|AXS36336.1\|3166154_3167780_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225827
CP031810.1\|AXS36332.1\|3160093_3163000_+\|RNA-polymerase-associated-protein-RapA	unknown	unknown	gnl\|CDD\|235319
CP031810.1\|AXS36341.1\|3173266_3174256_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	unknown	unknown	gnl\|CDD\|234696
CP031810.1\|AXS36327.1\|3152134_3152980_-\|arabinose-operon-transcriptional-regulator-AraC	unknown	unknown	gnl\|CDD\|236717
CP031810.1\|AXS36331.1\|3157548_3159906_+\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
CP031810.1\|AXS36339.1\|3169571_3171920_+\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|235158
CP031810.1\|AXS36328.1\|3153317_3155027_+\|ribulokinase	unknown	unknown	gnl\|CDD\|235221
CP031810.1\|AXS36345.1\|3176458_3176641_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367296
CP031810.1\|AXS36333.1\|3163012_3163672_+\|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA	unknown	unknown	gnl\|CDD\|236659
CP031810.1\|AXS36335.1\|3164465_3165830_-\|malate-permease	unknown	unknown	gnl\|CDD\|377030
CP031810.1\|AXS36340.1\|3171974_3173261_+\|peptidylprolyl-isomerase-SurA	unknown	unknown	gnl\|CDD\|236758
CP031810.1\|AXS36343.1\|3175076_3175454_+\|Co2+/Mg2+-efflux-protein-ApaG	unknown	unknown	gnl\|CDD\|180098
CP031810.1\|AXS36342.1\|3174252_3175074_+\|ribosomal-RNA-small-subunit-methyltransferase-A	unknown	unknown	gnl\|CDD\|234708
CP031810.1\|AXS36337.1\|3167769_3168468_+\|response-regulator	unknown	unknown	gnl\|CDD\|226931
CP031810.1\|AXS36330.1\|3156677_3157373_+\|L-ribulose-5-phosphate-4-epimerase	unknown	unknown	gnl\|CDD\|236181
CP031810.1\|AXS36344.1\|3175458_3176307_+\|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)	unknown	unknown	gnl\|CDD\|273208
CP031810.1\|AXS38484.1\|3164248_3164437_+\|hypothetical-protein	unknown	unknown	unknown
CP031810.1\|AXS36334.1\|3163746_3164286_-\|citrate-lyase-holo-[acyl-carrier-protein]-synthase	unknown	unknown	gnl\|CDD\|163145

Protein	Function_ID	Function_description	E-value
CP031810.1\|AXS36329.1\|3155037_3156540_+\|L-arabinose-isomerase	gnl\|CDD\|179503	PRK02929, PRK02929, L-arabinose isomerase; Provisional.	0
CP031810.1\|AXS36336.1\|3166154_3167780_+\|sensor-histidine-kinase	gnl\|CDD\|225827	COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms].	1.7543e-172
CP031810.1\|AXS36332.1\|3160093_3163000_+\|RNA-polymerase-associated-protein-RapA	gnl\|CDD\|235319	PRK04914, PRK04914, RNA polymerase-associated protein RapA.	0
CP031810.1\|AXS36341.1\|3173266_3174256_+\|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA	gnl\|CDD\|234696	PRK00232, pdxA, 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed.	0
CP031810.1\|AXS36327.1\|3152134_3152980_-\|arabinose-operon-transcriptional-regulator-AraC	gnl\|CDD\|236717	PRK10572, PRK10572, arabinose operon transcriptional regulator AraC.	0
CP031810.1\|AXS36331.1\|3157548_3159906_+\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
CP031810.1\|AXS36339.1\|3169571_3171920_+\|LPS-assembly-protein-LptD	gnl\|CDD\|235158	PRK03761, PRK03761, LPS assembly outer membrane complex protein LptD; Provisional.	0
CP031810.1\|AXS36328.1\|3153317_3155027_+\|ribulokinase	gnl\|CDD\|235221	PRK04123, PRK04123, ribulokinase; Provisional.	0
CP031810.1\|AXS36345.1\|3176458_3176641_+\|hypothetical-protein	gnl\|CDD\|367296	pfam03014, SP2, Structural protein 2. This family represents structural protein 2 of the hepatitis E virus. The high basic amino acid content of this protein has lead to the suggestion of a role in viral genomic RNA encapsidation.	0.00461336
CP031810.1\|AXS36333.1\|3163012_3163672_+\|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA	gnl\|CDD\|236659	PRK10158, PRK10158, bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA.	2.4454e-161
CP031810.1\|AXS36335.1\|3164465_3165830_-\|malate-permease	gnl\|CDD\|377030	pfam03390, 2HCT, 2-hydroxycarboxylate transporter family. The 2-hydroxycarboxylate transporter family is a family of secondary transporters found exclusively in the bacterial kingdom. They function in the metabolism of the di- and tricarboxylates malate and citrate, mostly in fermentative pathways involving decarboxylation of malate or oxaloacetate.	4.87969e-169
CP031810.1\|AXS36340.1\|3171974_3173261_+\|peptidylprolyl-isomerase-SurA	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	0
CP031810.1\|AXS36343.1\|3175076_3175454_+\|Co2+/Mg2+-efflux-protein-ApaG	gnl\|CDD\|180098	PRK05461, apaG, CO2+/MG2+ efflux protein ApaG; Reviewed.	7.84855e-74
CP031810.1\|AXS36342.1\|3174252_3175074_+\|ribosomal-RNA-small-subunit-methyltransferase-A	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	3.65731e-147
CP031810.1\|AXS36337.1\|3167769_3168468_+\|response-regulator	gnl\|CDD\|226931	COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms].	5.03078e-66
CP031810.1\|AXS36330.1\|3156677_3157373_+\|L-ribulose-5-phosphate-4-epimerase	gnl\|CDD\|236181	PRK08193, araD, L-ribulose-5-phosphate 4-epimerase AraD.	0
CP031810.1\|AXS36344.1\|3175458_3176307_+\|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)	gnl\|CDD\|273208	TIGR00668, Bis5'-nucleosyl-tetraphosphatase_symmetrical, bis(5'-nucleosyl)-tetraphosphatase (symmetrical). Diadenosine 5',5"'-P1,P4-tetraphosphate (Ap4A) is a regulatory metabolite of stress conditions. It is hydrolyzed to two ADP by this enzyme. Alternate names include diadenosine-tetraphosphatase and Ap4A hydrolase. [Cellular processes, Adaptations to atypical conditions].	0
CP031810.1\|AXS36338.1\|3168500_3169328_-\|co-chaperone-DjlA	gnl\|CDD\|236512	PRK09430, djlA, co-chaperone DjlA.	2.63694e-164
CP031810.1\|AXS36334.1\|3163746_3164286_-\|citrate-lyase-holo-[acyl-carrier-protein]-synthase	gnl\|CDD\|163145	TIGR03124, citrate_citX, holo-ACP synthase CitX. Members of this protein family are the CitX protein, or CitX domain of the CitXG bifunctional protein, of the citrate lyase system. CitX transfers the prosthetic group 2'-(5''-triphosphoribosyl)-3'-dephospho-CoA to the citrate lyase gamma chain, an acyl carrier protein. This enzyme may be designated holo-ACP synthase, holo-citrate lyase synthase, or apo-citrate lyase phosphoribosyl-dephospho-CoA transferase. In a few genera, including Haemophilus, this protein occurs as a fusion protein with CitG (2.7.8.25), an enzyme involved in prosthetic group biosynthesis. This CitX family is easily separated from the holo-ACP synthases of other enzyme systems. [Energy metabolism, Fermentation, Protein fate, Protein modification and repair].	1.64069e-84

>CP031810.1|AXS36335.1|3164465_3165830_-|malate-permease
MSTTDNAFSATLEPIDTPKTTLKQRWWHIMDNWKVGIVPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGKRLPVLGKLGAAAICATFIPSALVHYGLLPDVVIESTTKFYKSTNILYLYICCIIVGSIMSMNRTTLIQGFLKIFFPMLCGEVVGMLVGIGVGTLLGMEPFQVFFFIVLPIMAGGVGEGAIPLSMGYAALMHMEQGVALGRVLPMVMLGSLTAIVISGCLNQLGKRFPHLTGEGQLMPNRSHETRSLSESEGVSGKTDVGTLASGALLAVLLYMMGMLGHKLIGLPAPVGMLFLAVLLKLANVVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIVSTVSALVATGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTAGNRMSLMPFAQIATRIGGAINVSLGLLFLSHYLA
>CP031810.1|AXS38484.1|3164248_3164437_+|hypothetical-protein
MLTPAWAGVSTDINSSPTYDKYDSAWTVMMMVAIADRALIVTLNAEHLGYRTQIFSAFCSGK
>CP031810.1|AXS36334.1|3163746_3164286_-|citrate-lyase-holo-[acyl-carrier-protein]-synthase
MSVDTPAQAGVSIEALLAAKEQRAARQADWLAHYQQPVISLTLVTPGAVKDSIRYRNMMGVALQACDQLLWKHRWQTLDRQVLWLPTGPEALWCVAHPASEIKAMCSTLEQIHPLGRLWDIDVICPQNGLVGRQSLGESQRRCLLCDEPAHACARSRRHDTDLVVARVEQMIDAWFARD
>CP031810.1|AXS36333.1|3163012_3163672_+|bifunctional-tRNA-pseudouridine(32)-synthase/23S-rRNA-pseudouridine(746)-synthase-RluA
MAMENYNPPQDPWLVILYQDEHIMVVNKPSGLLSVPGRLEEHKDSVMTRIQRDFPQAESVHRLDMATSGVIVVALNKAAERELKRQFREREPKKQYVARVWGHPQPAEGLVDLPLICDWPNRPKQKVCYETGKAAQTEYEVLEYAEDNTARVRLKPITGRSHQLRVHMLALGHPILGDRFYATPEALAMAPRLLLHAETLTITHPAYGNAMTFRAPIDF
>CP031810.1|AXS36332.1|3160093_3163000_+|RNA-polymerase-associated-protein-RapA
MPFTLGQRWISDTESELGLGTVVALDARMVTLLFPAIGENRLYSRNDSPITRVMFNPGDTITSHEGWQLHVDKVNEENGLLSYTGTRLDTQEANVTLREVLLDSKLVFSKPQDRLFAGQIDRMDRFALRYRARKFQSEQYRMPWSGLRGQRTSLIPHQLHIAHDVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIVVPETLQHQWLVEMLRRFNLRFSLFDDERYAEAQHDAYNPFETEQLVICSLDFVRRSKQRLEHLCDAEWDLMVVDEAHHLVWSEEAPSREYQAIEQLAERVPGILLLTATPEQLGMESHFARLRLLDPNRFHDFEQFVEEQQNYRPVADAVALLLAGNKLSDSELNTLGDLIGEQDIEPLLQAANSDREDAQAARQELISMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIRLPLPTQYQTAIKVSGIMGARKTAEERARDMLYPEQIYQEFEGDTGTWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATALQLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFASNLVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHTCPTGRTVYDSVHDELINYLAAPESTDGFDDLIKSCRQQHDALKAQLEQGRDRLLEIHSNGGEKAQALAESIEEQDDDTSLIAFSMNLFDIVGINQDDRGENLIVLTPSDHMLVPDFPGLPEDGCTITFERDVALSREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVGTLLLELIYVVEAQAPKQLQLNRFLPATPVRMLLDKNGNNLAAQVEFESFNRQLSAVNRHTGSKLVNAVQQDVHAILQQGEAQIAKAAQGLIDAARNEADEKLTAELSRLEALKAVNPNIRDDELAAIESNRQQVMDALAQAGWRLDALRLIVVTHQ
>CP031810.1|AXS36331.1|3157548_3159906_+|DNA-polymerase-II
MTQPRAGFLLTRHWRDTPQGTELSFWLATDDGPLQVTLPPQESVAFIPEAQRAQAERLLQGEKGLRFAPLALKDFHRQPIVGLYCRAHRQLMRLEKMLRDSGVTVYEGDIRPPERYLMERFITAPVWVEGETRGSQLVNARMKPNPDYRPPLKWVSLDIETSRHGELYCIGLEGCGQRVVYMLGPEPETPPDVDFELVFTASRPLLLEKLNAWFAEHDPDVLIGWNVVQFDLRVLQKHAERYRIPLRLGRGNSELEWREHGFKNGVFFAQANGRLIIDGIDALKSAFWNFSSFSLEAVARELLGEGKAIDNPWDRMDEIDRRFHEDKPALAIYNLQDCELVTRIFHKTEIMPFLLERATVNGLPADRHGGSVAAFSHLYFPRMHRLGYVAPNLGDVPPQASPGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGLAQPDDQHSIEGFLGARFSRDKHCLPGIVSQIWHGRDEAKRQHNKPLSQALKIIMNAFYGVLGTSACRFFDPRLASSITMRGHAIMRQTKALIEAKGYDVIYGDTDSTFVWLKRPHSEAQAAEIGRELVSDVNAWWAQELSKSQLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGMIQEGDAQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNQPYQDYVRETIARLMNGELDEQLVYRKRLRRPLAEYQRNVPPHVRAARLADEHNLKLGRAQQYQQRGTIKYVWTTSGPEPVDYQQSPLDYDHYLTKQLQPVAEGILPFVNDDFATIVTGQLGLF
>CP031810.1|AXS36330.1|3156677_3157373_+|L-ribulose-5-phosphate-4-epimerase
MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDREKGVFVIKPSGVDYRVMTADDMVVVSLESGEVVEGNKKPSSDTPTHRLLYQAFPTLGGIVHTHSRHATIWAQAGQSIPATGTTHADYFYGPVPCTRLMTDAEINGDYEWETGNVIVETFRQQGIDPAQMPGVLVHSHGPFAWGKNAEDAVHNAIVLEEIAYMGIFCRQLAPQLPAMQQTLLDKHYLRKHGAKAYYGQ
>CP031810.1|AXS36329.1|3155037_3156540_+|L-arabinose-isomerase
MTIFDNYEVWFVIGSQHLYGPEALRQVTKHAEHMVNSLNAEAKLPCKLVLKPLGTTPDEITHICRDANYDDKCAGLVVWLHTFSPAKMWINGLTILNKPLLQFHTQYNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHSVVTGHWQDKEAHQRIGGWMRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSISDGDISALVDEYESSYRLTPAAQVHGEKRQNVLDAARIELGMKRFLEQGGFHAFTTTFEDLHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFDNGNDLVLGSHMLEVCPTIATAEKPILDVQPLGIGGKADPARLIFNTQTGPAIVASLIDLGDRFRLLVNTIETVPTPHDLPKLPVANALWKAQPDLRTASEAWIIAGGAHHTVFSHALNLDDMRQFAELHDIELTVIDNDTRLPSFKDALRWNEVYYGSKR
>CP031810.1|AXS36328.1|3153317_3155027_+|ribulokinase
MAIAIGLDFGSDSVRALAVECASGAELATSVEWYPRWREGQYCDGANNRFRHHPRDYIESMEAALKSVLASLSAEQRADVVGIGVDSTGSTPAPVDAEGNVLALREEFADNPNAMFVLWKDHTAVEEAEAITRLCHQPGKEDYSRYIGGIYSSEWFWAKILHVTREDSAVAQAAASWVELCDWVPALLSGTTRPQDLRRGRCSAGHKSLWHESWGGLPPASFFDELDPIINQHLAWPLFTDTWTADVPVGTLSAEWAQRLGLSQSVAISGGAFDCHMGAVGAGAQPNALVKVIGTSTCDILIADKESVGERTVKGICGQVDGSVVPHFIGMEAGQSAFGDIYAWFGRILGWPLEQLAQQQPALREQIKASQKQLLPALTEAWANNPSLEHLPVVLDWFNGRRTPNANQRLKGVITDLNLATDAPALFGGLIAATAFGARAIMECFTEQGIPVNNVMALGGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAGVYDDIPAAQQRMASQVETTLQPRPAQAQRFEQLYQRYQQWSVSAEQHYLPSAAKAEKAPQSQAALTH
>CP031810.1|AXS36327.1|3152134_3152980_-|arabinose-operon-transcriptional-regulator-AraC
MAETQNDPLLPGYSFNAHLVTGLTPIEAQGYLDFFIDRPLGMKGYILNLTIRGEGVINNHGEQFVCRPGDMLLFPPGEIHHYGRHPDASEWYHQWVYFRPRAYWHEWLNWPTIFAQTGFFRPDEQWQARFGELFGQIVDAGQGAGRYSELLAINLLEQLLLRRMEAINESLHPPLDNRVRDACQYISDHLADSHFDIASVAQHVCLSPSRLSHLFRQQLGVSVLGWREDQRISQAKLLLSTTRMPIATVGRNVGFEDQLYFSRVFKKCTGASPSEFRAGCE
>CP031810.1|AXS36336.1|3166154_3167780_+|sensor-histidine-kinase
MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAKIQAEEIALMPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHPEWVGTRLVGGDNQAVLEGKSITTIRKGGLGVSQRSKTPIVDDAGRVIGIVSVGYLTSYLDSITLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSLEPREIGLLVRQQKAMMESIFEGVIVIDRQRRIEVINHAARSLLGLSQPARQLRGQSIDSVISPQPFFASGDMLERDTHDELCRFNQLTVLASRVRIMLENTLQGWVITFRDRNEINALTAQLSQVKRYVDNLRIMRHEQLNRMTTLSGLLHMGHYDEAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREKGVALSFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAELPHEPVEVLIQLNARELIIEVADRGVGIRPDIRERIFERGVTTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPRGTIFTLFIPADAHACPQPEAHDAS
>CP031810.1|AXS36337.1|3167769_3168468_+|response-regulator
MHHDLVDVLIIEDESELARLHAELVQKHPRLRLAGMAASLAQARQLLHATPPQLVLLDNYLPDGKGVTLMTDPALATSQCSVIFITAASDMETCSQAIRNGAFDYILKPVSWKRLSQSLERFIQFYDQQREWKIVDQQNVDSLYQLQAKNYRVDSGSKGIEEKTLALVQGLFSDREAHCFSVDEVVSAAGLSKTTARRYLEHGVETGFLEVEMLYGKIGHPRRLYRRAKVKS
>CP031810.1|AXS36338.1|3168500_3169328_-|co-chaperone-DjlA
MQYLGKVIGVAVALLMGGGFWGVVLGFLVGHMFDRARSRRLNLFANQQERQSLFFSTTFEVMGHLTKSKGRVTEADIHVANVLMDRMNLHGASRTAAQQAFRDGKADNYPLREKMRQLRSVCFGRFDLIRMFLEIQLQAAFADGELHPNEREVLFVIADELGISRAQFDQFLRMMQGGAQFGGGSQQRSYGQHGGNAGWQQAQRGPTLEDACNVLGVKPTDDAATVKRAYRKLMNEHHPDKLVAKGLPPEMMEMAKQKAQEIQKAWELIKEQRGF
>CP031810.1|AXS36339.1|3169571_3171920_+|LPS-assembly-protein-LptD
MKKRIPSLLATMIASALYSQQGLAADLATQCMLGVPSYDRPLVEGRPGDLPVTINADHAKGNYPDNAVFTGNVDINQGNSRLRADEVQLHQQQAAGQAQPVRTVDALGNVHYDDNQVILKGPKAWSNLNTKDTNVWQGDYQMVGRQGRGTADLMKQRGENRYTILENGSFTSCLPGSDTWSVVGSEVIHDREEQVAEIWNARFKLGSVPIFYSPYLQLPVGDKRRSGFLIPNAKYSTKNGVEFSLPYYWNIAPNFDATITPHYMNKRGGVMWENEFRYLTQLGSGLTEFDYLPSDKVYEDDHSSDSNSRRWLFYWNHSGVIDQVWRLNADYTKVSDPDYFNDFSSKYGSSTDGYATQKFSAGYVNQNFDATVSTKQFQVFDRESSNSYSAEPQLDVNYYQNDVGPFDTHLYGQVAHFVNSNNNMPEATRVHFEPTINLPLSNGWGSLNTEAKLLATHYQQSNLDKYNAANGTDYKESVSRVMPQFKVDGKMVFERDLQEGFTQTLEPRVQYLYVPYRDQSEIGNYDSTLLQSDYTGLFRDRTYSGLDRIASANQVTTGLTSRVYDAAAVERFNISVGQIYYFTESRTGDDNINWENNDTTGSLVWAGDTYWRIADEWGLRGGIQYDTRLDNVATGNGTIEYRRDENRLVQLNYRYASPEYIQATLPSYSTAAQYKQGISQVGMTASWPIVDRWSVVGAYYYDTNTRKAANQMLGVQYNSCCYAIRLGYERKVNGWNSNDNGGESKYDNTFGINIELRGLSSNYGLGTQQMLRSNILPYQSSL
>CP031810.1|AXS36340.1|3171974_3173261_+|peptidylprolyl-isomerase-SurA
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQLPDDATLRHQILERLIMDQIVLQMGQKMGVKISDDQLDQAIANIAKQNNMTLDQMRSRLAYEGINYNTYRNQIRKEMLISEVRNNEVRRRITVLPQEVEALAKQIGDQNDASTELNLSHILIPLPENPTSDEVAAAQEQANSIVEQARNGANFGKLAITYSADQQALKGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGGTQNISVTEVHARHILLKPSPIMNDAQAQAKLEQIAAEIKSGKITFAQAAKTYSEDPGSANQGGDLGWATPDIFDPAFRDALMRLNKGQTSGPVHSSFGWHLIELLDSRQVDRTDAAQKDRAYRMLMNRKFSEEAATWMQEQRASAYVKILSN
>CP031810.1|AXS36341.1|3173266_3174256_+|4-hydroxythreonine-4-phosphate-dehydrogenase-PdxA
MPETRKVVITPGEPAGIGPDLVVQLAQRDWPAELVICADGALLTDRAKRLGLPLSLLPYDPAQPPVPQRAGTLTLLNVPLNVPAEPGVLNVQNGAYVVETLARACDGCLSGEFAALVTGPVHKGNINDAGIAFTGHTEFFEERAKASKVVMMLATEELRVALVTTHLPLKAISEAITPELLREIITILDHDLRTKFGIAQPHVLVCGLNPHAGEGGHMGTEEIDTIIPVLEEMRAKGMNLSGPLPADTLFQPKYLDHADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGQGKADVGSFITALNLAIKMIVNTQ
>CP031810.1|AXS36342.1|3174252_3175074_+|ribosomal-RNA-small-subunit-methyltransferase-A
MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTMNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCQVIPVLEVPPSAFTPPPKVDSAVVRLVPHSTMPYPVKEIRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTELGIDPAMRAENISVAQYCLMANWLSDNLPTKES
>CP031810.1|AXS36343.1|3175076_3175454_+|Co2+/Mg2+-efflux-protein-ApaG
MIHSPRVCVQVQSVYIESQSSPEEERYVFAYTVTIRNLGRSQVQLLGRYWLITNGHGRETEVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYEMIDIDGAPFRIEIPVFRLAVPTLIH
>CP031810.1|AXS36344.1|3175458_3176307_+|bis(5'-nucleosyl)-tetraphosphatase-(symmetrical)
MSTYLIGDVHGCYDELIALLAQVEFDPRRDTLWLTGDLVARGPGSLEVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLKPLLEAPDADELLNWLRRQPLLQVDEEKKLVMAHAGITPQWDLETAQQCARDVEAVLSSDSYPFFLDAMYGDMPNHWSNELSGLARLRFISNAFTRMRYCFPNGQLDMYSKEAPEDAPAPLKPWFAIPGPVSNAYSIAFGHWASLEGRGTPEGIYALDTGCCWGGELTCLRWEDKQYFTQPSNRQKSLDEGEAVAS
>CP031810.1|AXS36345.1|3176458_3176641_+|hypothetical-protein
MTQSRRPAQAQRRRARTAGAEPLLCRVAANALPDLRLCAICRSGECFRKKTKPATGNMTR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP031810.1	2061026-2061054	0	1.0
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP031810.1	2061134-2061162	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP031810.1	2062175-2062203	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP031810.1	2061116-2061144	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP031810.1	2061152-2061180	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP031810.1	2061188-2061216	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP031810.1	2061224-2061252	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP031810.1	2061242-2061270	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP031810.1	2061152-2061180	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP031810.1	2061188-2061216	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP031810.1	2062175-2062203	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP031810.1	2061098-2061126	2	0.931

1. spacer 2.51|2066231|29|CP031810|CRT matches to position: 2061026-2061054, mismatch: 0, identity: 1.0

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggagtcgctgtccgagtcagagtcg	Protospacer
*****************************

2. spacer 2.26|2064575|29|CP031810|CRT matches to position: 2061134-2061162, mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgaatcg	Protospacer
*******************.*********

3. spacer 2.26|2064575|29|CP031810|CRT matches to position: 2062175-2062203, mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcggaatccgaatcg	Protospacer
**** ************************

4. spacer 2.26|2064575|29|CP031810|CRT matches to position: 2061116-2061144, mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtcg	Protospacer
*******************.*****.***

5. spacer 2.26|2064575|29|CP031810|CRT matches to position: 2061152-2061180, mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatccgagtcg	Protospacer
*******.*****************.***

6. spacer 2.26|2064575|29|CP031810|CRT matches to position: 2061188-2061216, mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
****************.********.***

7. spacer 2.26|2064575|29|CP031810|CRT matches to position: 2061224-2061252, mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctatcggaatccgaatcg	Protospacer
**** ********.***************

8. spacer 2.34|2065091|29|CP031810|CRT matches to position: 2061242-2061270, mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatcggagtcg	Protospacer
********************** **.***

9. spacer 2.47|2066015|29|CP031810|CRT matches to position: 2061152-2061180, mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

10. spacer 2.47|2066015|29|CP031810|CRT matches to position: 2061188-2061216, mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

11. spacer 2.48|2066069|29|CP031810|CRT matches to position: 2062175-2062203, mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcggaatccgaatcg	Protospacer
*******.********.************

12. spacer 2.51|2066231|29|CP031810|CRT matches to position: 2061098-2061126, mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggagtcgctgtcggagtccgagtcg	Protospacer
**************** ***** ******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153915-153943	0	1.0
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1062-1090	0	1.0
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151752-151780	0	1.0
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151770-151798	0	1.0
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3366-3412	0	1.0
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1566-1594	0	1.0
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154527-154555	0	1.0
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154797-154825	0	1.0
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155013-155041	0	1.0
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155247-155275	0	1.0
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154419-154447	0	1.0
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2412-2440	0	1.0
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3714-3742	0	1.0
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3768-3796	0	1.0
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153387-153433	1	0.979
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3612-3652	1	0.976
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151782-151816	1	0.971
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157551-157585	1	0.971
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153813-153841	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154419-154447	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156087-156115	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156561-156589	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156663-156691	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1722-1750	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2280-2308	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2358-2386	1	0.966
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2412-2440	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151374-151402	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151734-151762	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154761-154789	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155157-155185	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155211-155239	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155391-155419	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157539-157567	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1116-1144	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1278-1306	1	0.966
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2862-2890	1	0.966
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1206-1234	1	0.966
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157197-157243	1	0.979
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151518-151546	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151554-151582	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151590-151618	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154065-154093	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156945-156973	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151626-151654	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153897-153925	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154779-154807	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154995-155023	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155175-155203	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155229-155257	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155409-155437	1	0.966
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3282-3310	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151788-151816	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151956-151984	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153621-153649	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154419-154447	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154653-154681	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156561-156589	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157557-157585	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2376-2404	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2412-2440	1	0.966
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3630-3658	1	0.966
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3102-3148	1	0.979
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3678-3724	1	0.979
CP031810_2	2.39\|2065481\|59\|CP031810\|CRT	2065481-2065539	59	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3354-3412	1	0.983
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157323-157369	1	0.979
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1260-1288	1	0.966
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3102-3130	1	0.966
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1002-1036	1	0.971
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154227-154255	1	0.966
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154245-154273	1	0.966
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154401-154429	1	0.966
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156849-156877	1	0.966
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157017-157045	1	0.966
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157153	1	0.966
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153861-153889	1	0.966
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154401-154429	1	0.966
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155193-155221	1	0.966
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155427-155455	1	0.966
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1134-1162	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151734-151762	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151752-151780	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151770-151798	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153915-153943	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154227-154255	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154245-154273	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154599-154627	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154635-154663	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154869-154897	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155031-155059	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155067-155095	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155265-155293	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155301-155329	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155583-155611	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155619-155647	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155655-155683	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156849-156877	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157017-157045	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157153	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157539-157567	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1602-1630	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3534-3562	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1062-1090	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1278-1306	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2244-2272	1	0.966
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3012-3040	1	0.966
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151283-151311	1	0.966
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154419-154447	1	0.966
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1098-1126	1	0.966
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2244-2272	1	0.966
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2412-2440	1	0.966
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3300-3328	1	0.966
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153261-153289	1	0.966
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153741-153769	1	0.966
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1662-1690	1	0.966
CP031810_2	2.11\|2063351\|47\|CP031810\|CRT	2063351-2063397	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154779-154825	2	0.957
CP031810_2	2.11\|2063351\|47\|CP031810\|CRT	2063351-2063397	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154995-155041	2	0.957
CP031810_2	2.11\|2063351\|47\|CP031810\|CRT	2063351-2063397	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155229-155275	2	0.957
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157215-157261	2	0.957
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154977-155023	2	0.957
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1584-1624	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1680-1720	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1872-1912	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2712-2752	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153549-153589	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151716-151756	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151734-151774	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153369-153409	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153423-153463	2	0.951
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154959-154999	2	0.951
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154431-154465	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151746-151780	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151764-151798	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153435-153469	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154239-154273	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154377-154411	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154611-154645	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154845-154879	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155595-155629	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155631-155665	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155829-155863	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157137-157171	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1110-1144	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1020-1054	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2970-3004	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	27-61	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1074-1108	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1290-1324	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1848-1882	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1902-1936	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2064-2098	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2424-2458	2	0.943
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2688-2722	2	0.943
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151662-151702	2	0.951
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157323-157363	2	0.951
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1350-1390	2	0.951
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151319-151347	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151734-151762	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151752-151780	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151770-151798	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151920-151948	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154227-154255	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154245-154273	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154365-154393	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154527-154555	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154599-154627	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154635-154663	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154797-154825	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154869-154897	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155013-155041	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155031-155059	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155067-155095	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155247-155275	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155265-155293	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155301-155329	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155511-155539	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155583-155611	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155619-155647	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155655-155683	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156291-156319	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156453-156481	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156849-156877	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157017-157045	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157153	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157539-157567	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1548-1576	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1602-1630	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3534-3562	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1026-1054	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1278-1306	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1620-1648	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1890-1918	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1962-1990	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2244-2272	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2676-2704	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3012-3040	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3138-3166	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3552-3580	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3678-3706	2	0.931
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	990-1018	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151680-151708	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153315-153343	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154311-154339	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156399-156427	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157341-157369	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151283-151311	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151410-151438	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151446-151474	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151956-151984	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152997-153025	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153177-153205	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153195-153223	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153297-153325	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153369-153397	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153423-153451	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153621-153649	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153657-153685	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153675-153703	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153813-153841	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154419-154447	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154635-154663	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154689-154717	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154707-154735	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154869-154897	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154905-154933	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154959-154987	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155049-155077	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155067-155095	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155103-155131	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155283-155311	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155301-155329	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155337-155365	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155817-155845	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155925-155953	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156087-156115	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156813-156841	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156831-156859	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156927-156955	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156981-157009	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156999-157027	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157251-157279	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157467-157495	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	990-1018	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2358-2386	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2394-2422	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2412-2440	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2640-2668	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2994-3022	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3456-3484	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3612-3640	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1062-1090	2	0.931
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1098-1126	2	0.931
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151644-151690	2	0.957
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151698-151744	2	0.957
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153333-153379	2	0.957
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157521-157567	2	0.957
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153279-153307	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153531-153559	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153759-153787	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156759-156787	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156909-156937	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157323-157351	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157611-157639	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21111-21139	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1224-1252	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1350-1378	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1926-1954	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1980-2008	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3246-3274	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3318-3346	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3594-3622	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3648-3676	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3768-3796	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9669-9697	2	0.931
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9975-10003	2	0.931
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153291-153325	2	0.943
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3258-3292	2	0.943
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3510-3544	2	0.943
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151410-151438	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153531-153559	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155049-155077	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155283-155311	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156813-156841	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156981-157009	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151680-151708	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151866-151894	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153315-153343	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154347-154375	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154725-154753	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154923-154951	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155121-155149	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155355-155383	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155445-155473	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156225-156253	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156399-156427	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157341-157369	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	990-1018	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1224-1252	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1854-1882	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2394-2422	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1044-1072	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2658-2686	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2772-2800	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3120-3148	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1062-1090	2	0.931
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1116-1144	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154833-154861	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155799-155827	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151446-151474	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151464-151492	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151734-151762	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151848-151876	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151938-151966	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151974-152002	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153195-153223	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153387-153415	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153441-153469	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153513-153541	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153639-153667	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153915-153943	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153957-153985	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154173-154201	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154227-154255	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154245-154273	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154599-154627	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154617-154645	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154635-154663	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154671-154699	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154851-154879	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154869-154897	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154887-154915	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154977-155005	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155031-155059	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155067-155095	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155085-155113	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155265-155293	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155301-155329	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155319-155347	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155583-155611	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155601-155629	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155619-155647	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155637-155665	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155655-155683	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155817-155845	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155835-155863	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155925-155953	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155943-155971	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156471-156499	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156489-156517	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156507-156535	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156849-156877	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157017-157045	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157153	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157539-157567	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1602-1630	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3156-3184	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3474-3502	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3534-3562	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1062-1090	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1080-1108	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1278-1306	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1620-1648	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1836-1864	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1890-1918	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1908-1936	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2244-2272	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2676-2704	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3012-3040	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3552-3580	2	0.931
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1008-1036	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2772-2800	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	33-61	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1152-1180	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1224-1252	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1332-1360	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1494-1522	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1854-1882	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2106-2134	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2430-2458	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2616-2644	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2694-2722	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3246-3274	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3366-3394	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3492-3520	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153531-153559	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154473-154501	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154743-154771	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154941-154969	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155139-155167	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155373-155401	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156609-156637	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157305-157333	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157431-157459	2	0.931
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157593-157621	2	0.931
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153237-153271	2	0.943
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153717-153751	2	0.943
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157575-157603	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151283-151311	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151788-151816	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152997-153025	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153657-153685	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153675-153703	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154419-154447	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154527-154555	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154797-154825	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155013-155041	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155247-155275	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156831-156859	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156999-157027	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157071-157099	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157143-157171	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157251-157279	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157467-157495	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157485-157513	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157557-157585	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1758-1786	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1584-1612	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1800-1828	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2244-2272	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2412-2440	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2994-3022	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1008-1036	2	0.931
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1098-1126	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151644-151672	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151698-151726	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153915-153943	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154227-154255	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154245-154273	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154365-154393	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155511-155539	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155733-155761	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156135-156163	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156291-156319	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156453-156481	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156699-156727	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156849-156877	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157017-157045	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157071-157099	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157153	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157521-157549	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1008-1036	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1062-1090	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1386-1414	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1584-1612	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2016-2044	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2244-2272	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2676-2704	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2790-2818	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3138-3166	2	0.931
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3678-3706	2	0.931
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155193-155233	2	0.951
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151608-151648	2	0.951
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151662-151702	2	0.951
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157323-157363	2	0.951
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3264-3304	2	0.951
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153141-153169	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157575-157603	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151283-151311	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151392-151420	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151428-151456	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151500-151528	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151788-151816	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151956-151984	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152997-153025	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153105-153133	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153177-153205	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153423-153451	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153459-153487	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153621-153649	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153657-153685	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153675-153703	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153813-153841	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153879-153907	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154401-154429	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154653-154681	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156087-156115	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156561-156589	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156663-156691	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156831-156859	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156927-156955	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156999-157027	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157143-157171	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157251-157279	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157467-157495	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157485-157513	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157557-157585	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157629-157657	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1758-1786	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1722-1750	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2034-2062	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2280-2308	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2358-2386	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2376-2404	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3612-3640	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3630-3658	2	0.931
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1098-1126	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151319-151347	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151734-151762	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151752-151780	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151770-151798	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151920-151948	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153915-153943	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154227-154255	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154245-154273	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154401-154429	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154599-154627	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154635-154663	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154869-154897	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155031-155059	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155067-155095	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155265-155293	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155301-155329	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155583-155611	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155619-155647	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155655-155683	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156849-156877	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157017-157045	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157153	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157539-157567	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157629-157657	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1044-1072	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	15-43	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1602-1630	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2088-2116	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3534-3562	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1062-1090	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1278-1306	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1680-1708	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2490-2518	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3012-3040	2	0.931
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3612-3640	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528971-528999	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528977-529005	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528983-529011	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528989-529017	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4658-4686	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518234-518262	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518240-518268	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518246-518274	2	0.931
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518252-518280	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3402-3430	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156015-156043	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151608-151636	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153333-153361	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154011-154039	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154155-154183	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154365-154393	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155529-155557	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156453-156481	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156741-156769	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156891-156919	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157161-157189	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157305-157333	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157593-157621	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21093-21121	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15480-15508	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15588-15616	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15714-15742	2	0.931
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9651-9679	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1350-1378	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1404-1432	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1512-1540	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1926-1954	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1980-2008	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2124-2152	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2562-2590	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3264-3292	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3402-3430	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3516-3544	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3594-3622	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16664-16692	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17834-17862	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19316-19344	2	0.931
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1080-1108	2	0.931
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153405-153451	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153423-153469	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153495-153541	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153513-153559	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155655-155701	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155925-155971	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155943-155989	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1080-1126	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1680-1726	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1890-1936	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2172-2218	3	0.936
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3630-3676	3	0.936
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154293-154333	3	0.927
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153123-153163	3	0.927
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153387-153427	3	0.927
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153405-153445	3	0.927
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153495-153535	3	0.927
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156909-156949	3	0.927
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151331-151365	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154989-155023	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157029-157063	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157083-157117	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157569-157603	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1038-1072	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2256-2290	3	0.914
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3150-3184	3	0.914
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153351-153391	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153405-153445	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153297-153337	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157251-157291	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1296-1336	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2898-2938	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2976-3016	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3438-3478	3	0.927
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1800-1840	3	0.927
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153405-153451	3	0.936
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155943-155989	3	0.936
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1080-1126	3	0.936
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153141-153169	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156327-156355	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156543-156571	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157575-157603	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151788-151816	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151956-151984	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153621-153649	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153861-153889	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154653-154681	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157197-157225	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157557-157585	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1758-1786	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3048-3076	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1494-1522	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2376-2404	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3366-3394	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3630-3658	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1134-1162	3	0.897
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1152-1180	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151626-151654	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153777-153805	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153897-153925	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156051-156079	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157413-157441	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157503-157531	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151241-151269	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151482-151510	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151518-151546	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151554-151582	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151590-151618	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151752-151780	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151770-151798	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151848-151876	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151974-152002	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152028-152056	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153159-153187	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153387-153415	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153441-153469	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153477-153505	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153495-153523	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153513-153541	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153639-153667	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153957-153985	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154065-154093	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154173-154201	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154617-154645	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154653-154681	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154671-154699	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154851-154879	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154887-154915	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154977-155005	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155085-155113	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155319-155347	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155547-155575	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155565-155593	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155601-155629	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155637-155665	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156207-156235	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156945-156973	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	15-43	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1242-1270	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1314-1342	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1476-1504	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1548-1576	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1602-1630	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2172-2200	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2598-2626	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2826-2854	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3282-3310	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3348-3376	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3534-3562	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1620-1648	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1836-1864	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1890-1918	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2298-2326	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3192-3220	3	0.897
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3552-3580	3	0.897
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	51-79	3	0.897
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2712-2740	3	0.897
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3420-3448	3	0.897
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	15-43	3	0.897
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155013-155059	3	0.936
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155193-155239	3	0.936
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155247-155293	3	0.936
CP031810_2	2.28\|2064683\|47\|CP031810\|CRT	2064683-2064729	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3300-3346	3	0.936
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151992-152020	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153567-153595	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153585-153613	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154029-154057	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155871-155899	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155889-155917	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156681-156709	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157287-157315	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1458-1486	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3438-3466	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1422-1450	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1662-1690	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2916-2944	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3264-3292	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3516-3544	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3750-3778	3	0.897
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	954-982	3	0.897
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153771-153805	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156045-156079	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151530-151564	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151566-151600	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153273-153307	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153543-153577	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153753-153787	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154755-154789	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155151-155185	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155385-155419	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155727-155761	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156753-156787	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156903-156937	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156957-156991	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157317-157351	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157443-157477	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2820-2854	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1578-1612	3	0.914
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2802-2836	3	0.914
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154101-154129	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154137-154165	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151241-151269	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151374-151402	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151482-151510	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153159-153187	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153441-153469	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153639-153667	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153957-153985	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153993-154021	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154173-154201	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154509-154537	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154617-154645	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154851-154879	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155565-155593	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155601-155629	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155637-155665	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155835-155863	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155997-156025	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156171-156199	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156207-156235	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156723-156751	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156777-156805	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156873-156901	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157611-157639	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153777-153805	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156051-156079	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156627-156655	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157413-157441	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157503-157531	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1116-1144	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2226-2254	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2298-2326	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3648-3676	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2826-2854	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3384-3412	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3696-3724	3	0.897
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	954-982	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152046-152074	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153141-153169	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156543-156571	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157575-157603	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151283-151311	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151392-151420	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151428-151456	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151500-151528	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152997-153025	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153105-153133	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153177-153205	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153423-153451	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153459-153487	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153657-153685	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153675-153703	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153813-153841	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153879-153907	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154401-154429	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156087-156115	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156663-156691	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156831-156859	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156927-156955	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156999-157027	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157143-157171	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157251-157279	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157467-157495	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157485-157513	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157629-157657	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1044-1072	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1740-1768	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1758-1786	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2262-2290	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2508-2536	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2658-2686	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1722-1750	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2034-2062	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2280-2308	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2358-2386	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3612-3640	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1116-1144	3	0.897
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1098-1126	3	0.897
CP031810_2	2.35\|2065145\|47\|CP031810\|CRT	2065145-2065191	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157287-157333	3	0.936
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1740-1786	3	0.936
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155493-155539	3	0.936
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156273-156319	3	0.936
CP031810_2	2.39\|2065481\|59\|CP031810\|CRT	2065481-2065539	59	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1248-1306	3	0.949
CP031810_2	2.39\|2065481\|59\|CP031810\|CRT	2065481-2065539	59	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3090-3148	3	0.949
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151662-151708	3	0.936
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156381-156427	3	0.936
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3264-3310	3	0.936
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1944-1990	3	0.936
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	972-1018	3	0.936
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3174-3202	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1962-1990	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3678-3706	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153069-153097	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153213-153241	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154101-154129	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154137-154165	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156417-156445	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155511-155539	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156291-156319	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157269-157297	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	954-982	3	0.897
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	990-1018	3	0.897
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1752-1786	3	0.914
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3378-3412	3	0.914
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3690-3724	3	0.914
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	966-1000	3	0.914
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153243-153271	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153723-153751	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154455-154483	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156309-156337	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151752-151780	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151770-151798	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153123-153151	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153441-153469	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153639-153667	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153861-153889	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153957-153985	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154173-154201	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154383-154411	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154581-154609	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154617-154645	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154851-154879	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155601-155629	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155637-155665	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155835-155863	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155943-155971	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	15-43	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1008-1036	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1134-1162	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1530-1558	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1602-1630	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1944-1972	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2088-2116	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3156-3184	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3384-3412	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3534-3562	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3696-3724	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1080-1108	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1908-1936	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	972-1000	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1134-1162	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16796-16824	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17630-17658	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17792-17820	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18878-18906	3	0.897
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19274-19302	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151884-151912	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153243-153271	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153723-153751	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154455-154483	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155493-155521	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156273-156301	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156309-156337	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156435-156463	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156645-156673	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157359-157387	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157575-157603	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151788-151816	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153087-153115	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153123-153151	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154383-154411	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154581-154609	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154743-154771	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154941-154969	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155139-155167	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155373-155401	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156561-156589	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156609-156637	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157197-157225	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157557-157585	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	972-1000	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1008-1036	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1758-1786	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1944-1972	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1494-1522	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2544-2572	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3366-3394	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21237-21265	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15858-15886	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9795-9823	3	0.897
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9939-9967	3	0.897
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154293-154333	3	0.927
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154401-154441	3	0.927
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2808-2848	3	0.927
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154833-154861	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155799-155827	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153015-153043	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153975-154003	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157503-157531	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151446-151474	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151464-151492	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151848-151876	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151938-151966	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151974-152002	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153195-153223	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153387-153415	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153441-153469	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153513-153541	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153639-153667	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153957-153985	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154173-154201	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154617-154645	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154671-154699	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154851-154879	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154887-154915	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154977-155005	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155085-155113	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155319-155347	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155601-155629	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155637-155665	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155817-155845	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155835-155863	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155925-155953	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155943-155971	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156471-156499	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156489-156517	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156507-156535	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	15-43	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1134-1162	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1548-1576	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1872-1900	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2088-2116	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2598-2626	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3156-3184	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3384-3412	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3474-3502	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3696-3724	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1080-1108	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1620-1648	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1836-1864	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1890-1918	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1908-1936	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2676-2704	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3552-3580	3	0.897
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1008-1036	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153141-153169	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157575-157603	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151788-151816	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151956-151984	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153621-153649	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154653-154681	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156471-156499	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156489-156517	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156507-156535	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156561-156589	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157557-157585	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1008-1036	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1476-1504	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1758-1786	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1872-1900	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2448-2476	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2598-2626	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1836-1864	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2376-2404	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2676-2704	3	0.897
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3630-3658	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528965-528993	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4664-4692	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518258-518286	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2148-2176	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3660-3688	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525703-525731	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525697-525725	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386541-1386569	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	JQ807233	Environmental Halophage eHP-12, partial genome	23882-23910	3	0.897
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	JQ807233	Environmental Halophage eHP-12, partial genome	23888-23916	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3228-3256	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3048-3076	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3174-3202	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153069-153097	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153585-153613	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155889-155917	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156327-156355	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152010-152038	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157197-157225	3	0.897
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1152-1180	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1458-1486	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2334-2362	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3438-3466	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1296-1324	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3318-3346	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3732-3760	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17024-17052	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151259-151287	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154293-154321	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153279-153307	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153759-153787	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156759-156787	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156909-156937	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157323-157351	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21111-21139	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9669-9697	3	0.897
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9975-10003	3	0.897
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154833-154879	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153369-153415	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154311-154357	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154599-154645	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154959-155005	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155583-155629	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155619-155665	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155961-156007	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157233-157279	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157449-157495	4	0.915
CP031810_2	2.14\|2063603\|47\|CP031810\|CRT	2063603-2063649	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157539-157585	4	0.915
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154977-155017	4	0.902
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157323-157363	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151716-151756	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156777-156817	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1458-1498	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1098-1138	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1662-1702	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2844-2884	4	0.902
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1026-1066	4	0.902
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1026-1072	4	0.915
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154833-154861	4	0.862
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155799-155827	4	0.862
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3156-3184	4	0.862
CP031810_2	2.25\|2064521\|29\|CP031810\|CRT	2064521-2064549	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3474-3502	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151866-151894	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154725-154753	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154923-154951	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155121-155149	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155355-155383	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156543-156571	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1740-1768	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1044-1072	4	0.862
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2658-2686	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154293-154321	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156171-156199	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156015-156043	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156627-156655	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2526-2554	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1368-1396	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1998-2026	4	0.862
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2334-2362	4	0.862
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153687-153721	4	0.886
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153789-153823	4	0.886
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156063-156097	4	0.886
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	966-1000	4	0.886
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152997-153025	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153297-153325	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153657-153685	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153675-153703	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154473-154501	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156831-156859	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156999-157027	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157143-157171	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157251-157279	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157467-157495	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1740-1768	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2136-2164	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2898-2926	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1152-1180	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1422-1450	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1926-1954	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2208-2236	4	0.862
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2994-3022	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154509-154537	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153015-153043	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153975-154003	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157503-157531	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	15-43	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2052-2080	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3030-3058	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1134-1162	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1548-1576	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1872-1900	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2088-2116	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2598-2626	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3384-3412	4	0.862
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3696-3724	4	0.862
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156831-156877	4	0.915
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156999-157045	4	0.915
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157125-157171	4	0.915
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153297-153343	4	0.915
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2136-2164	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1188-1216	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1776-1804	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151902-151930	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153693-153721	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153795-153823	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154263-154291	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155715-155743	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156069-156097	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156435-156463	4	0.862
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1152-1180	4	0.862
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1578-1612	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2238-2272	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154221-154255	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154395-154429	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156843-156877	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157011-157045	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157119-157153	4	0.886
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1002-1036	4	0.886
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152046-152074	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1740-1768	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1044-1072	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2262-2290	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1116-1144	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16754-16782	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17750-17778	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19232-19260	4	0.862
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	4	0.862
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156417-156445	4	0.862
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3156-3184	4	0.862
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	4	0.862
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154743-154783	4	0.902
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155139-155179	4	0.902
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155373-155413	4	0.902
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157521-157561	4	0.902
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152046-152074	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156543-156571	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1740-1768	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2508-2536	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3084-3112	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1044-1072	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2262-2290	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2658-2686	4	0.862
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1116-1144	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154833-154861	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155475-155503	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155799-155827	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156255-156283	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3084-3112	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3156-3184	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3474-3502	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21021-21049	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15408-15436	4	0.862
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9543-9571	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528995-529023	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4652-4680	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518228-518256	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2748-2776	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2952-2980	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525691-525719	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386535-1386563	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386547-1386575	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	JQ807233	Environmental Halophage eHP-12, partial genome	23876-23904	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153225-153253	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153705-153733	4	0.862
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	JQ807237	Environmental Halophage eHP-16, partial genome	9119-9147	4	0.862
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1638-1666	4	0.862
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3570-3598	4	0.862
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156363-156391	4	0.862
CP031810_2	2.50\|2066177\|29\|CP031810\|CRT	2066177-2066205	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157179-157207	4	0.862
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2898-2926	4	0.862
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157287-157315	4	0.862
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154185-154219	5	0.857
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155745-155779	5	0.857
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154293-154333	5	0.878
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2052-2080	5	0.828
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	NC_009444	Pseudomonas fluorescens SBW25 plasmid pQBR103, complete sequence	145873-145901	5	0.828
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3228-3256	5	0.828
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153831-153859	5	0.828
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156105-156133	5	0.828
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156579-156607	5	0.828
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3084-3112	5	0.828
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154293-154339	5	0.894
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154509-154537	5	0.828
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155751-155779	5	0.828
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3030-3058	5	0.828
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	NC_009507	Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence	212561-212589	5	0.828
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155463-155491	5	0.828
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156243-156271	5	0.828
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157698-157726	5	0.828
CP031810_2	2.45\|2065895\|29\|CP031810\|CRT	2065895-2065923	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154209-154237	5	0.828
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152046-152086	5	0.878
CP031810_2	2.46\|2065949\|41\|CP031810\|CRT	2065949-2065989	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151356-151396	5	0.878
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154509-154537	5	0.828
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155751-155779	5	0.828
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2052-2080	5	0.828
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3030-3058	5	0.828
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1164-1192	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1428-1456	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525709-525737	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525679-525707	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386553-1386581	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	JQ807233	Environmental Halophage eHP-12, partial genome	23894-23922	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153537-153565	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MT773556	Myoviridae sp. isolate BML_4 genomic sequence	96355-96383	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MT773556	Myoviridae sp. isolate BML_4 genomic sequence	96367-96395	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5001719-5001747	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP035502	Sphingosinicella sp. BN140058 plasmid p1, complete sequence	167560-167588	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP035502	Sphingosinicella sp. BN140058 plasmid p1, complete sequence	167566-167594	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP035502	Sphingosinicella sp. BN140058 plasmid p1, complete sequence	167572-167600	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MN693281	Marine virus AFVG_25M371, complete genome	15151-15179	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	960-988	5	0.828
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1367361-1367389	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1782-1810	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2472-2500	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16874-16902	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17876-17904	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17948-17976	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18356-18384	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19076-19104	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19358-19386	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19430-19458	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH590593	Mycobacterium phage Rabinovish, complete genome	33459-33487	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH590593	Mycobacterium phage Rabinovish, complete genome	33441-33469	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KX781992	Mycobacterium phage Gabriel, complete genome	32457-32485	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH697579	Mycobacterium phage Cane17, complete genome	29358-29386	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK112554	Mycobacterium phage TinyTim, complete genome	33219-33247	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359314	Mycobacterium phage Ewok, complete genome	33221-33249	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359337	Mycobacterium phage Flabslab, complete genome	31396-31424	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359337	Mycobacterium phage Flabslab, complete genome	31378-31406	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN234193	Mycobacterium phage Kboogie, complete genome	32170-32198	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450432	Mycobacterium phage ValleyTerrace, complete genome	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH051261	Mycobacterium phage Tyke, complete genome	33984-34012	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH779502	Mycobacterium phage FudgeTart, complete genome	32387-32415	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH779502	Mycobacterium phage FudgeTart, complete genome	32369-32397	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359365	Mycobacterium phage Loanshark, complete genome	33219-33247	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359311	Mycobacterium phage SmallFry, complete genome	32178-32206	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359364	Mycobacterium phage ChickenPhender, complete genome	31659-31687	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359303	Mycobacterium phage Shnickers, complete genome	32179-32207	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH697586	Mycobacterium phage InigoMontoya, complete genome	32185-32213	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK112549	Mycobacterium phage Morizzled23, complete genome	32298-32326	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK112549	Mycobacterium phage Morizzled23, complete genome	32280-32308	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359347	Mycobacterium phage Ading, complete genome	32161-32189	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450425	Mycobacterium phage Shelob, complete genome	34211-34239	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_023714	Mycobacterium phage LinStu, complete genome	33586-33614	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359358	Mycobacterium phage Essence, complete genome	31974-32002	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KJ595575	Mycobacterium phage Willis, complete genome	33114-33142	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MG812493	Mycobacterium phage NuevoMundo, complete genome	35180-35208	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359339	Mycobacterium phage Naija, complete genome	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359333	Mycobacterium phage JustHall, complete genome	32501-32529	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359333	Mycobacterium phage JustHall, complete genome	32483-32511	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KT321476	Mycobacterium phage Zeenon, complete genome	33206-33234	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN428065	Mycobacterium phage Cactojaque, complete genome	31535-31563	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359306	Mycobacterium phage Norm, complete genome	33221-33249	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN735434	Mycobacterium phage Mangeria, complete genome	33178-33206	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JN699625	Mycobacterium phage Wally, complete genome	31774-31802	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	EU826471	Mycobacterium phage Cali, complete genome	33052-33080	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KX721255	Mycobacterium phage Yucca, complete genome	33141-33169	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KX721255	Mycobacterium phage Yucca, complete genome	33123-33151	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359366	Mycobacterium phage Basquiat, complete genome	31611-31639	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359346	Mycobacterium phage NoodleTree, complete genome	34250-34278	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JN699013	Mycobacterium phage Pio, complete genome	34148-34176	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359361	Mycobacterium phage Darko, complete genome	33149-33177	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_023725	Mycobacterium phage Nappy, complete genome	33521-33549	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359348	Mycobacterium phage Rahel, complete genome	31780-31808	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH779498	Mycobacterium phage Bread, complete genome	32822-32850	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450427	Mycobacterium phage Adlitam, complete genome	32178-32206	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MG812494	Mycobacterium phage Pier, complete genome	33412-33440	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	GQ303262	Mycobacterium phage LRRHood, complete genome	32522-32550	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MT818423	Mycobacterium phage Janiyra, complete genome	32888-32916	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH316567	Mycobacterium phage ParkTD, complete genome	33215-33243	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	AY129337	Mycobacteriophage Bxz1, complete genome	34530-34558	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH051260	Mycobacterium phage InterFolia, complete genome	35627-35655	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KX721256	Mycobacterium phage Erdmann, complete genome	33219-33247	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359328	Mycobacterium phage EmmaElysia, complete genome	31794-31822	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KM881426	Mycobacterium phage ZygoTaiga	33220-33248	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359335	Mycobacterium phage Patter, complete genome	32241-32269	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MT889395	Mycobacterium phage Shifa, complete genome	30826-30854	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	EU826467	Mycobacterium phage Rizal, complete genome	32136-32164	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MT723944	Mycobacterium phage ChaylaJr, complete genome	31326-31354	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KR080196	Mycobacterium phage Momo, complete genome	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH910040	Mycobacterium phage Sauce, complete genome	32069-32097	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MF919495	Mycobacterium phage Bigswole, complete genome	35644-35672	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359318	Mycobacterium phage Specks, complete genome	35013-35041	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KF024734	Mycobacterium phage Shrimp, complete genome	33223-33251	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359308	Mycobacterium phage Shaqnato, complete genome	30944-30972	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH825697	Mycobacterium phage Bangla1971, complete genome	32675-32703	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359338	Mycobacterium phage Amataga, complete genome	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359350	Mycobacterium phage Nidhogg, complete genome	33073-33101	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MT723945	Mycobacterium phage Quasimodo, complete genome	33147-33175	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	32619-32647	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH316561	Mycobacterium phage Derek, complete genome	32513-32541	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK112533	Mycobacterium phage Bonray, complete genome	33323-33351	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450422	Mycobacterium phage RoMag, complete genome	32574-32602	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359327	Mycobacterium phage EmToTheThree, complete genome	34691-34719	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359327	Mycobacterium phage EmToTheThree, complete genome	34673-34701	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH727543	Mycobacterium phage CharlieB, complete genome	31050-31078	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JF704116	Mycobacterium phage Drazdys, complete genome	33019-33047	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359336	Mycobacterium phage Chargie21, complete genome	31611-31639	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359355	Mycobacterium phage Sprinklers, complete genome	31441-31469	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK112534	Mycobacterium phage Burrough, complete genome	33479-33507	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MF919499	Mycobacterium phage Daffodil, complete genome	33218-33246	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359334	Mycobacterium phage Delilah, complete genome	33219-33247	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_023696	Mycobacterium phage Dandelion, complete genome	35890-35918	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_023696	Mycobacterium phage Dandelion, complete genome	35872-35900	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN276192	Mycobacterium phage Trinitium, complete genome	31644-31672	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359324	Mycobacterium phage Tortoise16, complete genome	33080-33108	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH825713	Mycobacterium phage Zalkecks, complete genome	32904-32932	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359349	Mycobacterium phage FoxtrotP1, complete genome	33621-33649	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359349	Mycobacterium phage FoxtrotP1, complete genome	33603-33631	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JF704096	Mycobacterium phage Ghost, complete sequence	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN062707	Mycobacterium phage Grungle, complete genome	29602-29630	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359344	Mycobacterium phage Napoleon13, complete genome	31027-31055	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH727558	Mycobacterium phage Salacia, complete genome	33336-33364	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359363	Mycobacterium phage Fludd, complete genome	32058-32086	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KX831080	Mycobacterium phage Lukilu, complete genome	32434-32462	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359329	Mycobacterium phage Kamryn, complete genome	33743-33771	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JQ911768	Mycobacterium phage Ava3, complete genome	33278-33306	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_004687	Mycobacterium phage Bxz1, complete genome	34530-34558	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_011270	Mycobacterium phage Spud, complete genome	33534-33562	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_011270	Mycobacterium phage Spud, complete genome	33516-33544	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN183280	Mycobacteriophage LolaVinca, complete genome	34379-34407	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359345	Mycobacterium phage QBert, complete genome	32715-32743	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	GQ303260	Mycobacterium phage ET08, complete genome	30918-30946	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH744422	Mycobacterium phage Roots515, complete genome	32641-32669	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359321	Mycobacterium phage Phusco, complete genome	32992-33020	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359362	Mycobacterium phage Atlantean, complete genome	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	EU826469	Mycobacterium phage ScottMcG, complete genome	32573-32601	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	EU826469	Mycobacterium phage ScottMcG, complete genome	32555-32583	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK310143	Mycobacterium phage Dietrick, complete genome	31337-31365	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK310143	Mycobacterium phage Dietrick, complete genome	31319-31347	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450429	Mycobacterium phage Bipolarisk, complete genome	32930-32958	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH051266	Mycobacterium phage MikeLiesIn, complete genome	33232-33260	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_029044	Mycobacterium phage Breeniome, complete genome	32048-32076	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH669008	Mycobacterium phage Megamind, complete genome	32885-32913	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK878897	Mycobacterium phage Blackbrain, complete genome	31428-31456	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450434	Mycobacterium phage DrPhinkDaddy, complete genome	33274-33302	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359359	Mycobacterium phage Colt, complete genome	30420-30448	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MF919527	Mycobacterium phage Phox, complete genome	33109-33137	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MT818416	Mycobacterium phage BackyardAgain, complete genome	32113-32141	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359330	Mycobacterium phage Iota, complete genome	31961-31989	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KT365398	Mycobacterium phage DTDevon, complete genome	33388-33416	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KX369583	Mycobacterium phage Littleton, complete genome	32182-32210	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MF919494	Mycobacterium phage BeanWater, complete genome	31815-31843	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_028869	Mycobacterium phage HyRo, complete genome	31787-31815	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KT365400	Mycobacterium phage ErnieJ, complete genome	31615-31643	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KT365400	Mycobacterium phage ErnieJ, complete genome	31597-31625	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KC691257	Mycobacterium phage Astraea, complete genome	32406-32434	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MG872839	Mycobacterium phage LifeSavor, complete genome	31944-31972	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KC748968	Mycobacterium phage Gizmo, complete genome	32902-32930	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	KC748970	Mycobacterium phage ArcherS7, complete genome	32545-32573	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359353	Mycobacterium phage BadAgartude, complete genome	33279-33307	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MH697590	Mycobacterium phage Phlegm, complete genome	32224-32252	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359317	Mycobacterium phage FrayBell, complete genome	34664-34692	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MT553335	Mycobacterium phage Ronan, complete genome	30021-30049	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN428066	Mycobacterium phage JPickles, complete genome	30651-30679	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359305	Mycobacterium phage Teardrop, complete genome	32337-32365	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	DQ398053	Mycobacteriophage Catera, complete genome	31675-31703	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	DQ398053	Mycobacteriophage Catera, complete genome	31657-31685	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MF919513	Mycobacterium phage Koguma, complete genome	30703-30731	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JN699626	Mycobacterium phage MoMoMixon, complete genome	33332-33360	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JN699626	Mycobacterium phage MoMoMixon, complete genome	33314-33342	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_028986	Mycobacterium phage Alice, complete sequence	30863-30891	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450424	Mycobacterium phage Melpomini, complete genome	30778-30806	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450424	Mycobacterium phage Melpomini, complete genome	30760-30788	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JN204348	Mycobacterium phage Sebata, complete genome	33705-33733	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	31975-32003	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK450423	Mycobacterium phage Stubby, complete genome	31501-31529	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MF919493	Mycobacterium phage Audrick, complete genome	32203-32231	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_008207	Mycobacterium phage Catera, complete genome	31675-31703	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	NC_008207	Mycobacterium phage Catera, complete genome	31657-31685	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	JN624850	Mycobacterium phage Pleione, complete genome	33218-33246	5	0.828
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK359326	Mycobacterium phage Pivoine, complete genome	32224-32252	5	0.828
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153825-153859	6	0.829
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156099-156133	6	0.829
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156573-156607	6	0.829
CP031810_2	2.26\|2064575\|29\|CP031810\|CRT	2064575-2064603	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	6	0.793
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4652-4680	6	0.793
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1386535-1386563	6	0.793
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	KP790009	Gordonia phage Gmala1, complete genome	62627-62655	6	0.793
CP031810_2	2.27\|2064629\|29\|CP031810\|CRT	2064629-2064657	29	KP790008	Gordonia phage GordTnk2, complete genome	63345-63373	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KX781992	Mycobacterium phage Gabriel, complete genome	32439-32467	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH697579	Mycobacterium phage Cane17, complete genome	29340-29368	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359314	Mycobacterium phage Ewok, complete genome	33203-33231	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN234193	Mycobacterium phage Kboogie, complete genome	32152-32180	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK450432	Mycobacterium phage ValleyTerrace, complete genome	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH051261	Mycobacterium phage Tyke, complete genome	33966-33994	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359365	Mycobacterium phage Loanshark, complete genome	33201-33229	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359311	Mycobacterium phage SmallFry, complete genome	32160-32188	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359364	Mycobacterium phage ChickenPhender, complete genome	31641-31669	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359303	Mycobacterium phage Shnickers, complete genome	32161-32189	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH697586	Mycobacterium phage InigoMontoya, complete genome	32167-32195	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359347	Mycobacterium phage Ading, complete genome	32143-32171	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NC_023714	Mycobacterium phage LinStu, complete genome	33568-33596	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359358	Mycobacterium phage Essence, complete genome	31956-31984	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MG812493	Mycobacterium phage NuevoMundo, complete genome	35162-35190	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359339	Mycobacterium phage Naija, complete genome	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KT321476	Mycobacterium phage Zeenon, complete genome	33188-33216	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN428065	Mycobacterium phage Cactojaque, complete genome	31517-31545	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359306	Mycobacterium phage Norm, complete genome	33203-33231	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN735434	Mycobacterium phage Mangeria, complete genome	33160-33188	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	EU826471	Mycobacterium phage Cali, complete genome	33034-33062	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359366	Mycobacterium phage Basquiat, complete genome	31593-31621	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359346	Mycobacterium phage NoodleTree, complete genome	34232-34260	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	JN699013	Mycobacterium phage Pio, complete genome	34130-34158	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359361	Mycobacterium phage Darko, complete genome	33131-33159	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NC_023725	Mycobacterium phage Nappy, complete genome	33503-33531	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359348	Mycobacterium phage Rahel, complete genome	31762-31790	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK450427	Mycobacterium phage Adlitam, complete genome	32160-32188	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MG812494	Mycobacterium phage Pier, complete genome	33394-33422	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	GQ303262	Mycobacterium phage LRRHood, complete genome	32504-32532	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MT818423	Mycobacterium phage Janiyra, complete genome	32870-32898	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	AY129337	Mycobacteriophage Bxz1, complete genome	34512-34540	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH051260	Mycobacterium phage InterFolia, complete genome	35609-35637	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359328	Mycobacterium phage EmmaElysia, complete genome	31776-31804	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359335	Mycobacterium phage Patter, complete genome	32223-32251	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MT889395	Mycobacterium phage Shifa, complete genome	30808-30836	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MT723944	Mycobacterium phage ChaylaJr, complete genome	31308-31336	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KR080196	Mycobacterium phage Momo, complete genome	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH910040	Mycobacterium phage Sauce, complete genome	32051-32079	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359318	Mycobacterium phage Specks, complete genome	34995-35023	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359308	Mycobacterium phage Shaqnato, complete genome	30926-30954	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH825697	Mycobacterium phage Bangla1971, complete genome	32657-32685	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359338	Mycobacterium phage Amataga, complete genome	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MT723945	Mycobacterium phage Quasimodo, complete genome	33129-33157	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359342	Mycobacterium phage ShiaLabeouf, complete genome	32601-32629	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH316561	Mycobacterium phage Derek, complete genome	32495-32523	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK112533	Mycobacterium phage Bonray, complete genome	33305-33333	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK450422	Mycobacterium phage RoMag, complete genome	32556-32584	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH727543	Mycobacterium phage CharlieB, complete genome	31032-31060	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	JF704116	Mycobacterium phage Drazdys, complete genome	33001-33029	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359336	Mycobacterium phage Chargie21, complete genome	31593-31621	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359355	Mycobacterium phage Sprinklers, complete genome	31423-31451	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK112534	Mycobacterium phage Burrough, complete genome	33461-33489	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN276192	Mycobacterium phage Trinitium, complete genome	31626-31654	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359324	Mycobacterium phage Tortoise16, complete genome	33062-33090	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	JF704096	Mycobacterium phage Ghost, complete sequence	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN062707	Mycobacterium phage Grungle, complete genome	29584-29612	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH727558	Mycobacterium phage Salacia, complete genome	33318-33346	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359363	Mycobacterium phage Fludd, complete genome	32040-32068	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KX831080	Mycobacterium phage Lukilu, complete genome	32416-32444	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359329	Mycobacterium phage Kamryn, complete genome	33725-33753	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	JQ911768	Mycobacterium phage Ava3, complete genome	33260-33288	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NC_004687	Mycobacterium phage Bxz1, complete genome	34512-34540	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN183280	Mycobacteriophage LolaVinca, complete genome	34361-34389	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359345	Mycobacterium phage QBert, complete genome	32697-32725	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	GQ303260	Mycobacterium phage ET08, complete genome	30900-30928	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH744422	Mycobacterium phage Roots515, complete genome	32623-32651	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359321	Mycobacterium phage Phusco, complete genome	32974-33002	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359362	Mycobacterium phage Atlantean, complete genome	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NC_029044	Mycobacterium phage Breeniome, complete genome	32030-32058	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK878897	Mycobacterium phage Blackbrain, complete genome	31410-31438	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359359	Mycobacterium phage Colt, complete genome	30402-30430	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MF919527	Mycobacterium phage Phox, complete genome	33091-33119	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MT818416	Mycobacterium phage BackyardAgain, complete genome	32095-32123	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359330	Mycobacterium phage Iota, complete genome	31943-31971	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KT365398	Mycobacterium phage DTDevon, complete genome	33370-33398	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KX369583	Mycobacterium phage Littleton, complete genome	32164-32192	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MF919494	Mycobacterium phage BeanWater, complete genome	31797-31825	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NC_028869	Mycobacterium phage HyRo, complete genome	31769-31797	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KC691257	Mycobacterium phage Astraea, complete genome	32388-32416	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MG872839	Mycobacterium phage LifeSavor, complete genome	31926-31954	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KC748968	Mycobacterium phage Gizmo, complete genome	32884-32912	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	KC748970	Mycobacterium phage ArcherS7, complete genome	32527-32555	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359353	Mycobacterium phage BadAgartude, complete genome	33261-33289	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MH697590	Mycobacterium phage Phlegm, complete genome	32206-32234	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359317	Mycobacterium phage FrayBell, complete genome	34646-34674	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MT553335	Mycobacterium phage Ronan, complete genome	30003-30031	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN428066	Mycobacterium phage JPickles, complete genome	30633-30661	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359305	Mycobacterium phage Teardrop, complete genome	32319-32347	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MF919513	Mycobacterium phage Koguma, complete genome	30685-30713	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	NC_028986	Mycobacterium phage Alice, complete sequence	30845-30873	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	JN204348	Mycobacterium phage Sebata, complete genome	33687-33715	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MN183285	Mycobacterium phage YoungMoneyMata, complete genome	31957-31985	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK450423	Mycobacterium phage Stubby, complete genome	31483-31511	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MF919493	Mycobacterium phage Audrick, complete genome	32185-32213	6	0.793
CP031810_2	2.29\|2064755\|29\|CP031810\|CRT	2064755-2064783	29	MK359326	Mycobacterium phage Pivoine, complete genome	32206-32234	6	0.793
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151235-151269	6	0.829
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528989-529023	6	0.829
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518228-518262	6	0.829
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3336-3364	6	0.793
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	6	0.793
CP031810_2	2.42\|2065727\|29\|CP031810\|CRT	2065727-2065755	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	6	0.793
CP031810_2	2.44\|2065841\|29\|CP031810\|CRT	2065841-2065869	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154191-154219	6	0.793
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154191-154219	6	0.793
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	528959-528987	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	KU886268	Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome	4670-4698	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	518264-518292	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3504-3532	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1230-1258	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2322-2350	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3336-3364	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525667-525695	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1397565-1397593	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	JQ807233	Environmental Halophage eHP-12, partial genome	23870-23898	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1719550-1719578	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	1719538-1719566	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MN693281	Marine virus AFVG_25M371, complete genome	15145-15173	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	84701-84729	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	84767-84795	6	0.793
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016654	Rhodococcus phage REQ3, complete genome	21042-21070	6	0.793
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	MK112541	Mycobacterium phage Jessibeth14, complete genome	33004-33032	6	0.793
CP031810_2	2.11\|2063351\|47\|CP031810\|CRT	2063351-2063397	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155445-155491	7	0.851
CP031810_2	2.11\|2063351\|47\|CP031810\|CRT	2063351-2063397	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156225-156271	7	0.851
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16760-16800	7	0.829
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17756-17796	7	0.829
CP031810_2	2.15\|2063675\|41\|CP031810\|CRT	2063675-2063715	41	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19238-19278	7	0.829
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152046-152092	7	0.851
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2472-2518	7	0.851
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154275-154309	7	0.8
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3780-3814	7	0.8
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887816-2887844	7	0.759
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	16305-16333	7	0.759
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1524516-1524544	7	0.759
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154209-154255	7	0.851
CP031810_2	2.41\|2065655\|47\|CP031810\|CRT	2065655-2065701	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151356-151402	7	0.851
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155745-155779	7	0.8
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154185-154219	7	0.8
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154503-154537	7	0.8
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155457-155491	7	0.8
CP031810_2	2.43\|2065781\|35\|CP031810\|CRT	2065781-2065815	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156237-156271	7	0.8
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1634138-1634166	7	0.759
CP031810_2	2.47\|2066015\|29\|CP031810\|CRT	2066015-2066043	29	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1638806-1638834	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP013855	Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence	229010-229038	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	65111-65139	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	84707-84735	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP018205	Leptolyngbya boryana NIES-2135 plasmid plasmid2 DNA, complete genome	4802-4830	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MH001451	Mycobacterium phage Nairb, complete genome	5203-5231	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MF155936	Mycobacterium phage ZenTime222, complete genome	5203-5231	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MK494089	Mycobacterium phage Ibrahim, complete genome	5203-5231	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_024135	Mycobacterium phage Bernal13, complete genome	5203-5231	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	KM591905	Mycobacterium phage RonRayGun, complete genome	5203-5231	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	MN735432	Mycobacteriophage Whitty, complete genome	5203-5231	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	8863-8891	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP014640	Leptolyngbya boryana IAM M-101 plasmid pLBX	500596-500624	7	0.759
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NC_016587	Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence	109709-109737	7	0.759
CP031810_2	2.51\|2066231\|29\|CP031810\|CRT	2066231-2066259	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	7	0.759
CP031810_2	2.17\|2063801\|41\|CP031810\|CRT	2063801-2063841	41	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151356-151396	8	0.805
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	525703-525737	8	0.771
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	KX752698	Mycobacterium phage Tonenili, complete genome	37355-37389	8	0.771
CP031810_2	2.33\|2065037\|29\|CP031810\|CRT	2065037-2065065	29	MH976512	Gordonia phage Geodirt, complete genome	16162-16190	8	0.724
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1634138-1634166	8	0.724
CP031810_2	2.34\|2065091\|29\|CP031810\|CRT	2065091-2065119	29	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1638806-1638834	8	0.724
CP031810_2	2.37\|2065301\|47\|CP031810\|CRT	2065301-2065347	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155733-155779	8	0.83
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	1030539-1030567	8	0.724
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	1035219-1035247	8	0.724
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1402246-1402274	8	0.724
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	84773-84801	8	0.724
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	95755-95783	8	0.724
CP031810_2	2.49\|2066123\|29\|CP031810\|CRT	2066123-2066151	29	NZ_CP015597	Mycobacterium sp. YC-RL4 plasmid pMYC1, complete sequence	170277-170305	8	0.724
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2887810-2887844	9	0.743
CP031810_2	2.24\|2064449\|47\|CP031810\|CRT	2064449-2064495	47	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154173-154219	9	0.809
CP031810_2	2.31\|2064899\|35\|CP031810\|CRT	2064899-2064933	35	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157692-157726	9	0.743
CP031810_2	2.36\|2065217\|59\|CP031810\|CRT	2065217-2065275	59	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3492-3550	9	0.847
CP031810_2	2.48\|2066069\|29\|CP031810\|CRT	2066069-2066097	29	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1182-1203	9	0.69
CP031810_2	2.16\|2063741\|35\|CP031810\|CRT	2063741-2063775	35	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1-25	12	0.657

1. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
*****************************

2. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
*****************************

3. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*****************************

4. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*****************************

5. spacer 2.37|2065301|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	Protospacer
***********************************************

6. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtcggagtcggagtcg	Protospacer
*****************************

7. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
*****************************

8. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
*****************************

9. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
*****************************

10. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
*****************************

11. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
*****************************

12. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
*****************************

13. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtccgaatcggagtcg	Protospacer
*****************************

14. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggagtcgctgtccgagtcagagtcg	Protospacer
*****************************

15. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.979

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtcg	Protospacer
**********************************************.

16. spacer 2.15|2063675|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.976

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtcggagtcgctgtcagaatccgaatcgctgtcagaatcc	Protospacer
*************************.***************

17. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagagtccgaatcg	Protospacer
**************************** ******

18. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.971

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagagtccgaatcg	Protospacer
**************************** ******

19. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*******.*********************

20. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
**********.******************

21. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*******.*********************

22. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcagaatccgaatcg	Protospacer
*.***************************

23. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgagtcg	Protospacer
*************************.***

24. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagcatccgaatcg	Protospacer
****************** **********

25. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgagtcg	Protospacer
*************************.***

26. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*******.*********************

27. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
**********.******************

28. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgaatcg	Protospacer
*******************.*********

29. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
****************.************

30. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatccgagtcg	Protospacer
*************************.***

31. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatccgagtcg	Protospacer
*************************.***

32. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatccgagtcg	Protospacer
*************************.***

33. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatccgagtcg	Protospacer
*************************.***

34. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
****************.************

35. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgaatcg	Protospacer
*******************.*********

36. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
****************.************

37. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatccgagtcg	Protospacer
*************************.***

38. spacer 2.27|2064629|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
aatcagagtcggagtcagaatccgagtcg	Protospacer
********************** ******

39. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.979

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
aatcggaatcactgtcagaatccgagtcgctgtcagagtccgagtcg	Protospacer
*************************************.*********

40. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
****************************.

41. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
****************************.

42. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
****************************.

43. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
****************************.

44. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
****************************.

45. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggaatcggaatca	Protospacer
*******************.*********

46. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatca	Protospacer
********************** ******

47. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtcggaatca	Protospacer
****************.************

48. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtcggaatca	Protospacer
****************.************

49. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtcggaatca	Protospacer
****************.************

50. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtcggaatca	Protospacer
****************.************

51. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtcggaatca	Protospacer
****************.************

52. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtcggaatca	Protospacer
*.***************************

53. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

54. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgaatcg	Protospacer
*******.*********************

55. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgaatcg	Protospacer
****************.************

56. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
*.***************************

57. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgaatcg	Protospacer
**************** ************

58. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcagaatccgaatcg	Protospacer
**********.******************

59. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

60. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

61. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
*.***************************

62. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

63. spacer 2.37|2065301|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.979

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
aatccgaatcactgtcggagtccgagtcgctgtcagagtcggaatca	Protospacer
*************************.*********************

64. spacer 2.37|2065301|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.979

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
agtccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	Protospacer
*.*********************************************

65. spacer 2.39|2065481|59|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.983

agtcgctgtccgaatccgaatcactgtcggagtccgaatcgctgtcagagtccgaatca	CRISPR spacer
agtcgctgtccgaatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	Protospacer
**************************************************** ******

66. spacer 2.41|2065655|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.979

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatca	Protospacer
**********************************************.

67. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtcggagtccgagtcg	Protospacer
********************** ******

68. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtcggagtccgagtcg	Protospacer
********************** ******

69. spacer 2.43|2065781|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.971

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtcggaatcgctgtcagagtctgaatca	Protospacer
 **********************************

70. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** ************************

71. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** ************************

72. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtccgaatcg	Protospacer
****.************************

73. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** ************************

74. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** ************************

75. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** ************************

76. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgaatcg	Protospacer
*.***************************

77. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtccgaatcg	Protospacer
**********.******************

78. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgagtcg	Protospacer
*************************.***

79. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgagtcg	Protospacer
*************************.***

80. spacer 2.45|2065895|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatca	Protospacer
****************************.

81. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*******.*********************

82. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.***************************

83. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.***************************

84. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
**********.******************

85. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

86. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

87. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

88. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**************** ************

89. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**************** ************

90. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

91. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**************** ************

92. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

93. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**************** ************

94. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

95. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

96. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*************************.***

97. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

98. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

99. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*******************.*********

100. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*******.*********************

101. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
****************************.

102. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
****************************.

103. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
**********.******************

104. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*******.*********************

105. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgaatcg	Protospacer
**** ************************

106. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagcatccgaatcg	Protospacer
****************** **********

107. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
*******.*********************

108. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
**** ************************

109. spacer 2.48|2066069|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
*******.*********************

110. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgaatcg	Protospacer
****.************************

111. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
**** ************************

112. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtcagaatcggagtcg	Protospacer
**************** ************

113. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtcagaatcggagtcg	Protospacer
**************** ************

114. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.966

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtcagaatcggagtcg	Protospacer
**************** ************

115. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.966

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgagtcgctgtccgagtcagagtcg	Protospacer
**** ************************

116. spacer 2.11|2063351|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatccgagtcactgtcagagtcggaatcactgtcagagtcagaatcg	CRISPR spacer
aatccgagtcgctgtcagagtcggaatcactgtcagagtccgaatcg	Protospacer
**********.***************************** ******

117. spacer 2.11|2063351|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatccgagtcactgtcagagtcggaatcactgtcagagtcagaatcg	CRISPR spacer
aatccgagtcgctgtcagagtcggaatcactgtcagagtccgaatcg	Protospacer
**********.***************************** ******

118. spacer 2.11|2063351|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatccgagtcactgtcagagtcggaatcactgtcagagtcagaatcg	CRISPR spacer
aatccgagtcgctgtcagagtcggaatcactgtcagagtccgaatcg	Protospacer
**********.***************************** ******

119. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
*******************.**************************.

120. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcgctgtcagagtcggaatca	Protospacer
**************************************** **.***

121. spacer 2.15|2063675|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtcggagtcgctgtcagagtccgaatcgctgtcagaatcc	Protospacer
*******************.*****.***************

122. spacer 2.15|2063675|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtcagagtcgctgtcagaatccgagtcgctgtcagagtcc	Protospacer
****.********************************.***

123. spacer 2.15|2063675|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtcggaatcgctgtcagaatccgagtcactgtcagaatcc	Protospacer
*******.********************.************

124. spacer 2.15|2063675|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtcagagtcgctgtcagaatcggagtcgctgtcagaatcc	Protospacer
****.***************** ******************

125. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtcggagtcgctgtcagaatccgagtcgctgtccgaatcg	Protospacer
********************************** *****

126. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcagaatcc	Protospacer
**** **************.*********************

127. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcgctgtcagaatcc	Protospacer
**** ********************.***************

128. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtccgagtcgctgtccgaatccgagtcgctgtcagaatcc	Protospacer
**** *********** ************************

129. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcgctgtcagagtcc	Protospacer
**** ********************************.***

130. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
agtccgagtcgctgtccgaatccgagtcgctgtcagaatcc	Protospacer
**** *********** ************************

131. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagagtcagagtca	Protospacer
*******************************.**.

132. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagaatccgaatcg	Protospacer
*************************.** ******

133. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagaatccgaatcg	Protospacer
*************************.** ******

134. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*************.************** ******

135. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtccgaatcg	Protospacer
*******.******************** ******

136. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatcggaatcgctgtcagagtcggaatcg	Protospacer
********** *****************.******

137. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*************.************** ******

138. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*************.************** ******

139. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*************.************** ******

140. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*************.************** ******

141. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtccgaatccgaatcgctgtcagagtcggaatcg	Protospacer
**** ***********************.******

142. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtcggaatcg	Protospacer
*******.********************.******

143. spacer 2.16|2063741|35|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagagtcggaatca	Protospacer
****************************.*****.

144. spacer 2.16|2063741|35|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtcagagtcg	Protospacer
*******.***********************.***

145. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
agtcagaatccgaatcgctgtcagagtcagagtcg	Protospacer
 ******************************.***

146. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcagagtcg	Protospacer
**********************.********.***

147. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagagtccgagtcg	Protospacer
**************************** **.***

148. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtccgagtcagagtcg	Protospacer
********************** ********.***

149. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcggaatcg	Protospacer
**********************.*****.******

150. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcagagtccgagtcg	Protospacer
**************************** **.***

151. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcactgtcagagtcagaatcg	Protospacer
*************.**.******************

152. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcagagtcg	Protospacer
**********************.********.***

153. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcagagtcg	Protospacer
**********************.********.***

154. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcggaatcg	Protospacer
*.******************** ******************

155. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatcggagtcgctgtcagagtccgagtcgctgtcggaatcg	Protospacer
**** ***************** ******************

156. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.951

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatcggagtcgctgtcagagtcagagtcgctgtccgaatcg	Protospacer
**** ***************************** ******

157. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcagagtcactgtcagaatccgaatcg	Protospacer
**** **.*********************

158. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*******.**.******************

159. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.********.******************

160. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.********.******************

161. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcagagtcactgtcagaatccgaatcg	Protospacer
**** **.*********************

162. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**********.********.*********

163. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**********.********.*********

164. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagaatcggaatcg	Protospacer
**** ***************** ******

165. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
**** **************.*********

166. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**********.**************.***

167. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**********.***** ************

168. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
**** **************.*********

169. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**********.***** ************

170. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
**** **************.*********

171. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**********.**************.***

172. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**********.***** ************

173. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
**** **************.*********

174. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**********.**************.***

175. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**********.***** ************

176. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagagtcggaatcg	Protospacer
*******************.** ******

177. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**********.**************.***

178. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**********.**************.***

179. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**********.**************.***

180. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagagtcggaatcg	Protospacer
*******************.** ******

181. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagaatcggaatcg	Protospacer
**** ***************** ******

182. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**********.********.*********

183. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**********.********.*********

184. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**********.********.*********

185. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*******.**.******************

186. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggaatccgaatca	Protospacer
****************.***********.

187. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
**********.*****************.

188. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
**********.*****************.

189. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtctgaatcactgtcagaatccgagtcg	Protospacer
****.********************.***

190. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*******.**.******************

191. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
*.**************.************

192. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatcg	Protospacer
*.*****.*********************

193. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggaatcggaatcg	Protospacer
****************.***** ******

194. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgaatcg	Protospacer
**** *****.******************

195. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgaatcg	Protospacer
*.** ************************

196. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagcatccgaatcg	Protospacer
**********.******* **********

197. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcggaatccgaatcg	Protospacer
**** ***********.************

198. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
*.**************.************

199. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggagtccgaatcg	Protospacer
****************.**.*********

200. spacer 2.25|2064521|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggaatcggaatcg	Protospacer
****************.***** ******

201. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
********************** *****.

202. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
********************** *****.

203. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatccgagtca	Protospacer
*************************.**.

204. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
********************** *****.

205. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
********************** *****.

206. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
**** ***********.************

207. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

208. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.************** ************

209. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgaatcg	Protospacer
*.**************.************

210. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
****************.**.*********

211. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatccgagtcg	Protospacer
*******.*****************.***

212. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.************** ************

213. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtcg	Protospacer
*******************.*****.***

214. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

215. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
****************.********.***

216. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgaatcg	Protospacer
*.*****.*********************

217. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*******.***********.*********

218. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*******.***********.*********

219. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
**********.*****.************

220. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
*******.********.************

221. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

222. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatccgagtcg	Protospacer
*.***********************.***

223. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatccgagtcg	Protospacer
*.***********************.***

224. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

225. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatccgagtcg	Protospacer
*.***********************.***

226. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

227. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

228. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

229. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatccgagtcg	Protospacer
*.***********************.***

230. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

231. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

232. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatccgagtcg	Protospacer
*.***********************.***

233. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.************** ************

234. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.************** ************

235. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
**********.*****.************

236. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

237. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*******.***********.*********

238. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
****************.********.***

239. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

240. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*******.***********.*********

241. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
****************.**.*********

242. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
****************.**.*********

243. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtcggaatcg	Protospacer
*******************.** ******

244. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
**********.*****.************

245. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

246. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
*******.********.************

247. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcggagtcactgtcggaatccgaatcg	Protospacer
**** *****.******************

248. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcggagtccgaatcg	Protospacer
**** **************.*********

249. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcactgtcggaatccgaatcg	Protospacer
**** *****.******************

250. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcggagtcgctgtcagaatccgaatcg	Protospacer
**** ***********.************

251. spacer 2.26|2064575|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
*.*****************.*********

252. spacer 2.26|2064575|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
**** ***********.************

253. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
*******************.*****************.*********

254. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
*******************.*****************.*********

255. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
aatcggaatcactgtccgaatccgagtcgctgtcagagtccgagtcg	Protospacer
**************** ********************.*********

256. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.957

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcgctgtcagaatccgaatcg	Protospacer
*******************.***********************.***

257. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
**************** ***** ******

258. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtcggagtcggagtcg	Protospacer
**** *********** ************

259. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
**************** ***** ******

260. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
**************** ***** ******

261. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
**************** ***** ******

262. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcagagtccgagtcg	Protospacer
**************** ***** ******

263. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcagagtcggaatcg	Protospacer
**************** ********.***

264. spacer 2.29|2064755|29|CP031810|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtctgagtctgagtcg	Protospacer
****************.***** ******

265. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtcggagtcggagtcg	Protospacer
**** *********** ************

266. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcagagtcagagtcg	Protospacer
**************** *****.******

267. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtccgagtcgctgtccgagtcggagtcg	Protospacer
*.** ************************

268. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggaatcgctgtccgagtcagagtcg	Protospacer
*******.**************.******

269. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcactgtcggagtcggagtcg	Protospacer
**********.***** ************

270. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtccgaatccgagtcg	Protospacer
*******************.** ******

271. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcagagtcgctgtccgagtcggagtcg	Protospacer
*.**.************************

272. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtcagagtcggagtcg	Protospacer
**** *********** ************

273. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcggagtcgctgtccgagtcagagtcg	Protospacer
*.********************.******

274. spacer 2.29|2064755|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtctgagtctgagtcg	Protospacer
****************.***** ******

275. spacer 2.29|2064755|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.931

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtctgagtctgagtcg	Protospacer
****************.***** ******

276. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggagtccgagtcg	Protospacer
 ********* ************************

277. spacer 2.31|2064899|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggagtcgctgtcagagtccgagtcg	Protospacer
 *********************.************

278. spacer 2.31|2064899|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.943

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
agtcggagtcggagtcgctgtccgagtccgaatcg	Protospacer
********************** ********.***

279. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

280. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggagtcg	Protospacer
*************************.**.

281. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

282. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

283. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

284. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

285. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
*.*****************.*********

286. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
**************** **.*********

287. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
*.*****************.*********

288. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtcggaatca	Protospacer
*.**************.************

289. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
**************** **.*********

290. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
**************** **.*********

291. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
**************** **.*********

292. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
**************** **.*********

293. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtcggaatca	Protospacer
*.**************.************

294. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtcggaatca	Protospacer
*.**************.************

295. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
*.*****************.*********

296. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggaatcggaatca	Protospacer
*.*****************.*********

297. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtcggaatcg	Protospacer
*.**************************.

298. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtcggagtcg	Protospacer
*************************.**.

299. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggagtcggaatcg	Protospacer
*******.********************.

300. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

301. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatca	Protospacer
****************.***** ******

302. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggaatcggaatca	Protospacer
*******.***********.*********

303. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggagtcggagtca	Protospacer
*******.*****************.***

304. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtcggaatca	Protospacer
*.**************.************

305. spacer 2.33|2065037|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgaatcg	Protospacer
********************** *****.

306. spacer 2.33|2065037|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcagagtcggaatca	Protospacer
*******.********.************

307. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 ************************.***

308. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 ************************.***

309. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

310. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

311. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*.*****.*********************

312. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

313. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

314. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

315. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

316. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

317. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

318. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

319. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggagtccgaatcg	Protospacer
****************.**.*********

320. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
*.********.******************

321. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

322. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

323. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

324. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

325. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

326. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

327. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*.************** ************

328. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

329. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

330. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*.************** ************

331. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

332. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

333. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

334. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*.************** ************

335. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

336. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

337. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
*.************** ************

338. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

339. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

340. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

341. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

342. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

343. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

344. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

345. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcggaatcg	Protospacer
*******************.** ******

346. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*******.******** ************

347. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*******************.*****.***

348. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
**** ***************** ******

349. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
**** ***************** ******

350. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
**** ***************** ******

351. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

352. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

353. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

354. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*.*****.*********************

355. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
*.**************************.

356. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatca	Protospacer
*******************.********.

357. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtca	Protospacer
*************************.**.

358. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
*.**************************.

359. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
*.********.******************

360. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*******************.*****.***

361. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
*.*****.*********************

362. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
**********.*****.************

363. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

364. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatcg	Protospacer
*******.**.******************

365. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*******************.*****.***

366. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgaatcg	Protospacer
*.** ************************

367. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgaatcg	Protospacer
**** *****.******************

368. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagcatccgaatcg	Protospacer
*.**************** **********

369. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
**********.*****.************

370. spacer 2.34|2065091|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

371. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcgctgtcggagtcggagtca	Protospacer
**********.*****************.

372. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcgctgtcggagtcagagtcg	Protospacer
**********.***********.******

373. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgagtcactgtcggagtcggagtcg	Protospacer
*.*****.*********************

374. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgagtcgctgtcggagtcggagtcg	Protospacer
*******.**.******************

375. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgagtcactgtcggaatcggagtcg	Protospacer
*******.***********.*********

376. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtcggagtccgaatcg	Protospacer
********************** **.***

377. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcgctgtcggagtcggaatcg	Protospacer
**********.**************.***

378. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgagtcactgtcagagtcggagtcg	Protospacer
*******.********.************

379. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcgctgtcggagtcagagtcg	Protospacer
**********.***********.******

380. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtcgctgtcggagtcg	Protospacer
*****************  **********

381. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcgctgtcggagtcagagtcg	Protospacer
**********.***********.******

382. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggagtcactgtcggagtcggagtcg	Protospacer
**** **.*********************

383. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtcggagtccgaatcg	Protospacer
********************** **.***

384. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgagtcactgtcagagtcggagtcg	Protospacer
*******.********.************

385. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgagtcgctgtcggagtcggagtcg	Protospacer
*******.**.******************

386. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggagtcggaatcg	Protospacer
*.***********************.***

387. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
**** ***************** ******

388. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
**** ***************** ******

389. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
**** ***************** ******

390. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
**** ***************** ******

391. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
**** ***************** ******

392. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggagtcg	Protospacer
*.*****************.*********

393. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggagtccgagtcg	Protospacer
*.******************** ******

394. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggagtcg	Protospacer
*.*****************.*********

395. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
agtcagagtcggaatcgctgtcagagtcggaatca	Protospacer
****.*********************** ******

396. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.943

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
agtcagagtcggaatcgctgtcagagtcggaatca	Protospacer
****.*********************** ******

397. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**** ***********************.

398. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
*******.***********.*********

399. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.** ************************

400. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
**** **.*********************

401. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
**** ***********.************

402. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
**** ***********.************

403. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
**** **************.*********

404. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
****.*****.******************

405. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
****.*****.******************

406. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
****.*****.******************

407. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcg	Protospacer
****.*****.******************

408. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
**** ***********.************

409. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
**** ***********.************

410. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcactgtcagagtccgaatcg	Protospacer
*******.**.******************

411. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatcg	Protospacer
**** ***************** ******

412. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
**** **.*********************

413. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
**** **.*********************

414. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtccgagtccgaatcg	Protospacer
**** *********** ************

415. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.** ************************

416. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**** ***********************.

417. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatcg	Protospacer
****.**.*********************

418. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcgctgtcagagtcagaatcg	Protospacer
*******.************** ******

419. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgaatcg	Protospacer
****.**************.*********

420. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatcg	Protospacer
**** **************.*********

421. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcgctgtcggagtccgaatcg	Protospacer
*******.********.************

422. spacer 2.44|2065841|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtccgaatcg	Protospacer
*.**.************************

423. spacer 2.44|2065841|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
*******.***********.*********

424. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcg	Protospacer
*.***********************.***

425. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcg	Protospacer
*.***********************.***

426. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
**** **************.*********

427. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** *****.******************

428. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** *****.******************

429. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagaatcggaatcg	Protospacer
*******************.** ******

430. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcactgtcagagtcggaatcg	Protospacer
**** ***************** ******

431. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggagtcactgtcggagtccgaatcg	Protospacer
*******.********.************

432. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcg	Protospacer
*.***********************.***

433. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcactgtcagagtcggaatcg	Protospacer
**** ***************** ******

434. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagaatcggaatcg	Protospacer
*******************.** ******

435. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggagtcactgtcagagtccgaatcg	Protospacer
*.*****.*********************

436. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** *****.******************

437. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** *****.******************

438. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcagagtcactgtcagagtccgaatcg	Protospacer
****.**.*********************

439. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** *****.******************

440. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcg	Protospacer
*.***********************.***

441. spacer 2.45|2065895|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtccgaatcg	Protospacer
*.********.******************

442. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
**** **************.*********

443. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggagtcactgtcagagtccgaatcg	Protospacer
*.*****.*********************

444. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatcg	Protospacer
*******.**.******************

445. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggagtcactgtcagagtccgaatcg	Protospacer
*.*****.*********************

446. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgaatcg	Protospacer
**********.********.*********

447. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgaatcg	Protospacer
*.*****************.*********

448. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggagtcactgtcagagtcggaatcg	Protospacer
*******.************** ******

449. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcggaatccgaatcg	Protospacer
****************.**.*********

450. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcactgtcggagtccgaatcg	Protospacer
**** ***********.************

451. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgagtcgctgtcggaatcc	Protospacer
**********.*****************************

452. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
agtcggaatcgctgtccgaatccgagtcgctgtcggaatcg	Protospacer
**************** **.*********************

453. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcggaatcg	Protospacer
**** **.*********************************

454. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.951

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
aatcggagtcgctgtcagagtccgagtcgctgtcggaatcg	Protospacer
*.*****.*********************************

455. spacer 2.46|2065949|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.951

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgagtcgctgtcggagtcg	Protospacer
*******.*****************************.***

456. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtca	Protospacer
*************************.**.

457. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
*******************.********.

458. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

459. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

460. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

461. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

462. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

463. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgaatcg	Protospacer
*.*****.*********************

464. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

465. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatcggagtcg	Protospacer
********************** **.***

466. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatccgagtcg	Protospacer
****************.********.***

467. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

468. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

469. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgaatcg	Protospacer
*.**************.************

470. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
****************.**.*********

471. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
****************.**.*********

472. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*******.**.******************

473. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
**************** ********.***

474. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

475. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgaatcg	Protospacer
*.************** ************

476. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*******.**.******************

477. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcagaatccgaatcg	Protospacer
*.********.******************

478. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgagtcg	Protospacer
**********.**************.***

479. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
****************.**.*********

480. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

481. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
****************.**.*********

482. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatcg	Protospacer
*******************.** ******

483. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

484. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*******.***********.*********

485. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgagtccgaatcg	Protospacer
**************** **.*********

486. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.*****************.*********

487. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatcggaatcg	Protospacer
**** ***************** ******

488. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
*******************.********.

489. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagcatccgaatcg	Protospacer
**********.******* **********

490. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagcatccgagtcg	Protospacer
****************** ******.***

491. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgagtcg	Protospacer
**********.**************.***

492. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*******.**.******************

493. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

494. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

495. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*.***********************.***

496. spacer 2.47|2066015|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

497. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcactgtcagaatccgaatcg	Protospacer
*******.**.******************

498. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

499. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.** ************************

500. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.** ************************

501. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcactgtcagaatccgaatcg	Protospacer
*******.**.******************

502. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
**** *****.******************

503. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

504. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

505. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtccgaatcg	Protospacer
****.**************.*********

506. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**** ********************.***

507. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**** *********** ************

508. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**** *********** ************

509. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**** ********************.***

510. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**** *********** ************

511. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**** ********************.***

512. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgaatcg	Protospacer
**** *********** ************

513. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**** ********************.***

514. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**** ********************.***

515. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcg	Protospacer
**** ********************.***

516. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

517. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

518. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcg	Protospacer
**** **************.*********

519. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

520. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatcggaatcg	Protospacer
****.***************** ******

521. spacer 2.48|2066069|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

522. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatccgaatcg	Protospacer
 ******.*********************

523. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
**** ***********************.

524. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagaatcgctgtcagaatccgagtca	Protospacer
*************************.**.

525. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
**** ***********************.

526. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgaatcg	Protospacer
**** *****.******************

527. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcg	Protospacer
**** **.*********************

528. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgagtcg	Protospacer
*******.*****************.***

529. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagcatccgaatcg	Protospacer
*******.********** **********

530. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagcatccgaatcg	Protospacer
**** ************* **********

531. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggagtcgctgtcagaatccgaatcg	Protospacer
****.**.*********************

532. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

533. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

534. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

535. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

536. spacer 2.49|2066123|29|CP031810|CRT matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

537. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

538. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

539. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

540. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 2, identity: 0.931

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggagtcg	Protospacer
*************************.**.

541. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtccgagtcagagtcg	Protospacer
*******************.**.******

542. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatcggagtca	Protospacer
**********.*****************.

543. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatccgagtcg	Protospacer
**********.*********** ******

544. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatcggaatcactgtccgaatccgagtcg	Protospacer
*.******************** ******

545. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatccgagtcg	Protospacer
**********.*********** ******

546. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatccgagtcg	Protospacer
**********.*********** ******

547. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtcagaatcggaatcg	Protospacer
**************** ********.***

548. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatccgagtcg	Protospacer
**********.*********** ******

549. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcactgtcagaatcggaatcg	Protospacer
**************** ********.***

550. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtcagaatcggagtcg	Protospacer
**********.***** ************

551. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtcagaatcggagtcg	Protospacer
**********.***** ************

552. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatcggaatcg	Protospacer
**********.**************.***

553. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggagtcg	Protospacer
**** *********** ************

554. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggagtcg	Protospacer
**** *********** ************

555. spacer 2.50|2066177|29|CP031810|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtctgaatcactgtctgaatcggagtcg	Protospacer
**** ***********.************

556. spacer 2.50|2066177|29|CP031810|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtctgaatcactgtctgaatcggagtcg	Protospacer
**** ***********.************

557. spacer 2.50|2066177|29|CP031810|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtctgaatcactgtctgaatcggagtcg	Protospacer
**** ***********.************

558. spacer 2.50|2066177|29|CP031810|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtctgaatcactgtctgaatcggagtcg	Protospacer
**** ***********.************

559. spacer 2.50|2066177|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.931

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtctgaatcactgtctgaatcggagtcg	Protospacer
**** ***********.************

560. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcagagtcagagtcg	Protospacer
*.************** ************

561. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgaatcgctgtccgagtcagagtcg	Protospacer
**** **.*********************

562. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgaatcgctgtccgagtcagagtcg	Protospacer
**** **.*********************

563. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgagtcgctgtccgagtcggagtcg	Protospacer
**** *****************.******

564. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggaatcgctgtccgagtcagagtcg	Protospacer
*.*****.*********************

565. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggagtcgctgtccgagtcactgtcg	Protospacer
***********************  ****

566. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgaatcgctgtccgagtcagagtcg	Protospacer
**** **.*********************

567. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggagtcgctgtcagagtccgagtcg	Protospacer
**************** ***** ******

568. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggaatcactgtccgagtcagagtcg	Protospacer
*******.**.******************

569. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcggagtcgctgtccgagtccgaatcg	Protospacer
********************** **.***

570. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcagagtcgctgtccgagtcggagtcg	Protospacer
****.*****************.******

571. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcagagtcgctgtctgagtcagagtcg	Protospacer
****.***********.************

572. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtctgagtcgctgtctgagtcagagtcg	Protospacer
**** ***********.************

573. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtctgagtcgctgtctgagtcagagtcg	Protospacer
**** ***********.************

574. spacer 2.51|2066231|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.931

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgaatcgctgtccgagtcagagtcg	Protospacer
**** **.*********************

575. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtcagagtccgagtcgctgtcagaatccgagtcg	Protospacer
*******************.*****************.********.

576. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****************************************.**.

577. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtccgaatccgagtcgctgtcagaatccgagtcg	Protospacer
**************** ********************.********.

578. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcgctgtcggagtcggagtcg	Protospacer
**********************************.***** *****.

579. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcgctgtcagagtccgagtcg	Protospacer
*.*****.**************************************.

580. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcgctgtcagagtccgagtcg	Protospacer
**************** ********.********************.

581. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
*******.***********.**************************.

582. spacer 2.14|2063603|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
*******.***********.**************************.

583. spacer 2.14|2063603|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtcagagtcgctgtcagaatccgagtcgctgtcagagtccgagtcc	Protospacer
*.** *****************************************

584. spacer 2.14|2063603|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcactgtcagaatccgaatcgctgtcagagtccgagtcg	Protospacer
**********.**************.********************.

585. spacer 2.14|2063603|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgagtcgctgtcggaatccgagtcactgtcagagtccgagtcg	Protospacer
****************.***********.*****************.

586. spacer 2.14|2063603|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcgctgtcagagtcggagtcg	Protospacer
*******.******************************** *****.

587. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
tgtcggagtcgctgtcagagtccgagtcgctgtcggaatcc	Protospacer
 ******************.**************.******

588. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatcggagtcgctgtcagagtccgaatcgctgtcagaatcc	Protospacer
*.*****************.*****.***************

589. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcgctgtcagagtcc	Protospacer
*.** ********************************.***

590. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatccgagtcgctgtcagagtccgagtcgctgtcagaatcc	Protospacer
*.** **************.*********************

591. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatccgagtcgctgtccgaatccgagtcgctgtcagaatcc	Protospacer
*.** *********** ************************

592. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcgctgtcagaatcc	Protospacer
*.**************.**.*********************

593. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctatccgagtcagaatcc	Protospacer
*******************.** ***********

594. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtcggaatca	Protospacer
*************.**************.*****.

595. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtcagagtca	Protospacer
*******.***********************.**.

596. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtcagagtca	Protospacer
*******.***********************.**.

597. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtccgaatca	Protospacer
*******.******************** *****.

598. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgagtcgctgtcagagtccgaatca	Protospacer
*************.************** *****.

599. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtccgagtccgaatca	Protospacer
********************** ***** *****.

600. spacer 2.16|2063741|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcggaatccgaatcgctgtcagagtccgaatca	Protospacer
****.*********************** *****.

601. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgagtcgctgtccgaatcc	Protospacer
********************** *********** *****

602. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgagtcgctgtcagaatcc	Protospacer
********************** ***********.*****

603. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtcgctgtcggaatcg	Protospacer
*.**************.***** ******************

604. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcgctgtcggaatcg	Protospacer
*.******************** **.***************

605. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatccgaatcgctgtccgagtcagagtcgctgtcggaatcc	Protospacer
*******.******** ***********************

606. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
catccgagtcgctgtcggagtcagagtcgctgtccgaatcg	Protospacer
 ***************.***************** ******

607. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcagagtcgctgtcggagtcc	Protospacer
*******.*****************************.**

608. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
aatcggagtcgctgtcagagtcagagtcactgtcggaatcc	Protospacer
**** ***********************.***********

609. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.927

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtcagagtcgctgtcagagtcagaatcgctgtcggaatcg	Protospacer
*.** ********************.***************

610. spacer 2.24|2064449|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
aatccgagtcgctgtcagagtccgagtcgctgtcagaatccgagtcg	Protospacer
 ******.**************************** **********

611. spacer 2.24|2064449|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
 *********************************** .*********

612. spacer 2.24|2064449|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcgctgtcagagtccgagtcg	Protospacer
 *********************************** .*********

613. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtca	Protospacer
**********.**************.**.

614. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtccgaatccgagtca	Protospacer
**************** ********.**.

615. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatca	Protospacer
*.*****.********************.

616. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**********.********.********.

617. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.********.********.*********

618. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgaatcg	Protospacer
*.*****.**.******************

619. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgaatcg	Protospacer
*.********.*****.************

620. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgaatcg	Protospacer
*.** **************.*********

621. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgaatcg	Protospacer
*.********.***** ************

622. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgagtcg	Protospacer
*.** ********************.***

623. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.********.********.*********

624. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**********.********.********.

625. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtccgaatccgagtca	Protospacer
**************** ********.**.

626. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggagtccgaatcg	Protospacer
*.**************.**.*********

627. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*.********.**************.***

628. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggagtccgaatcg	Protospacer
*.**************.**.*********

629. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*.********.**************.***

630. spacer 2.25|2064521|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatca	Protospacer
**** **************.********.

631. spacer 2.25|2064521|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatcggagtca	Protospacer
********************** **.**.

632. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatcggaatca	Protospacer
*.******************** *****.

633. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtca	Protospacer
*******************.*****.**.

634. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgaatca	Protospacer
*.*****************.********.

635. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtca	Protospacer
*******************.*****.**.

636. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtccgagtccgaatca	Protospacer
**************** **.********.

637. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatcggaatca	Protospacer
*******.************** *****.

638. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgagtcg	Protospacer
*.*****************.*****.***

639. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgagtccgaatcg	Protospacer
*.************** **.*********

640. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
*.*****************.** ******

641. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
*.*****************.** ******

642. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
*.*****************.** ******

643. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.*****.********.************

644. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.*****.********.************

645. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.*****.*****************.***

646. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.*****.*****************.***

647. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcgctatccgaatcg	Protospacer
*.***************  **********

648. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcactgtcggagtccgaatcg	Protospacer
*.********.********.*********

649. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*.**************.********.***

650. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

651. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

652. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

653. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*.**************.********.***

654. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggagtccgaatcg	Protospacer
*.*****.***********.*********

655. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

656. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
*.*****************.** ******

657. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

658. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

659. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgaatcg	Protospacer
*.*****.******** ************

660. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.*****.*****************.***

661. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

662. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.*****.*****************.***

663. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*.**************.********.***

664. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.*****.*****************.***

665. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.*****.*****************.***

666. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

667. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgagtccgaatcg	Protospacer
*.************** **.*********

668. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

669. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.**.*********

670. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtccgagtcg	Protospacer
*.*****************.*****.***

671. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggagtcggaatcg	Protospacer
*.*****************.** ******

672. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatccgaatcg	Protospacer
 *** ***********.************

673. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcggagtcgctgtccgaatccgaatca	Protospacer
**** *********** ***********.

674. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcggaatccgagtca	Protospacer
**** ********************.**.

675. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcagagtcgctgtccgaatccgaatca	Protospacer
**** *********** ***********.

676. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggaatccgaatca	Protospacer
*******.**.*****************.

677. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
*******.********.***********.

678. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatccgagtca	Protospacer
*.***********************.**.

679. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtctgagtcgctgtcagaatccgaatca	Protospacer
****.***********.***********.

680. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtca	Protospacer
*******************.*****.**.

681. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcggagtcggaatca	Protospacer
*******************.** *****.

682. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtcggagtcgctgtccgaatccgaatca	Protospacer
**** *********** ***********.

683. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
*******.********.***********.

684. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
*.*****.**.******************

685. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatcggagtcgctgtcagaatccgaatcg	Protospacer
*.** ***********.************

686. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatcg	Protospacer
*.********.*****.************

687. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcggaatcggagtcg	Protospacer
*.******************** **.***

688. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatcggagtcactgtcggaatccgaatcg	Protospacer
*.** *****.******************

689. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
*.*****.**.******************

690. spacer 2.27|2064629|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
agtcagagtcgctgtcagaatcggagtcg	Protospacer
*.*********  ****************

691. spacer 2.27|2064629|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
agtcagagtcgctgtcagaatcggagtcg	Protospacer
*.*********  ****************

692. spacer 2.27|2064629|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
agtcagagtcgctgtcagaatcggagtcg	Protospacer
*.*********  ****************

693. spacer 2.27|2064629|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
agtcagagtcgctgtcagaatcggagtcg	Protospacer
*.*********  ****************

694. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcgctgtcagaatccgagtcg	Protospacer
*.*****************.*****.*********************

695. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
agtcggaatcactgtcagagtccgagtcgctgtcggaatccgagtcg	Protospacer
*.*****************.**************.************

696. spacer 2.28|2064683|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatcgctgtcagaatccgagtcg	Protospacer
*.*****************.*****.*********************

697. spacer 2.28|2064683|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatcggaatcactgtcagaatccgagtcgctgtcagaatccgagtcg	CRISPR spacer
agtcggaatcactgtcagaatcggagtcgctgtccgaatccgagtcg	Protospacer
*.******************** *********** ************

698. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtccgaatcggagtca	Protospacer
**** **************.********.

699. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtccgaatcggagtca	Protospacer
**** **************.********.

700. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcactgtccgaatcggagtca	Protospacer
**********.********.********.

701. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtccgaatcggagtca	Protospacer
**** **************.********.

702. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtccgaatcggagtca	Protospacer
**** **************.********.

703. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcactgtccgaatcggagtca	Protospacer
**********.********.********.

704. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatccgagtcgctgtccgaatcggagtca	Protospacer
**** **************.********.

705. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtccgagtccgaatca	Protospacer
********************** **.**.

706. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
catccgagtcgctgtccgagtcagagtcg	Protospacer
 *** *****************.******

707. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
aatcggagtcgctgtcagagtcagagtca	Protospacer
**************** *****.*****.

708. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcagagtcgctgtcggagtcggagtcg	Protospacer
*.**.*********** ************

709. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtccgagtcgctgtccgagtcagagtcg	Protospacer
*.** *****************.******

710. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcagagtcgctgtccgaatcggagtcg	Protospacer
*.**.**************.*********

711. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcggagtcgctgtcagagtccgagtcg	Protospacer
*.************** ***** ******

712. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcggagtcgctgtccgagtccgaatcg	Protospacer
*.******************** **.***

713. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcagaatcgctgtccgagtcggagtcg	Protospacer
*.**.**.*********************

714. spacer 2.29|2064755|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtccgagtcgctgtcggagtcggagtcg	Protospacer
*.** *********** ************

715. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggagtccgagtca	Protospacer
 ********* ***********************.

716. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggagtccgagtca	Protospacer
 ********* ***********************.

717. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggaatcgctgtcggaatccgagtcg	Protospacer
 ************.***********.*********

718. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggaatcgctgtcggaatccgagtcg	Protospacer
 ************.***********.*********

719. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcagaatcggagtcgctgtcggagtccgagtcg	Protospacer
 ***.**.***************************

720. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggagtcgctgtcagaatccgagtcg	Protospacer
 *********************.**.*********

721. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcagaatcggagtcgctgtcggagtccgagtcg	Protospacer
 ***.**.***************************

722. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggaatccgagtcg	Protospacer
 ********* **************.*********

723. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggaatccgagtcg	Protospacer
 ********* **************.*********

724. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggaatccgagtcg	Protospacer
 ********* **************.*********

725. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggagtcactgtcggagtccgaatcg	Protospacer
 ***************.**************.***

726. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcagaatcggagtcgctgtcggagtccgagtcg	Protospacer
 ***.**.***************************

727. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcagaatcggagtcgctgtcggagtccgagtcg	Protospacer
 ***.**.***************************

728. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggaatcgctgtcggaatccgagtcg	Protospacer
 ************.***********.*********

729. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggaatcggagtcgctgtcagagtccgagtcg	Protospacer
 ******.**************.************

730. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcagagtccgagtcg	Protospacer
 ********* ***********.************

731. spacer 2.31|2064899|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcgctgtcggagtccgagtca	Protospacer
 ********* ***********************.

732. spacer 2.31|2064899|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggagtcgctgtcagagtccgaatcg	Protospacer
 *********************.********.***

733. spacer 2.31|2064899|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcagagtcggaatcgctgtcggagtccgagtcg	Protospacer
 ***.********.*********************

734. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tatccgaatcgctgtcggagtcggaatcg	Protospacer
 ******.********************.

735. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tatccgaatcgctgtcggagtcggaatcg	Protospacer
 ******.********************.

736. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgagtcg	Protospacer
********************** **.**.

737. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtccgaatcg	Protospacer
*.******************** *****.

738. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgagtccgaatcg	Protospacer
**************** ***** *****.

739. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcactgtcggagtccgaatcg	Protospacer
**********.*********** *****.

740. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

741. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggagtccgaatcg	Protospacer
*******.************** *****.

742. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

743. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatcggagtcactgtcggagtcggaatcg	Protospacer
**** *****.*****************.

744. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

745. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tatccgaatcgctgtcagagtcggaatca	Protospacer
 ******.********.************

746. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

747. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

748. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtccgagtccgaatcg	Protospacer
**************** ***** *****.

749. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

750. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
****************.***** *****.

751. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcagagtcggaatcg	Protospacer
*******.********.***********.

752. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtctgagtcggaatcg	Protospacer
*.************** ***********.

753. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tatccgagtcgctgtcagagtcggagtca	Protospacer
 ***************.********.***

754. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggagtccgagtcg	Protospacer
********************** **.**.

755. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatcggagtcactgtcggagtcggaatcg	Protospacer
**** *****.*****************.

756. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtcggaatcg	Protospacer
*.**************.***********.

757. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatcggagtcactgtcggagtcggaatcg	Protospacer
**** *****.*****************.

758. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatcggagtcgctgtcagagtcggaatcg	Protospacer
**** ***********.***********.

759. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtccgagtca	Protospacer
*.******************** **.***

760. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtccgagtca	Protospacer
*.******************** **.***

761. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtcggagtca	Protospacer
*.**************.********.***

762. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtccgagtccgaatca	Protospacer
*.************** ***** ******

763. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggaatcggaatca	Protospacer
*.*****.***********.*********

764. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtccgaatcg	Protospacer
*.******************** *****.

765. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtctgagtcgctgtcggagtcggaatcg	Protospacer
*.**.***********************.

766. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcggaatcggagtcg	Protospacer
*******************.*****.**.

767. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcgctgtcagagtcggagtcg	Protospacer
****************.********.**.

768. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtccgagtca	Protospacer
*.******************** **.***

769. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
*.*****.********.************

770. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
*.*****.********.************

771. spacer 2.33|2065037|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtcggagtcg	Protospacer
*.***********************.**.

772. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagagtccgagtcg	Protospacer
 ******************.*****.***

773. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtca	Protospacer
*.***********************.**.

774. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatca	Protospacer
*******.**.*****************.

775. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
*.*****************.********.

776. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
*.** **.*********************

777. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

778. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

779. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

780. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

781. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatcggagtcg	Protospacer
*.******************** **.***

782. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

783. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
*.*****.*****************.***

784. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

785. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.**************.**.*********

786. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.**************.**.*********

787. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*.*****.**.******************

788. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

789. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtccgaatcg	Protospacer
*.** **************.*********

790. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*.*****.**.******************

791. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgagtcg	Protospacer
*.********.**************.***

792. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.**************.**.*********

793. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagaatccgagtcg	Protospacer
*.*****.*****************.***

794. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.**************.**.*********

795. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatcg	Protospacer
*.*****************.** ******

796. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

797. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

798. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgagtccgaatcg	Protospacer
*.************** **.*********

799. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatcggaatcg	Protospacer
*.** ***************** ******

800. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatca	Protospacer
*******.***********.********.

801. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgaatcgctgtcggagtccgaatcg	Protospacer
 ***************.**.*********

802. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
*.*****************.********.

803. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgagtccgaatca	Protospacer
**************** **.********.

804. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgaatcgctgtcagcatccgagtcg	Protospacer
 ***************** ******.***

805. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatcggaatca	Protospacer
****************.***** *****.

806. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagcatccgaatcg	Protospacer
*.********.******* **********

807. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagcatccgagtcg	Protospacer
*.**************** ******.***

808. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcagaatccgagtcg	Protospacer
*.********.**************.***

809. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgagtcactgtcagaatccgaatcg	Protospacer
*.*****.**.******************

810. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggagtcgctgtcagaatccgaatcg	Protospacer
*.** **.*********************

811. spacer 2.34|2065091|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcggaatca	Protospacer
*******************.** *****.

812. spacer 2.34|2065091|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagaatccgaatcg	Protospacer
*.** **.*********************

813. spacer 2.35|2065145|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

agtcggagtcgctgtcggagtccgaatcactgtcggaatcagagtcg	CRISPR spacer
aatcggagtcgctgtccgagtccgaatcactgtcggaatcggagtcg	Protospacer
*.************** ***********************.******

814. spacer 2.37|2065301|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
catccgaatcgctgtcggagtccgaatcgctgtcagagtccgaatca	Protospacer
 *********.***************************** ******

815. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
aatcggaatcactgtcggagtccgaatcactgtcagagtcggaatcg	Protospacer
**** ***********************.*****************.

816. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
aatcggaatcactgtcggagtccgaatcactgtcagagtcggaatcg	Protospacer
**** ***********************.*****************.

817. spacer 2.39|2065481|59|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.949

agtcgctgtccgaatccgaatcactgtcggagtccgaatcgctgtcagagtccgaatca	CRISPR spacer
agtcgctgtccgaatccgaatcactgtcggagtccgagtcgctgtcagaatccgaatcg	Protospacer
*************************************.***********.********.

818. spacer 2.39|2065481|59|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.949

agtcgctgtccgaatccgaatcactgtcggagtccgaatcgctgtcagagtccgaatca	CRISPR spacer
aatcgctgtccgaatccgaatcactgtcggagtccgagtcgctgtcagagtcggaatca	Protospacer
*.***********************************.************** ******

819. spacer 2.41|2065655|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcggaatcggaatca	Protospacer
*.** *****************************************.

820. spacer 2.41|2065655|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.936

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
aatcggagtcactgtcggagtccgagtcgctgtcggaatcggaatca	Protospacer
**********.*****.*****************************.

821. spacer 2.41|2065655|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgagtcgctgtcggagtcggaatca	Protospacer
*.***********************************.********.

822. spacer 2.41|2065655|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.936

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatcactgtcggaatcggaatcg	Protospacer
*.***********************.**.******************

823. spacer 2.41|2065655|47|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.936

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatcactgtcggaatcggaatcg	Protospacer
*.***********************.**.******************

824. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggagtca	Protospacer
*.*****************.********.

825. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggaatcg	Protospacer
*.*****************.*****.***

826. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggagtccgaatcg	Protospacer
*.******************** **.***

827. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcactgtccgaatcggagtca	Protospacer
**************** **.********.

828. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatccgaatcgctgtcggagtccgagtca	Protospacer
**********.*********** *****.

829. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
tatccgaatcgctgtcggagtcggaatcg	Protospacer
 *********.**************.***

830. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
tatccgaatcgctgtcggagtcggaatcg	Protospacer
 *********.**************.***

831. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
aatcggaatcactgtcggagtcggaatca	Protospacer
**** ********************.**.

832. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcagagtcggaatcg	Protospacer
*.**************.********.***

833. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcagagtcggaatcg	Protospacer
*.**************.********.***

834. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcgctgtcggaatcggagtcg	Protospacer
*.********.********.*********

835. spacer 2.42|2065727|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgagtcgctgtcggagtcggagtcg	Protospacer
*.*****.**.******************

836. spacer 2.42|2065727|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggaatcg	Protospacer
*.*****************.*****.***

837. spacer 2.43|2065781|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtccgaatca	Protospacer
 ********* *****************.******

838. spacer 2.43|2065781|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtcggaatca	Protospacer
 ********* ***************** ******

839. spacer 2.43|2065781|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.914

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtcggaatca	Protospacer
 ********* ***************** ******

840. spacer 2.43|2065781|35|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.914

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtcggagtcgctgtcagagtccgaatca	Protospacer
 ************.**************.******

841. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtcggaatca	Protospacer
****.***************** *****.

842. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtcggaatca	Protospacer
****.***************** *****.

843. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcactgtcagagtccgaatca	Protospacer
*******.**.*****************.

844. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtccgagtccgaatca	Protospacer
****.*********** ***********.

845. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.** **************.*********

846. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgaatcg	Protospacer
*.** **************.*********

847. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcggagtcgctgtcagagtccgaatcg	Protospacer
*.**.**.*********************

848. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

849. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcggagtccgaatcg	Protospacer
*.** ***********.************

850. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgaatcg	Protospacer
*.**.*****.******************

851. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

852. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

853. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtcggaatcg	Protospacer
*.**.***************** ******

854. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcactgtcagagtccgaatcg	Protospacer
*.*****.**.******************

855. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

856. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

857. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

858. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.** **.*********************

859. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcggaatcg	Protospacer
*.** ***************** ******

860. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*.** ********************.***

861. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatccgaatcg	Protospacer
 ******.***********.*********

862. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtctgaatca	Protospacer
****.*****************.*****.

863. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgagtca	Protospacer
**** ********************.**.

864. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagagtcgctgtccgagtccgaatca	Protospacer
*******.******** ***********.

865. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
**** **************.********.

866. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatca	Protospacer
****.**.********************.

867. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcagaatcgctgtcagaatccgagtca	Protospacer
*******************.*****.**.

868. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatca	Protospacer
*.** ***********************.

869. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
**** ***************** *****.

870. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgaatca	Protospacer
**** **************.********.

871. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
**** ***************** *****.

872. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*.** ********************.***

873. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*.** ********************.***

874. spacer 2.44|2065841|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatca	Protospacer
****.**.********************.

875. spacer 2.44|2065841|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtccgaatca	Protospacer
****.*****.*****************.

876. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatcg	Protospacer
*.*****.**************.******

877. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatcg	Protospacer
*.*****.**************.******

878. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatcg	Protospacer
*.*****.**************.******

879. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatcg	Protospacer
*.*****.**************.******

880. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatcg	Protospacer
*.*****.**************.******

881. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgaatca	Protospacer
*.**************.***********.

882. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtcggaatca	Protospacer
**********.*********** *****.

883. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtcggaatca	Protospacer
**********.*********** *****.

884. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcagagtcactgtcagagtccgaatca	Protospacer
****.**.********************.

885. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgaatca	Protospacer
*.**************.***********.

886. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgaatca	Protospacer
*.**************.***********.

887. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtccgagtccgaatca	Protospacer
**********.***** ***********.

888. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcggagtcggaatca	Protospacer
****************.***** *****.

889. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggagtcactgtcggagtccgaatca	Protospacer
*******.********.***********.

890. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtca	Protospacer
*.***********************.**.

891. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**** *****.*****************.

892. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.** *****.******************

893. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggagtcactgtcggagtccgaatcg	Protospacer
*.*****.********.************

894. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggagtcgctgtcagagtccgaatcg	Protospacer
*.*****.**.******************

895. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtcggaatcg	Protospacer
*.********.*********** ******

896. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcagagtcactgtcagagtccgaatcg	Protospacer
*.**.**.*********************

897. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
*.**************.********.***

898. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
*.**************.********.***

899. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
*.**************.********.***

900. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
*.**************.********.***

901. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatccgaatcactgtcagaatccgaatcg	Protospacer
*.** **************.*********

902. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcg	Protospacer
*.**************.********.***

903. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgagtcg	Protospacer
*.*****************.*****.***

904. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.** *****.******************

905. spacer 2.45|2065895|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatca	Protospacer
*******.**.*****************.

906. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcgctgtcagagtctgaatca	Protospacer
**********.***********.*****.

907. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**** *****.*****************.

908. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggagtcgctgtcagagtccgaatca	Protospacer
*******.**.*****************.

909. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatccgaatcactgtcggagtccgaatcg	Protospacer
*.** ***********.************

910. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggagtcactatcagagtccgaatcg	Protospacer
*.*****.*****.***************

911. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatccgaatcactgtcggagtccgaatcg	Protospacer
*.** ***********.************

912. spacer 2.45|2065895|29|CP031810|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatctgaatcactgtctgagtccgaatcg	Protospacer
*.** *********** ************

913. spacer 2.45|2065895|29|CP031810|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatctgaatcactgtctgagtccgaatcg	Protospacer
*.** *********** ************

914. spacer 2.45|2065895|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatctgaatcactgtctgagtccgaatcg	Protospacer
*.** *********** ************

915. spacer 2.45|2065895|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatctgaatcactgtctgagtccgaatcg	Protospacer
*.** *********** ************

916. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
tgtcggagtcgctgtcagagtccgagtcgctgtcggaatcc	Protospacer
 ******.********************************

917. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.927

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
agtcggaatcgctgtcagagtccgaatcgctgtcagaatcc	Protospacer
*************************.********.*****

918. spacer 2.46|2065949|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.927

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
agtcggaatcgctgtcggagtccgagtcgctgtcggagtcc	Protospacer
****************.********************.**

919. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 .***********************.***

920. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 .***********************.***

921. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtca	Protospacer
**************** ********.**.

922. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatcggagtca	Protospacer
********************** **.**.

923. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatcggaatca	Protospacer
****************.***** *****.

924. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.*****.******** ************

925. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

926. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

927. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgagtcg	Protospacer
*.************** ********.***

928. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

929. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.*****.******** ************

930. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*.*****.*****************.***

931. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

932. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*.*****.*****************.***

933. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggagtccgaatcg	Protospacer
*.**************.**.*********

934. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

935. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

936. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

937. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

938. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

939. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

940. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcg	Protospacer
*.*****.*****************.***

941. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

942. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgagtcg	Protospacer
*.**************.********.***

943. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

944. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********.*********

945. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.*****.******** ************

946. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcggaatcg	Protospacer
*.*****************.** ******

947. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatccgaatcg	Protospacer
*.*****.******** ************

948. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*.*****************.*****.***

949. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
*.** ***************** ******

950. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
*.** ***************** ******

951. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
*.** ***************** ******

952. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatccgaatcg	Protospacer
 *** **.*********************

953. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgagtca	Protospacer
*******************.*****.**.

954. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggaatccgaatca	Protospacer
**********.*****.***********.

955. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgagtca	Protospacer
**** ********************.**.

956. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagaatcgctgtcagaatccgagtca	Protospacer
**** ********************.**.

957. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtctgagtcgctgtcagaatccgaatca	Protospacer
****.**.********************.

958. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatca	Protospacer
*.*****************.********.

959. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
*******************.** *****.

960. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtca	Protospacer
*.***********************.**.

961. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
*******************.** *****.

962. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*.*****************.*****.***

963. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
*.********.*****.************

964. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggagtcgctgtcagaatccgaatcg	Protospacer
*.** **.*********************

965. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatcg	Protospacer
*.*****.**.******************

966. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgagtcg	Protospacer
*.*****************.*****.***

967. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgaatcg	Protospacer
*.** *****.******************

968. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcggaatccgaatcg	Protospacer
*.********.*****.************

969. spacer 2.47|2066015|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtccgaatcg	Protospacer
*.** **************.*********

970. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatccgagtca	Protospacer
**** ********************.**.

971. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**** **************.********.

972. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.** **************.*********

973. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagaatccgaatcg	Protospacer
*.** **.*********************

974. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatccgaatcg	Protospacer
*.** ***********.************

975. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgaatccgaatcg	Protospacer
*.** *********** ************

976. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
*.**.***************** ******

977. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
*.**.***************** ******

978. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagaatcggaatcg	Protospacer
*.**.***************** ******

979. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcactgtcagaatccgaatcg	Protospacer
*.** *****.******************

980. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatcg	Protospacer
*.** **************.*********

981. spacer 2.48|2066069|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcgctgtcagagtccgaatcg	Protospacer
*.**.**************.*********

982. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtccgaatccgaatca	Protospacer
*******.******** ***********.

983. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgaatca	Protospacer
**** **************.********.

984. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgagtca	Protospacer
****.********************.**.

985. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagagtcgctgtcagcatccgaatca	Protospacer
*******.********** *********.

986. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
agtctgagtcgctgtcagaatccgaatca	Protospacer
**** **.********************.

987. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggagtcgctgtcagaatccgaatcg	Protospacer
*.**.**.*********************

988. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*.** ********************.***

989. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatcggaatcactgtcagaatccgaatcg	Protospacer
*.**.*****.******************

990. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtcg	Protospacer
*.** ********************.***

991. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtcggagtcggagtcggagtcg	Protospacer
 ************************.**.

992. spacer 2.49|2066123|29|CP031810|CRT matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggacttg	Protospacer
************************* *..

993. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtcggagtcggagtcggagtcg	Protospacer
 ************************.**.

994. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtcggagtcagagtcggaatcc	Protospacer
 ***************.***********

995. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcagagtcggagtcggagtccgaatca	Protospacer
 ***.***************** ******

996. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
ggtcggagtcggagtcggagtcggagtcg	Protospacer
.************************.**.

997. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggggtcggagtcggagtcggagtcg	Protospacer
******.******************.**.

998. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggcgtcg	Protospacer
************************ .**.

999. spacer 2.49|2066123|29|CP031810|CRT matches to JQ807233 (Environmental Halophage eHP-12, partial genome) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggattcggagtcggagtcggattcg	Protospacer
******* ***************** **.

1000. spacer 2.49|2066123|29|CP031810|CRT matches to JQ807233 (Environmental Halophage eHP-12, partial genome) position: , mismatch: 3, identity: 0.897

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggattcggagtcggagtcg	Protospacer
************* ***********.**.

1001. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
tgtcggaatcgctgtccgaatcggagtca	Protospacer
 *********.*****************.

1002. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtccgaatcactgtccgaatccgagtca	Protospacer
**** ***************** *****.

1003. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtccgaatcactgtcggaatcggagtca	Protospacer
**** *********** ***********.

1004. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatccgaatcactgtccgaatcggagtca	Protospacer
*.** ***********************.

1005. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatcggagtcactgtccgaatcggagtca	Protospacer
*.*****.********************.

1006. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatcggagtcactgtccgaatcggagtca	Protospacer
*.*****.********************.

1007. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtccgaatcactgtccgaatccgagtca	Protospacer
**** ***************** *****.

1008. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatcggagtcactgtccgaatccgagtcg	Protospacer
*.*****.************** ******

1009. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatcggaatcactgtcagaatccgagtcg	Protospacer
*.************** ***** ******

1010. spacer 2.50|2066177|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
agtccgaatcactgtcagaatcggagtca	Protospacer
**** *********** ***********.

1011. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
catccgagtcgctgtccgagtcagagtcg	Protospacer
 .** ************************

1012. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgagtcgctgtccgagtccgagtcc	Protospacer
**** ***************** *****

1013. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcagagtcagagtca	Protospacer
*.************** ***********.

1014. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatccgaatcgctgtccgagtcagagtcg	Protospacer
*.** **.*********************

1015. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtccgaatccgagtcg	Protospacer
*.*****************.** ******

1016. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcagagtcagaatcg	Protospacer
*.************** ********.***

1017. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcagagtcgctgtctgagtcagagtcg	Protospacer
*.**.***********.************

1018. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtccgagtcgctgtcagagtcagagtca	Protospacer
**** *********** ***********.

1019. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
tgtcggagtcgctgtcagagtccgagtcg	Protospacer
 *************** ***** ******

1020. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
*.************** ***** ******

1021. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
*.************** ***** ******

1022. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
*.************** ***** ******

1023. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcggagtccgagtcg	Protospacer
*.************** ***** ******

1024. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtcagagtccgagtcg	Protospacer
*.************** ***** ******

1025. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtctgagtctgagtcg	Protospacer
*.**************.***** ******

1026. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtctgagtctgagtcg	Protospacer
*.**************.***** ******

1027. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.897

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtctgagtctgagtcg	Protospacer
*.**************.***** ******

1028. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
 ******.***********************************.**.

1029. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtccgaatccgagtcgctgtcagaatccgagtcg	Protospacer
*.************** ********************.********.

1030. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtcggaatccgagtcactgtcagagtccgagtcg	Protospacer
*.**************.***********.*****************.

1031. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********************************.**.

1032. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtccgaatccgagtcgctgtcagaatccgagtcg	Protospacer
*.************** ********************.********.

1033. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********************************.**.

1034. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgaatcgctgtcagaatccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****.***********************************.**.

1035. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtctgagtccgagtcg	Protospacer
*.*****************.************** ***********.

1036. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****************.***********************.**.

1037. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcagagtccgaatcg	Protospacer
*.*****************.***********************.**.

1038. spacer 2.14|2063603|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgagtcgctgtcagaatccgagtcgctgtcagagtccgagtca	CRISPR spacer
agtccgagtcgctgtcagaatccgaatcgctgtcagagtccgaatcg	Protospacer
*.***********************.*****************.**.

1039. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatccgagtcgctgtcagaatccgagtcgctgtcagagtcg	Protospacer
*.** ********************************.**

1040. spacer 2.15|2063675|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatcggagtcgctgtcagagtccgagtcgctgtcggaatcg	Protospacer
*.*****************.**************.*****

1041. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcagaatcc	Protospacer
*.******************** ***********.*****

1042. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtcggaatcgctgtcggaatcc	Protospacer
*.********************.**.**************

1043. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
catccgagtcgctgtccgagtcagagtcgctgtccgaatcc	Protospacer
 *************** ***************** *****

1044. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtcagagtccgagtcgctgtcggagtcc	Protospacer
*.******************** **************.**

1045. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcgctgtccgagtcagagtcgctgtcagaatcc	Protospacer
*.************** *****************.*****

1046. spacer 2.17|2063801|41|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgagtcactgtcagagtccgagtcgctgtcggaatcc	Protospacer
*.********.*********** *****************

1047. spacer 2.17|2063801|41|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.902

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcagagtcgctgtcagaatcc	Protospacer
*.*****.**************************.*****

1048. spacer 2.24|2064449|47|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.915

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
agtccgaatcgctgtcagagtcagagtcgctgtcagaatccgagtcg	Protospacer
 .******************** ************* **********

1049. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 .********.**************.***

1050. spacer 2.25|2064521|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 .********.**************.***

1051. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatca	Protospacer
*.********.********.********.

1052. spacer 2.25|2064521|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcactgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtca	Protospacer
*.********.**************.**.

1053. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
*.************** ***** *****.

1054. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
*.************** ***** *****.

1055. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
*.************** ***** *****.

1056. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
*.************** ***** *****.

1057. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtccgaatcggaatca	Protospacer
*.************** ***** *****.

1058. spacer 2.26|2064575|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatca	Protospacer
*.********.*****.***********.

1059. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
catccgaatcgctgtcggagtccgaatcg	Protospacer
 .*****.***********.*********

1060. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatca	Protospacer
*.**************.**.********.

1061. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatcggaatca	Protospacer
*.*****.************** *****.

1062. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
tgtcggagtcgctgtcagagtccgagtcg	Protospacer
 .************** ***** ******

1063. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
tatccgagtcgctgtcagagtcggagtca	Protospacer
 *** *********** ***********.

1064. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcggaatcgctgtccgaatcggagtca	Protospacer
*.*****.***********.********.

1065. spacer 2.29|2064755|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtccgagtcgctgtcagagtcggagtca	Protospacer
*.** *********** ***********.

1066. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
catccgagtcgctgtccgaatcggagtca	Protospacer
 *** **************.********.

1067. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcagagtcgctgtccgaatcggagtca	Protospacer
*.**.**************.********.

1068. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcagagtcgctgtccgaatcggagtca	Protospacer
*.**.**************.********.

1069. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtccgagtcgctgtccgagtccgagtcc	Protospacer
*.** ***************** *****

1070. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgaatcgctgtcggagtccgagtca	Protospacer
 ********* **.********************.

1071. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcactgtcggagtccgagtca	Protospacer
 ********* *****.*****************.

1072. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtccgagtcactgtcggagtccgagtca	Protospacer
 ********* *****.*****************.

1073. spacer 2.31|2064899|35|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.886

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcggagtcggagtcgctgtcagagtccgaatca	Protospacer
 *********************.********.**.

1074. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.***** *****.

1075. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtccgagtcg	Protospacer
*.******************** **.**.

1076. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.*****.************** *****.

1077. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.*****.************** *****.

1078. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcactgtcggagtcggaatcg	Protospacer
*.*****.**.*****************.

1079. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.*****.************** *****.

1080. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcg	Protospacer
*.*****.************** *****.

1081. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgaatcgctgtcagagtcggaatcg	Protospacer
*.*****.********.***********.

1082. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.***** *****.

1083. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcagagtccgaatcg	Protospacer
*.**************.***** *****.

1084. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
catccgaatcgctgtcggagtccgaatcg	Protospacer
 ******.************** *****.

1085. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tgtccgagtcactgtcggagtcggagtca	Protospacer
 .********.**************.***

1086. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
catccgagtcgctgtcggagtcagagtcg	Protospacer
 *********************.**.**.

1087. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcactgtcggagtcggagtcg	Protospacer
*.********.**************.**.

1088. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtcagagtcgctgtcggagtcggagtcg	Protospacer
*.** ********************.**.

1089. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtccgagtcggagtcg	Protospacer
*.************** ********.**.

1090. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtccgagtcgctgtcggagtctgagtcg	Protospacer
*.******************** **.**.

1091. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
agtcagagtcgctgtcggagtccgaatcg	Protospacer
*.** ***************** *****.

1092. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagagtcggaatca	Protospacer
 ******************.** *****.

1093. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtccgaatccgagtca	Protospacer
*.************** ********.**.

1094. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagaatcggagtca	Protospacer
*.******************** **.**.

1095. spacer 2.34|2065091|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcggaatcggaatca	Protospacer
*.**************.***** *****.

1096. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatccgaatcg	Protospacer
 .** **.*********************

1097. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgagtcgctgtcagaatccgagtca	Protospacer
 ******.*****************.**.

1098. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgaatcgctgtccgagtccgaatca	Protospacer
 *************** **.********.

1099. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtccgagtca	Protospacer
*.*****************.*****.**.

1100. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcactgtcggaatccgaatca	Protospacer
*.********.*****.***********.

1101. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcggaatcgctgtcagaatccgagtca	Protospacer
*.** ********************.**.

1102. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtcagaatcgctgtcagaatccgagtca	Protospacer
*.** ********************.**.

1103. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtctgagtcgctgtcagaatccgaatca	Protospacer
*.**.**.********************.

1104. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
*.*****************.** *****.

1105. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcggaatca	Protospacer
*.*****************.** *****.

1106. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
*.********.***************************** *****.

1107. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
agtccgaatcgctgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
*.********.***************************** *****.

1108. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
agtccgaatcgctgtcagagtccgaatcgctgtcagagtcggaatcg	Protospacer
*.********.*****.*****************************.

1109. spacer 2.41|2065655|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.915

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
agtccgagtcgctgtcggagtccgagtcgctgtcggaatcggaatca	Protospacer
*.** ***********.*****************************.

1110. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
tgtccgagtcactgtcggagtcggagtca	Protospacer
 .*****.********************.

1111. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
tgtccgaatcactgtcggaatcagagtcg	Protospacer
 .*****************.**.******

1112. spacer 2.42|2065727|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcgctgtcggagtca	Protospacer
*.***************  *********.

1113. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtccgagtcagagtca	Protospacer
*.************** *****.*****.

1114. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcgctgtcggagtccgagtca	Protospacer
*.********.*********** *****.

1115. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgagtcactgtcggagtccgagtca	Protospacer
*.*****.************** *****.

1116. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcgctgtcagagtcggagtca	Protospacer
*.********.*****.***********.

1117. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtctgaatcgctgtcggagtcggagtca	Protospacer
*.**.*****.*****************.

1118. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgagtcactgtcggagtccgagtca	Protospacer
*.*****.************** *****.

1119. spacer 2.42|2065727|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtcggaatcactgtcggagtcggaatca	Protospacer
*.** ********************.**.

1120. spacer 2.42|2065727|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.862

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
agtccgaatcactgtcagaatcggagtca	Protospacer
*.**************.**.********.

1121. spacer 2.43|2065781|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtcggagtcgctgtcagagtccgaatcg	Protospacer
 ************.**************.*****.

1122. spacer 2.43|2065781|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtcggaatcgctgtcagaatccgaatcg	Protospacer
 ************************.**.*****.

1123. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
 ********* *****************.*****.

1124. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcagagtcggaatcgctgtcagagtccgaatcg	Protospacer
 ***.***********************.*****.

1125. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
 ********* *****************.*****.

1126. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
 ********* *****************.*****.

1127. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
 ********* *****************.*****.

1128. spacer 2.43|2065781|35|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.886

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggaatcggaatcgctgtcagagtccgaatcg	Protospacer
 ******.********************.*****.

1129. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
tatccgaatcgctgtcagagtccgagtcg	Protospacer
 .** ********************.***

1130. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
catccgaatcgctgtcggagtccgaatcg	Protospacer
 .** ***********.************

1131. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatca	Protospacer
*.** **.********************.

1132. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtccgagtccgaatca	Protospacer
*.** *********** ***********.

1133. spacer 2.44|2065841|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcggaatca	Protospacer
*.** ***************** *****.

1134. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatca	Protospacer
*.*****.**************.*****.

1135. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatca	Protospacer
*.*****.**************.*****.

1136. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
aatcagagtcgctgtcagagtctgaatca	Protospacer
*.*****.**************.*****.

1137. spacer 2.44|2065841|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.862

agtca--gaatcgctgtcagagtccgaatcg	CRISPR spacer
--tcgacgaatcgctgtcggagtccgaatcg	Protospacer
  **.  ***********.************

1138. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatcggaatcactgtcggagtcggaatca	Protospacer
*.**************.***** *****.

1139. spacer 2.45|2065895|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatca	Protospacer
*.** *****.*****************.

1140. spacer 2.45|2065895|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.862

agtcg--gaatcactgtcagagtccgaatcg	CRISPR spacer
--tcgacgaatcgctgtcggagtccgaatcg	Protospacer
  ***  *****.*****.************

1141. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcgctgtcggaatcc	Protospacer
*.********.*****.***********************

1142. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcgctgtcggaatcc	Protospacer
*.********.*****.***********************

1143. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
aatcggaatcactgtcggagtccgagtcgctgtcggaatcc	Protospacer
*.********.*****.***********************

1144. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.902

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
aatcggaatcactgtcagagtccgagtcgctgtcagaatcc	Protospacer
*.********.***********************.*****

1145. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagagtccgagtcg	Protospacer
 .*****************.*****.***

1146. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcactgtcagaatccgaatca	Protospacer
*.*****.**.*****************.

1147. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgaatcgctgtcggagtccgaatcg	Protospacer
 .**************.**.*********

1148. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgaatcgctgtcagcatccgagtcg	Protospacer
 .**************** ******.***

1149. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcggaatcgctgtccgaatccgaatca	Protospacer
 *** *********** ***********.

1150. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatca	Protospacer
*.*****.***********.********.

1151. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtccgagtccgaatca	Protospacer
*.************** **.********.

1152. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcggaatcggaatca	Protospacer
*.**************.***** *****.

1153. spacer 2.47|2066015|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.862

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtcggaatca	Protospacer
*.*****************.** *****.

1154. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 .** ********************.***

1155. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatcggaatca	Protospacer
 ******.************** *****.

1156. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagaatccgagtcg	Protospacer
 .** ********************.***

1157. spacer 2.48|2066069|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatcggaatca	Protospacer
 ******.************** *****.

1158. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcggaatcgctgtccgaatccgaatca	Protospacer
 ***.*********** ***********.

1159. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagagtccgaatca	Protospacer
*.** **************.********.

1160. spacer 2.48|2066069|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
aatccgaatcgctgtcagaatccgagtca	Protospacer
*.** ********************.**.

1161. spacer 2.48|2066069|29|CP031810|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
attcagaatcgctgtctgaatcggaatca	Protospacer
* ************** ***** *****.

1162. spacer 2.48|2066069|29|CP031810|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
attcagaatcgctgtctgaatctgaatca	Protospacer
* ************** *****.*****.

1163. spacer 2.48|2066069|29|CP031810|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.862

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
attcagaatcgctgtctgaatcggaatca	Protospacer
* ************** ***** *****.

1164. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggttgcg	Protospacer
************************   *.

1165. spacer 2.49|2066123|29|CP031810|CRT matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgttggagtcggagtcggagtcggagtcg	Protospacer
 **.*********************.**.

1166. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcggttgcg	Protospacer
************************   *.

1167. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
aatccgagtcggagtcggagtcagaatcc	Protospacer
*.** *****************.*****

1168. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
aatccgagtcggagtcggagtcagaatcc	Protospacer
*.** *****************.*****

1169. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggggtcggagtcggagtcg	Protospacer
 ***********.************.**.

1170. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgttggagtcggagtcggagtcggagtcg	Protospacer
 **.*********************.**.

1171. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggcgtcggtgtcg	Protospacer
****************** ***** .**.

1172. spacer 2.49|2066123|29|CP031810|CRT matches to JQ807233 (Environmental Halophage eHP-12, partial genome) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
attcggagtcggagtcggattcggagtcg	Protospacer
* ***************** *****.**.

1173. spacer 2.49|2066123|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtccgagtcagagtcggaatcg	Protospacer
 ********* *****.***********.

1174. spacer 2.49|2066123|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtccgagtcagagtcggaatcg	Protospacer
 ********* *****.***********.

1175. spacer 2.49|2066123|29|CP031810|CRT matches to JQ807237 (Environmental Halophage eHP-16, partial genome) position: , mismatch: 4, identity: 0.862

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
actcggagtcggattcggagtcggattct	Protospacer
* *********** *********** **

1176. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatccgaatcgctgtccgaatcggagtcc	Protospacer
*.** *****.*****************

1177. spacer 2.50|2066177|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatccgaatcgctgtccgaatcggagtca	Protospacer
*.** *****.*****************.

1178. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatccgagtcactgtccgaatcggagtca	Protospacer
*.** **.********************.

1179. spacer 2.50|2066177|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcggaatcactgtccgaatcggagtcg	CRISPR spacer
aatcggaatcgctgtccgaatcggaatca	Protospacer
*.********.**************.**.

1180. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.862

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
catccgagtcgctgtcggagtcagagtcg	Protospacer
 .** *********** ************

1181. spacer 2.51|2066231|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.862

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcggagtcgctgtccgagtccgaatca	Protospacer
*.******************** **.**.

1182. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.857

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtcactgtca	Protospacer
*******.*********************  .**.

1183. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.857

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtcactgtcg	Protospacer
****.**.*********************  .***

1184. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.878

aatccgagtcgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
tgtcggagtcgctgtcagagtccgagtcgctgtcggaatcc	Protospacer
 .** ***************** *****************

1185. spacer 2.26|2064575|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
catccgagtcgctgtcagaatccgagtca	Protospacer
 .**************.********.**.

1186. spacer 2.26|2064575|29|CP031810|CRT matches to NC_009444 (Pseudomonas fluorescens SBW25 plasmid pQBR103, complete sequence) position: , mismatch: 5, identity: 0.828

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
tgaccgagtcgctgtcggaatcagcatcc	Protospacer
 * ******************* * ***

1187. spacer 2.29|2064755|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
tgtcggaatcgctgtccgaatcggagtca	Protospacer
 .*****.***********.********.

1188. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggagtcgctgtct	Protospacer
*******.***************  .**

1189. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggagtcgctgtct	Protospacer
*******.***************  .**

1190. spacer 2.33|2065037|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgaatcgctgtcggagtcgctgtct	Protospacer
*******.***************  .**

1191. spacer 2.34|2065091|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcggaatcgctgtccgaatccgaatca	Protospacer
 .** *********** ***********.

1192. spacer 2.41|2065655|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.894

aatcggagtcgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
tgtcggagtcgctgtcagagtccgagtcgctgtcggaatccgagtca	Protospacer
 .************************************** **.**.

1193. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
tatccgaatcgctgtcagagtcggaatca	Protospacer
 .** ***************** *****.

1194. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcactgtcg	Protospacer
**** *****************   .***

1195. spacer 2.44|2065841|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
catccgaatcgctgtccgagtccgaatca	Protospacer
 .** *********** ***********.

1196. spacer 2.44|2065841|29|CP031810|CRT matches to NC_009507 (Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence) position: , mismatch: 5, identity: 0.828

agtcagaatcgctgtcagagtccgaatcg-	CRISPR spacer
ggtcaggatcgctgtcagagtcc-cgtcgc	Protospacer
.*****.****************  .***

1197. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtcgctgtca	Protospacer
**********************   .**.

1198. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcggaatcactgtcagagtcgctgtca	Protospacer
**********************   .**.

1199. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
gatcggagtcactgtcagagtccgagtcc	Protospacer
..*****.*****************.**

1200. spacer 2.45|2065895|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcggaatcactgtcagagtccgaatcg	CRISPR spacer
agtcactgtcactgtcggagtccgaatcg	Protospacer
****.  .********.************

1201. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.878

agtcggaatcgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
tatccgaatcgctgtcagagtccgagtcgctgtccgaatct	Protospacer
 .** ***************************** *****

1202. spacer 2.46|2065949|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.878

agtcggaat-cgctgtcagagtccgagtcgctgtcggaatcg	CRISPR spacer
-gtcagaatccactgtcagagtccgagtcgctgtcggagtcc	Protospacer
 ***.**** *.**************************.**

1203. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tatccgaatcgctgtcagagtcggaatca	Protospacer
 .*****************.** *****.

1204. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcactgtcg	Protospacer
*******************.**   .***

1205. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgagtcgctgtcagaatccgagtca	Protospacer
 .*****.*****************.**.

1206. spacer 2.47|2066015|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
catccgaatcgctgtccgagtccgaatca	Protospacer
 .************** **.********.

1207. spacer 2.48|2066069|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.828

agtca--gaatcgctgtcagaatccgaatcg	CRISPR spacer
--tcgacgaatcgctgtcggagtccgaatcg	Protospacer
  **.  ***********.**.*********

1208. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtcggagtcggagtcgctgtcc	Protospacer
 **********************  .**

1209. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcgctgtcggagtcggagtcgctgtca	Protospacer
*****  ****************  .***

1210. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagtcgtgggct	Protospacer
*********************** .. *

1211. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggggtcggcgtcggagtcggggtcg	Protospacer
******.***** ***********..**.

1212. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggcgtcggtgtcggcgtcg	Protospacer
************ ***** ***** .**.

1213. spacer 2.49|2066123|29|CP031810|CRT matches to JQ807233 (Environmental Halophage eHP-12, partial genome) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
gttcggagtcggagtcggattcggagtcg	Protospacer
. ***************** *****.**.

1214. spacer 2.49|2066123|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcgctgtcggagtcggagtcgctgtca	Protospacer
*****  ****************  .***

1215. spacer 2.49|2066123|29|CP031810|CRT matches to MT773556 (Myoviridae sp. isolate BML_4 genomic sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggcgtcggagtcggacctg	Protospacer
************ ************ ...

1216. spacer 2.49|2066123|29|CP031810|CRT matches to MT773556 (Myoviridae sp. isolate BML_4 genomic sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggcgttggagtcggagtcggcgtcg	Protospacer
****** **.************** .**.

1217. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
atcaggagtcggagtcggactcggaatcc	Protospacer
* . *************** ********

1218. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP035502 (Sphingosinicella sp. BN140058 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
ggtcggggtcggagtcggagtcggagtgg	Protospacer
.*****.******************.* .

1219. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP035502 (Sphingosinicella sp. BN140058 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
ggtcggagtcggagtcggagtgggcgtcg	Protospacer
.******************** ** .**.

1220. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP035502 (Sphingosinicella sp. BN140058 plasmid p1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtgggcgtcggagccg	Protospacer
*************** ** ******..*.

1221. spacer 2.49|2066123|29|CP031810|CRT matches to MN693281 (Marine virus AFVG_25M371, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggagttgggctag	Protospacer
*********************.**. * .

1222. spacer 2.49|2066123|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcgctgtcggagtcggagtcgctgtca	Protospacer
*****  ****************  .***

1223. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
actcggattcggagtcggagtcggactgc	Protospacer
* ***** ***************** *

1224. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcactgtcgctgtcggagtcagagtcg	Protospacer
*.**.  ********* ************

1225. spacer 2.51|2066231|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcactgtcgctgtcagagtcagagtcg	Protospacer
*.**.  ********* ************

1226. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1227. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1228. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1229. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1230. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1231. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1232. spacer 2.51|2066231|29|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
aatcgctatcgctgtctgagtcagagtcg	Protospacer
*.***  .********.************

1233. spacer 2.51|2066231|29|CP031810|CRT matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1234. spacer 2.51|2066231|29|CP031810|CRT matches to MH590593 (Mycobacterium phage Rabinovish, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1235. spacer 2.51|2066231|29|CP031810|CRT matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1236. spacer 2.51|2066231|29|CP031810|CRT matches to MH697579 (Mycobacterium phage Cane17, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1237. spacer 2.51|2066231|29|CP031810|CRT matches to MK112554 (Mycobacterium phage TinyTim, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1238. spacer 2.51|2066231|29|CP031810|CRT matches to MK359314 (Mycobacterium phage Ewok, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1239. spacer 2.51|2066231|29|CP031810|CRT matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1240. spacer 2.51|2066231|29|CP031810|CRT matches to MK359337 (Mycobacterium phage Flabslab, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1241. spacer 2.51|2066231|29|CP031810|CRT matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1242. spacer 2.51|2066231|29|CP031810|CRT matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1243. spacer 2.51|2066231|29|CP031810|CRT matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1244. spacer 2.51|2066231|29|CP031810|CRT matches to MH779502 (Mycobacterium phage FudgeTart, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1245. spacer 2.51|2066231|29|CP031810|CRT matches to MH779502 (Mycobacterium phage FudgeTart, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1246. spacer 2.51|2066231|29|CP031810|CRT matches to MK359365 (Mycobacterium phage Loanshark, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1247. spacer 2.51|2066231|29|CP031810|CRT matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1248. spacer 2.51|2066231|29|CP031810|CRT matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1249. spacer 2.51|2066231|29|CP031810|CRT matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1250. spacer 2.51|2066231|29|CP031810|CRT matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1251. spacer 2.51|2066231|29|CP031810|CRT matches to MK112549 (Mycobacterium phage Morizzled23, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1252. spacer 2.51|2066231|29|CP031810|CRT matches to MK112549 (Mycobacterium phage Morizzled23, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1253. spacer 2.51|2066231|29|CP031810|CRT matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1254. spacer 2.51|2066231|29|CP031810|CRT matches to MK450425 (Mycobacterium phage Shelob, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1255. spacer 2.51|2066231|29|CP031810|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1256. spacer 2.51|2066231|29|CP031810|CRT matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1257. spacer 2.51|2066231|29|CP031810|CRT matches to KJ595575 (Mycobacterium phage Willis, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1258. spacer 2.51|2066231|29|CP031810|CRT matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1259. spacer 2.51|2066231|29|CP031810|CRT matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1260. spacer 2.51|2066231|29|CP031810|CRT matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1261. spacer 2.51|2066231|29|CP031810|CRT matches to MK359333 (Mycobacterium phage JustHall, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1262. spacer 2.51|2066231|29|CP031810|CRT matches to KT321476 (Mycobacterium phage Zeenon, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1263. spacer 2.51|2066231|29|CP031810|CRT matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1264. spacer 2.51|2066231|29|CP031810|CRT matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1265. spacer 2.51|2066231|29|CP031810|CRT matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1266. spacer 2.51|2066231|29|CP031810|CRT matches to JN699625 (Mycobacterium phage Wally, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1267. spacer 2.51|2066231|29|CP031810|CRT matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1268. spacer 2.51|2066231|29|CP031810|CRT matches to KX721255 (Mycobacterium phage Yucca, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1269. spacer 2.51|2066231|29|CP031810|CRT matches to KX721255 (Mycobacterium phage Yucca, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1270. spacer 2.51|2066231|29|CP031810|CRT matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1271. spacer 2.51|2066231|29|CP031810|CRT matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1272. spacer 2.51|2066231|29|CP031810|CRT matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1273. spacer 2.51|2066231|29|CP031810|CRT matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1274. spacer 2.51|2066231|29|CP031810|CRT matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1275. spacer 2.51|2066231|29|CP031810|CRT matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1276. spacer 2.51|2066231|29|CP031810|CRT matches to MH779498 (Mycobacterium phage Bread, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1277. spacer 2.51|2066231|29|CP031810|CRT matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1278. spacer 2.51|2066231|29|CP031810|CRT matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1279. spacer 2.51|2066231|29|CP031810|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1280. spacer 2.51|2066231|29|CP031810|CRT matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1281. spacer 2.51|2066231|29|CP031810|CRT matches to MH316567 (Mycobacterium phage ParkTD, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1282. spacer 2.51|2066231|29|CP031810|CRT matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1283. spacer 2.51|2066231|29|CP031810|CRT matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1284. spacer 2.51|2066231|29|CP031810|CRT matches to KX721256 (Mycobacterium phage Erdmann, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1285. spacer 2.51|2066231|29|CP031810|CRT matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1286. spacer 2.51|2066231|29|CP031810|CRT matches to KM881426 (Mycobacterium phage ZygoTaiga) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1287. spacer 2.51|2066231|29|CP031810|CRT matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1288. spacer 2.51|2066231|29|CP031810|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1289. spacer 2.51|2066231|29|CP031810|CRT matches to EU826467 (Mycobacterium phage Rizal, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1290. spacer 2.51|2066231|29|CP031810|CRT matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1291. spacer 2.51|2066231|29|CP031810|CRT matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1292. spacer 2.51|2066231|29|CP031810|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1293. spacer 2.51|2066231|29|CP031810|CRT matches to MF919495 (Mycobacterium phage Bigswole, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1294. spacer 2.51|2066231|29|CP031810|CRT matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1295. spacer 2.51|2066231|29|CP031810|CRT matches to KF024734 (Mycobacterium phage Shrimp, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1296. spacer 2.51|2066231|29|CP031810|CRT matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1297. spacer 2.51|2066231|29|CP031810|CRT matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1298. spacer 2.51|2066231|29|CP031810|CRT matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1299. spacer 2.51|2066231|29|CP031810|CRT matches to MK359350 (Mycobacterium phage Nidhogg, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1300. spacer 2.51|2066231|29|CP031810|CRT matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1301. spacer 2.51|2066231|29|CP031810|CRT matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1302. spacer 2.51|2066231|29|CP031810|CRT matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1303. spacer 2.51|2066231|29|CP031810|CRT matches to MK112533 (Mycobacterium phage Bonray, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1304. spacer 2.51|2066231|29|CP031810|CRT matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1305. spacer 2.51|2066231|29|CP031810|CRT matches to MK359327 (Mycobacterium phage EmToTheThree, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1306. spacer 2.51|2066231|29|CP031810|CRT matches to MK359327 (Mycobacterium phage EmToTheThree, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1307. spacer 2.51|2066231|29|CP031810|CRT matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1308. spacer 2.51|2066231|29|CP031810|CRT matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1309. spacer 2.51|2066231|29|CP031810|CRT matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1310. spacer 2.51|2066231|29|CP031810|CRT matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1311. spacer 2.51|2066231|29|CP031810|CRT matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1312. spacer 2.51|2066231|29|CP031810|CRT matches to MF919499 (Mycobacterium phage Daffodil, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1313. spacer 2.51|2066231|29|CP031810|CRT matches to MK359334 (Mycobacterium phage Delilah, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1314. spacer 2.51|2066231|29|CP031810|CRT matches to NC_023696 (Mycobacterium phage Dandelion, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1315. spacer 2.51|2066231|29|CP031810|CRT matches to NC_023696 (Mycobacterium phage Dandelion, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1316. spacer 2.51|2066231|29|CP031810|CRT matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1317. spacer 2.51|2066231|29|CP031810|CRT matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1318. spacer 2.51|2066231|29|CP031810|CRT matches to MH825713 (Mycobacterium phage Zalkecks, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1319. spacer 2.51|2066231|29|CP031810|CRT matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1320. spacer 2.51|2066231|29|CP031810|CRT matches to MK359349 (Mycobacterium phage FoxtrotP1, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1321. spacer 2.51|2066231|29|CP031810|CRT matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1322. spacer 2.51|2066231|29|CP031810|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1323. spacer 2.51|2066231|29|CP031810|CRT matches to MK359344 (Mycobacterium phage Napoleon13, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1324. spacer 2.51|2066231|29|CP031810|CRT matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1325. spacer 2.51|2066231|29|CP031810|CRT matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1326. spacer 2.51|2066231|29|CP031810|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1327. spacer 2.51|2066231|29|CP031810|CRT matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1328. spacer 2.51|2066231|29|CP031810|CRT matches to JQ911768 (Mycobacterium phage Ava3, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1329. spacer 2.51|2066231|29|CP031810|CRT matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1330. spacer 2.51|2066231|29|CP031810|CRT matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1331. spacer 2.51|2066231|29|CP031810|CRT matches to NC_011270 (Mycobacterium phage Spud, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1332. spacer 2.51|2066231|29|CP031810|CRT matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1333. spacer 2.51|2066231|29|CP031810|CRT matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1334. spacer 2.51|2066231|29|CP031810|CRT matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1335. spacer 2.51|2066231|29|CP031810|CRT matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1336. spacer 2.51|2066231|29|CP031810|CRT matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1337. spacer 2.51|2066231|29|CP031810|CRT matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1338. spacer 2.51|2066231|29|CP031810|CRT matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1339. spacer 2.51|2066231|29|CP031810|CRT matches to EU826469 (Mycobacterium phage ScottMcG, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1340. spacer 2.51|2066231|29|CP031810|CRT matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1341. spacer 2.51|2066231|29|CP031810|CRT matches to MK310143 (Mycobacterium phage Dietrick, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1342. spacer 2.51|2066231|29|CP031810|CRT matches to MK450429 (Mycobacterium phage Bipolarisk, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1343. spacer 2.51|2066231|29|CP031810|CRT matches to MH051266 (Mycobacterium phage MikeLiesIn, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1344. spacer 2.51|2066231|29|CP031810|CRT matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1345. spacer 2.51|2066231|29|CP031810|CRT matches to MH669008 (Mycobacterium phage Megamind, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1346. spacer 2.51|2066231|29|CP031810|CRT matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1347. spacer 2.51|2066231|29|CP031810|CRT matches to MK450434 (Mycobacterium phage DrPhinkDaddy, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1348. spacer 2.51|2066231|29|CP031810|CRT matches to MK359359 (Mycobacterium phage Colt, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1349. spacer 2.51|2066231|29|CP031810|CRT matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1350. spacer 2.51|2066231|29|CP031810|CRT matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1351. spacer 2.51|2066231|29|CP031810|CRT matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1352. spacer 2.51|2066231|29|CP031810|CRT matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1353. spacer 2.51|2066231|29|CP031810|CRT matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1354. spacer 2.51|2066231|29|CP031810|CRT matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1355. spacer 2.51|2066231|29|CP031810|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1356. spacer 2.51|2066231|29|CP031810|CRT matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1357. spacer 2.51|2066231|29|CP031810|CRT matches to KT365400 (Mycobacterium phage ErnieJ, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1358. spacer 2.51|2066231|29|CP031810|CRT matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1359. spacer 2.51|2066231|29|CP031810|CRT matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1360. spacer 2.51|2066231|29|CP031810|CRT matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1361. spacer 2.51|2066231|29|CP031810|CRT matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1362. spacer 2.51|2066231|29|CP031810|CRT matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1363. spacer 2.51|2066231|29|CP031810|CRT matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1364. spacer 2.51|2066231|29|CP031810|CRT matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1365. spacer 2.51|2066231|29|CP031810|CRT matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1366. spacer 2.51|2066231|29|CP031810|CRT matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1367. spacer 2.51|2066231|29|CP031810|CRT matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1368. spacer 2.51|2066231|29|CP031810|CRT matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1369. spacer 2.51|2066231|29|CP031810|CRT matches to DQ398053 (Mycobacteriophage Catera, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1370. spacer 2.51|2066231|29|CP031810|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1371. spacer 2.51|2066231|29|CP031810|CRT matches to JN699626 (Mycobacterium phage MoMoMixon, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1372. spacer 2.51|2066231|29|CP031810|CRT matches to JN699626 (Mycobacterium phage MoMoMixon, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1373. spacer 2.51|2066231|29|CP031810|CRT matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1374. spacer 2.51|2066231|29|CP031810|CRT matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1375. spacer 2.51|2066231|29|CP031810|CRT matches to MK450424 (Mycobacterium phage Melpomini, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1376. spacer 2.51|2066231|29|CP031810|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1377. spacer 2.51|2066231|29|CP031810|CRT matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1378. spacer 2.51|2066231|29|CP031810|CRT matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1379. spacer 2.51|2066231|29|CP031810|CRT matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1380. spacer 2.51|2066231|29|CP031810|CRT matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1381. spacer 2.51|2066231|29|CP031810|CRT matches to NC_008207 (Mycobacterium phage Catera, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
agtcactatcgctgtccgagtcagaatcg	Protospacer
****.  .*****************.***

1382. spacer 2.51|2066231|29|CP031810|CRT matches to JN624850 (Mycobacterium phage Pleione, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1383. spacer 2.51|2066231|29|CP031810|CRT matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 5, identity: 0.828

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactatcg	Protospacer
 *** ******************  .***

1384. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.829

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcgctgtct	Protospacer
**********************.*****.  .**

1385. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.829

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcgctgtct	Protospacer
**********************.*****.  .**

1386. spacer 2.16|2063741|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.829

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
tgtcagaatccgaatcgctgtcggagtcgctgtct	Protospacer
**********************.*****.  .**

1387. spacer 2.26|2064575|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.793

agtccgagtcgctgtcggaatccgaatcg	CRISPR spacer
tcgacgaatcgctgtcggagtccgaatcg	Protospacer
    ***.***********.*********

1388. spacer 2.27|2064629|29|CP031810|CRT matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 6, identity: 0.793

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
tgttggagtcggagtcggagtcggagtcg	Protospacer
 .*..***********.**.*********

1389. spacer 2.27|2064629|29|CP031810|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.793

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
cgttggagtcggagtcggagtcggagtcg	Protospacer
 .*..***********.**.*********

1390. spacer 2.27|2064629|29|CP031810|CRT matches to KP790009 (Gordonia phage Gmala1, complete genome) position: , mismatch: 6, identity: 0.793

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
aatcagagtcagagtcagaatcttcttca	Protospacer
**********.***********    **.

1391. spacer 2.27|2064629|29|CP031810|CRT matches to KP790008 (Gordonia phage GordTnk2, complete genome) position: , mismatch: 6, identity: 0.793

aatcagagtcggagtcagaatcggagtcg	CRISPR spacer
aatcagagtcagagtcagaatcttcttca	Protospacer
**********.***********    **.

1392. spacer 2.29|2064755|29|CP031810|CRT matches to KX781992 (Mycobacterium phage Gabriel, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1393. spacer 2.29|2064755|29|CP031810|CRT matches to MH697579 (Mycobacterium phage Cane17, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1394. spacer 2.29|2064755|29|CP031810|CRT matches to MK359314 (Mycobacterium phage Ewok, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1395. spacer 2.29|2064755|29|CP031810|CRT matches to MN234193 (Mycobacterium phage Kboogie, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1396. spacer 2.29|2064755|29|CP031810|CRT matches to MK450432 (Mycobacterium phage ValleyTerrace, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1397. spacer 2.29|2064755|29|CP031810|CRT matches to MH051261 (Mycobacterium phage Tyke, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1398. spacer 2.29|2064755|29|CP031810|CRT matches to MK359365 (Mycobacterium phage Loanshark, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1399. spacer 2.29|2064755|29|CP031810|CRT matches to MK359311 (Mycobacterium phage SmallFry, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1400. spacer 2.29|2064755|29|CP031810|CRT matches to MK359364 (Mycobacterium phage ChickenPhender, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1401. spacer 2.29|2064755|29|CP031810|CRT matches to MK359303 (Mycobacterium phage Shnickers, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1402. spacer 2.29|2064755|29|CP031810|CRT matches to MH697586 (Mycobacterium phage InigoMontoya, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1403. spacer 2.29|2064755|29|CP031810|CRT matches to MK359347 (Mycobacterium phage Ading, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1404. spacer 2.29|2064755|29|CP031810|CRT matches to NC_023714 (Mycobacterium phage LinStu, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1405. spacer 2.29|2064755|29|CP031810|CRT matches to MK359358 (Mycobacterium phage Essence, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1406. spacer 2.29|2064755|29|CP031810|CRT matches to MG812493 (Mycobacterium phage NuevoMundo, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1407. spacer 2.29|2064755|29|CP031810|CRT matches to MK359339 (Mycobacterium phage Naija, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1408. spacer 2.29|2064755|29|CP031810|CRT matches to KT321476 (Mycobacterium phage Zeenon, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1409. spacer 2.29|2064755|29|CP031810|CRT matches to MN428065 (Mycobacterium phage Cactojaque, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1410. spacer 2.29|2064755|29|CP031810|CRT matches to MK359306 (Mycobacterium phage Norm, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1411. spacer 2.29|2064755|29|CP031810|CRT matches to MN735434 (Mycobacterium phage Mangeria, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1412. spacer 2.29|2064755|29|CP031810|CRT matches to EU826471 (Mycobacterium phage Cali, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1413. spacer 2.29|2064755|29|CP031810|CRT matches to MK359366 (Mycobacterium phage Basquiat, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1414. spacer 2.29|2064755|29|CP031810|CRT matches to MK359346 (Mycobacterium phage NoodleTree, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1415. spacer 2.29|2064755|29|CP031810|CRT matches to JN699013 (Mycobacterium phage Pio, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1416. spacer 2.29|2064755|29|CP031810|CRT matches to MK359361 (Mycobacterium phage Darko, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1417. spacer 2.29|2064755|29|CP031810|CRT matches to NC_023725 (Mycobacterium phage Nappy, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1418. spacer 2.29|2064755|29|CP031810|CRT matches to MK359348 (Mycobacterium phage Rahel, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1419. spacer 2.29|2064755|29|CP031810|CRT matches to MK450427 (Mycobacterium phage Adlitam, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1420. spacer 2.29|2064755|29|CP031810|CRT matches to MG812494 (Mycobacterium phage Pier, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1421. spacer 2.29|2064755|29|CP031810|CRT matches to GQ303262 (Mycobacterium phage LRRHood, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1422. spacer 2.29|2064755|29|CP031810|CRT matches to MT818423 (Mycobacterium phage Janiyra, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1423. spacer 2.29|2064755|29|CP031810|CRT matches to AY129337 (Mycobacteriophage Bxz1, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1424. spacer 2.29|2064755|29|CP031810|CRT matches to MH051260 (Mycobacterium phage InterFolia, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1425. spacer 2.29|2064755|29|CP031810|CRT matches to MK359328 (Mycobacterium phage EmmaElysia, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1426. spacer 2.29|2064755|29|CP031810|CRT matches to MK359335 (Mycobacterium phage Patter, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1427. spacer 2.29|2064755|29|CP031810|CRT matches to MT889395 (Mycobacterium phage Shifa, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1428. spacer 2.29|2064755|29|CP031810|CRT matches to MT723944 (Mycobacterium phage ChaylaJr, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1429. spacer 2.29|2064755|29|CP031810|CRT matches to KR080196 (Mycobacterium phage Momo, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1430. spacer 2.29|2064755|29|CP031810|CRT matches to MH910040 (Mycobacterium phage Sauce, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1431. spacer 2.29|2064755|29|CP031810|CRT matches to MK359318 (Mycobacterium phage Specks, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1432. spacer 2.29|2064755|29|CP031810|CRT matches to MK359308 (Mycobacterium phage Shaqnato, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1433. spacer 2.29|2064755|29|CP031810|CRT matches to MH825697 (Mycobacterium phage Bangla1971, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1434. spacer 2.29|2064755|29|CP031810|CRT matches to MK359338 (Mycobacterium phage Amataga, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1435. spacer 2.29|2064755|29|CP031810|CRT matches to MT723945 (Mycobacterium phage Quasimodo, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1436. spacer 2.29|2064755|29|CP031810|CRT matches to MK359342 (Mycobacterium phage ShiaLabeouf, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1437. spacer 2.29|2064755|29|CP031810|CRT matches to MH316561 (Mycobacterium phage Derek, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1438. spacer 2.29|2064755|29|CP031810|CRT matches to MK112533 (Mycobacterium phage Bonray, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1439. spacer 2.29|2064755|29|CP031810|CRT matches to MK450422 (Mycobacterium phage RoMag, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1440. spacer 2.29|2064755|29|CP031810|CRT matches to MH727543 (Mycobacterium phage CharlieB, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1441. spacer 2.29|2064755|29|CP031810|CRT matches to JF704116 (Mycobacterium phage Drazdys, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1442. spacer 2.29|2064755|29|CP031810|CRT matches to MK359336 (Mycobacterium phage Chargie21, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1443. spacer 2.29|2064755|29|CP031810|CRT matches to MK359355 (Mycobacterium phage Sprinklers, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1444. spacer 2.29|2064755|29|CP031810|CRT matches to MK112534 (Mycobacterium phage Burrough, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1445. spacer 2.29|2064755|29|CP031810|CRT matches to MN276192 (Mycobacterium phage Trinitium, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1446. spacer 2.29|2064755|29|CP031810|CRT matches to MK359324 (Mycobacterium phage Tortoise16, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1447. spacer 2.29|2064755|29|CP031810|CRT matches to JF704096 (Mycobacterium phage Ghost, complete sequence) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1448. spacer 2.29|2064755|29|CP031810|CRT matches to MN062707 (Mycobacterium phage Grungle, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1449. spacer 2.29|2064755|29|CP031810|CRT matches to MH727558 (Mycobacterium phage Salacia, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1450. spacer 2.29|2064755|29|CP031810|CRT matches to MK359363 (Mycobacterium phage Fludd, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1451. spacer 2.29|2064755|29|CP031810|CRT matches to KX831080 (Mycobacterium phage Lukilu, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1452. spacer 2.29|2064755|29|CP031810|CRT matches to MK359329 (Mycobacterium phage Kamryn, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1453. spacer 2.29|2064755|29|CP031810|CRT matches to JQ911768 (Mycobacterium phage Ava3, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1454. spacer 2.29|2064755|29|CP031810|CRT matches to NC_004687 (Mycobacterium phage Bxz1, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1455. spacer 2.29|2064755|29|CP031810|CRT matches to MN183280 (Mycobacteriophage LolaVinca, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1456. spacer 2.29|2064755|29|CP031810|CRT matches to MK359345 (Mycobacterium phage QBert, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1457. spacer 2.29|2064755|29|CP031810|CRT matches to GQ303260 (Mycobacterium phage ET08, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1458. spacer 2.29|2064755|29|CP031810|CRT matches to MH744422 (Mycobacterium phage Roots515, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1459. spacer 2.29|2064755|29|CP031810|CRT matches to MK359321 (Mycobacterium phage Phusco, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1460. spacer 2.29|2064755|29|CP031810|CRT matches to MK359362 (Mycobacterium phage Atlantean, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1461. spacer 2.29|2064755|29|CP031810|CRT matches to NC_029044 (Mycobacterium phage Breeniome, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1462. spacer 2.29|2064755|29|CP031810|CRT matches to MK878897 (Mycobacterium phage Blackbrain, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1463. spacer 2.29|2064755|29|CP031810|CRT matches to MK359359 (Mycobacterium phage Colt, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1464. spacer 2.29|2064755|29|CP031810|CRT matches to MF919527 (Mycobacterium phage Phox, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1465. spacer 2.29|2064755|29|CP031810|CRT matches to MT818416 (Mycobacterium phage BackyardAgain, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1466. spacer 2.29|2064755|29|CP031810|CRT matches to MK359330 (Mycobacterium phage Iota, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1467. spacer 2.29|2064755|29|CP031810|CRT matches to KT365398 (Mycobacterium phage DTDevon, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1468. spacer 2.29|2064755|29|CP031810|CRT matches to KX369583 (Mycobacterium phage Littleton, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1469. spacer 2.29|2064755|29|CP031810|CRT matches to MF919494 (Mycobacterium phage BeanWater, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1470. spacer 2.29|2064755|29|CP031810|CRT matches to NC_028869 (Mycobacterium phage HyRo, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1471. spacer 2.29|2064755|29|CP031810|CRT matches to KC691257 (Mycobacterium phage Astraea, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1472. spacer 2.29|2064755|29|CP031810|CRT matches to MG872839 (Mycobacterium phage LifeSavor, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1473. spacer 2.29|2064755|29|CP031810|CRT matches to KC748968 (Mycobacterium phage Gizmo, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1474. spacer 2.29|2064755|29|CP031810|CRT matches to KC748970 (Mycobacterium phage ArcherS7, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1475. spacer 2.29|2064755|29|CP031810|CRT matches to MK359353 (Mycobacterium phage BadAgartude, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1476. spacer 2.29|2064755|29|CP031810|CRT matches to MH697590 (Mycobacterium phage Phlegm, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1477. spacer 2.29|2064755|29|CP031810|CRT matches to MK359317 (Mycobacterium phage FrayBell, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1478. spacer 2.29|2064755|29|CP031810|CRT matches to MT553335 (Mycobacterium phage Ronan, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1479. spacer 2.29|2064755|29|CP031810|CRT matches to MN428066 (Mycobacterium phage JPickles, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1480. spacer 2.29|2064755|29|CP031810|CRT matches to MK359305 (Mycobacterium phage Teardrop, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1481. spacer 2.29|2064755|29|CP031810|CRT matches to MF919513 (Mycobacterium phage Koguma, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1482. spacer 2.29|2064755|29|CP031810|CRT matches to NC_028986 (Mycobacterium phage Alice, complete sequence) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1483. spacer 2.29|2064755|29|CP031810|CRT matches to JN204348 (Mycobacterium phage Sebata, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1484. spacer 2.29|2064755|29|CP031810|CRT matches to MN183285 (Mycobacterium phage YoungMoneyMata, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1485. spacer 2.29|2064755|29|CP031810|CRT matches to MK450423 (Mycobacterium phage Stubby, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1486. spacer 2.29|2064755|29|CP031810|CRT matches to MF919493 (Mycobacterium phage Audrick, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1487. spacer 2.29|2064755|29|CP031810|CRT matches to MK359326 (Mycobacterium phage Pivoine, complete genome) position: , mismatch: 6, identity: 0.793

aatcggagtcgctgtccgagtcggagtcg	CRISPR spacer
agtcactatcgctgtccgagtcggaatcg	Protospacer
*.**.  .*****************.***

1488. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.829

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
caacagaatccgagtcgctgtcggagtccgagtcg	Protospacer
 . *.**.** ************************

1489. spacer 2.31|2064899|35|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.829

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
agtcggagtcggagtcggagtcggagtcggttgcg	Protospacer
*****************  ********* *   **

1490. spacer 2.31|2064899|35|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.829

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
agtcggagtcggagtcggagtcggagtcggttgcg	Protospacer
*****************  ********* *   **

1491. spacer 2.33|2065037|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.793

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
aatccgagtcggagtcggagtcgctgtcc	Protospacer
***********  **********  .**

1492. spacer 2.34|2065091|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.793

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tcgacgaatcgctgtcggagtccgaatcg	Protospacer
    ************.**.*********

1493. spacer 2.42|2065727|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.793

aatccgaatcactgtcggagtcggagtcg	CRISPR spacer
----cgaatcgctgtcggagtcagagtcg	Protospacer
    ******.***********.******

1494. spacer 2.44|2065841|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.793

agtcagaatcgctgtcagagtccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcactgtca	Protospacer
**** *****************   .**.

1495. spacer 2.47|2066015|29|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.793

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
agtccgaatcgctgtcagagtcactgtca	Protospacer
*******************.**   .**.

1496. spacer 2.47|2066015|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.793

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
tcgacgaatcgctgtcggagtccgaatcg	Protospacer
    ************.**.*********

1497. spacer 2.49|2066123|29|CP031810|CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgctggtgtcggagtcggagtcggagtcg	Protospacer
 *..** ******************.**.

1498. spacer 2.49|2066123|29|CP031810|CRT matches to KU886268 (Freshwater phage uvFW-CGR-AMD-COM-C203, complete genome) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggagtcggacttggagcag	Protospacer
******************* *.***.. .

1499. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgctggtgtcggagtcggagtcggagtcg	Protospacer
 *..** ******************.**.

1500. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcagagtcggagtcggagtcgctgtcc	Protospacer
 ***.******************  .**

1501. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcgctgtcggagtcggagtcgctgtcc	Protospacer
*****  ****************  .**

1502. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcagagtccgagtcgctgtcc	Protospacer
**********.***** ******  .**

1503. spacer 2.49|2066123|29|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
aatccgagtcggagtcggagtcgctgtcc	Protospacer
*.** ******************  .**

1504. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggcgtcggagtcggggtcggcgtcg	Protospacer
 ***** ***********.***** .**.

1505. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggcgtcggcgtcggagcag	Protospacer
************ ***** ******.. .

1506. spacer 2.49|2066123|29|CP031810|CRT matches to JQ807233 (Environmental Halophage eHP-12, partial genome) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcggagtcggattcggagtcggttctg	Protospacer
************* **********  ...

1507. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcgtcggagtcggcgttg	Protospacer
 *********** *********** .*..

1508. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
ggtgggagtcggcgtcggagtcggcgtcg	Protospacer
.** ******** *********** .**.

1509. spacer 2.49|2066123|29|CP031810|CRT matches to MN693281 (Marine virus AFVG_25M371, complete genome) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
ggggggagtcggagtcggagtcggagttg	Protospacer
.*  *********************.*..

1510. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggtgtcggcgtcggagtcggtgtcg	Protospacer
 ***** ***** *********** .**.

1511. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggcgtcggcgtcggagtcggtgtcg	Protospacer
 ***** ***** *********** .**.

1512. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016654 (Rhodococcus phage REQ3, complete genome) position: , mismatch: 6, identity: 0.793

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagccggattcggagtcggcccca	Protospacer
 *******.**** **********  .**

1513. spacer 2.51|2066231|29|CP031810|CRT matches to MK112541 (Mycobacterium phage Jessibeth14, complete genome) position: , mismatch: 6, identity: 0.793

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
cgtccgagtcgctgtccgagtcactaccg	Protospacer
 *** ******************  ..**

1514. spacer 2.11|2063351|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.851

aatccgagtcactgtcagagtcggaatcactgtcagagtcagaatcg	CRISPR spacer
agtccgagtcgctgtcagagtcggaatcactgtcagagtcgctgtca	Protospacer
*.********.*****************************.  .**.

1515. spacer 2.11|2063351|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.851

aatccgagtcactgtcagagtcggaatcactgtcagagtcagaatcg	CRISPR spacer
agtccgagtcgctgtcagagtcggaatcactgtcagagtcgctgtca	Protospacer
*.********.*****************************.  .**.

1516. spacer 2.15|2063675|41|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.829

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatcgctatcgctgtcagaatcagagtcgctgtcagagtct	Protospacer
*.***  .************** **************.**.

1517. spacer 2.15|2063675|41|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.829

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatcgctatcgctgtcagaatcagagtcgctgtcagagtct	Protospacer
*.***  .************** **************.**.

1518. spacer 2.15|2063675|41|CP031810|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.829

agtcggagtcgctgtcagaatccgagtcgctgtcagaatcc	CRISPR spacer
aatcgctatcgctgtcagaatcagagtcgctgtcagagtct	Protospacer
*.***  .************** **************.**.

1519. spacer 2.24|2064449|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.851

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
tatccgaatcgctgtcagagtccgagtcgctgtccgaatctgcatca	Protospacer
.********************************* * ***.* .**.

1520. spacer 2.24|2064449|47|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.851

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
aatcactgtcgctgtcagagtcagagtcgctgtcagcatccgaatcg	Protospacer
 ***   .************** ********************.***

1521. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.8

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtcagagtcggagtcactgtcggagtcgctgtca	Protospacer
 ***.***********.***********   ***.

1522. spacer 2.31|2064899|35|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.8

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
tgtccgagtcagagtcgctgtcggagtctgcatcc	Protospacer
 *** *****.*****************.* .**

1523. spacer 2.33|2065037|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.759

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tcgacgaatcgctgtcggagtccgaatcg	Protospacer
    ***.************** *****.

1524. spacer 2.33|2065037|29|CP031810|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.759

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
cttccgtgtcgctgccggagtcggaacac	Protospacer
  **** *******.***********.

1525. spacer 2.33|2065037|29|CP031810|CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 7, identity: 0.759

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
cctccgagtcgctgtcggactcgctgtcg	Protospacer
  ***************** ***  .**.

1526. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.851

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
agtcactgtcactgtcggagtccgaatcgctgtcagagtccgaatcg	Protospacer
*.**   .******************************** *****.

1527. spacer 2.41|2065655|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.851

aatcggagt-cgctgtcagagtccgagtcgctgtcggaatcggaatcg	CRISPR spacer
-gtcagaatccactgtcagagtccgagtcgctgtcggagtccgaatcg	Protospacer
 .**.**.* *.**************************.** ******

1528. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.8

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcggagtccgaatcgctgtcagagtcactgtcg	Protospacer
 ********* *****************   .**.

1529. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.8

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcagagtccgaatcgctgtcagagtcactgtca	Protospacer
 ***.***** *****************   .***

1530. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.8

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcactatccgaatcgctgtcagagtcggaatca	Protospacer
 ***.  .** ***************** ******

1531. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.8

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcagagtcggaatcactgtcagagtcgctgtca	Protospacer
 ***.***********.***********   .***

1532. spacer 2.43|2065781|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.8

agtcggagtcggaatcgctgtcagagtctgaatca	CRISPR spacer
tgtcagagtcggaatcactgtcagagtcgctgtca	Protospacer
 ***.***********.***********   .***

1533. spacer 2.47|2066015|29|CP031810|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 7, identity: 0.759

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
cgtccgaaccgctgtcagaatccctgctg	Protospacer
 *******.**************  ...*

1534. spacer 2.47|2066015|29|CP031810|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 7, identity: 0.759

agtccgaatcgctgtcagaatccgaatcg	CRISPR spacer
cgtccgaaccgctgtcagaatccctgctg	Protospacer
 *******.**************  ...*

1535. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP013855 (Pseudonocardia sp. HH130630-07 plasmid pLS2-1, complete sequence) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtcggtgtcggagtcggcggtc	Protospacer
 *********** *********** . .

1536. spacer 2.49|2066123|29|CP031810|CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagccggagtcggagttggagcag	Protospacer
 *******.************.***.. .

1537. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggcgtcggagtcggtgtcggcgtag	Protospacer
 ***** *********** ***** .* .

1538. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP018205 (Leptolyngbya boryana NIES-2135 plasmid plasmid2 DNA, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcgcagtcggagtcggagttgcggttg	Protospacer
***** ***************.* ..*..

1539. spacer 2.49|2066123|29|CP031810|CRT matches to MH001451 (Mycobacterium phage Nairb, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcggcggagtcggcggcc	Protospacer
 *********** * ********* . *

1540. spacer 2.49|2066123|29|CP031810|CRT matches to MF155936 (Mycobacterium phage ZenTime222, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcggcggagtcggcggcc	Protospacer
 *********** * ********* . *

1541. spacer 2.49|2066123|29|CP031810|CRT matches to MK494089 (Mycobacterium phage Ibrahim, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcggcggagtcggcggcc	Protospacer
 *********** * ********* . *

1542. spacer 2.49|2066123|29|CP031810|CRT matches to NC_024135 (Mycobacterium phage Bernal13, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcggcggagtcggcggcc	Protospacer
 *********** * ********* . *

1543. spacer 2.49|2066123|29|CP031810|CRT matches to KM591905 (Mycobacterium phage RonRayGun, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcggcggagtcggcggcc	Protospacer
 *********** * ********* . *

1544. spacer 2.49|2066123|29|CP031810|CRT matches to MN735432 (Mycobacteriophage Whitty, complete genome) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggagtcggcggcggagtcggcggcc	Protospacer
 *********** * ********* . *

1545. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgtcggagtctgtgtcggagtcggctttg	Protospacer
 ********* * ***********  *..

1546. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP014640 (Leptolyngbya boryana IAM M-101 plasmid pLBX) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
agtcgcagtcggagtcggagttgcggttg	Protospacer
***** ***************.* ..*..

1547. spacer 2.49|2066123|29|CP031810|CRT matches to NC_016587 (Azospirillum lipoferum 4B plasmid AZO_p4, complete sequence) position: , mismatch: 7, identity: 0.759

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
ggtcggagtgggagtcggggtcggcgtgg	Protospacer
.******** ********.***** .* .

1548. spacer 2.51|2066231|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.759

agtcggagtcgctgtccgagtcagagtcg	CRISPR spacer
----cgaatcgctgtcggagtcagagtcg	Protospacer
     **.******** ************

1549. spacer 2.17|2063801|41|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.805

aatccgagt-cgctgtcagagtcagagtcgctgtcggaatcg	CRISPR spacer
-gtcagaatccactgtcagagtccgagtcgctgtcggagtcc	Protospacer
 .** **.* *.*********** **************.**

1550. spacer 2.31|2064899|35|CP031810|CRT matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 8, identity: 0.771

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
ggtcggagtcggagtcggagtcggagtcgtgggct	Protospacer
.****************  *********  .* *

1551. spacer 2.31|2064899|35|CP031810|CRT matches to KX752698 (Mycobacterium phage Tonenili, complete genome) position: , mismatch: 8, identity: 0.771

agtcggagtcggagtcgctgtcgga---gtccgagtcg	CRISPR spacer
tgtcggtgtcggagtcgctgtccgagctgcccgaa---	Protospacer
 ***** *************** **   *.****.

1552. spacer 2.33|2065037|29|CP031810|CRT matches to MH976512 (Gordonia phage Geodirt, complete genome) position: , mismatch: 8, identity: 0.724

aatccgagtcgctgtcggagtcggaatca	CRISPR spacer
tgaccgaggcgatgtcggagtcggaagat	Protospacer
 . ***** ** **************

1553. spacer 2.34|2065091|29|CP031810|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.724

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
cgtccgaaccgctgtcagaatccctgctg	Protospacer
 .******.**************  ...*

1554. spacer 2.34|2065091|29|CP031810|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.724

aatccgaatcgctgtcagaatccgaatcg	CRISPR spacer
cgtccgaaccgctgtcagaatccctgctg	Protospacer
 .******.**************  ...*

1555. spacer 2.37|2065301|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.83

aatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatca	CRISPR spacer
agtcggagtcactgtcggagtccgaatcgctgtcagagtcactgtcg	Protospacer
*.** **.********************************.  .**.

1556. spacer 2.48|2066069|29|CP031810|CRT matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.724

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
ggtcagaatcgctgccagaatcgctgcct	Protospacer
.*************.*******   ..*

1557. spacer 2.48|2066069|29|CP031810|CRT matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.724

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
ggtcagaatcgctgccagaatcgctgcct	Protospacer
.*************.*******   ..*

1558. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.724

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggtgtcggggtcggagtcggcgcgg	Protospacer
 ***** *****.*********** .. .

1559. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.724

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
cgtcggcgtcggagtcggtgtcggcgcag	Protospacer
 ***** *********** ***** .. .

1560. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.724

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
tgctggagtcggagtcggcgtcggagcag	Protospacer
 *..************** ******.. .

1561. spacer 2.49|2066123|29|CP031810|CRT matches to NZ_CP015597 (Mycobacterium sp. YC-RL4 plasmid pMYC1, complete sequence) position: , mismatch: 8, identity: 0.724

agtcggagtcggagtcggagtcggaatca	CRISPR spacer
gttcggagtcggagtccgggtcggatcag	Protospacer
. ************** *.****** . .

1562. spacer 2.16|2063741|35|CP031810|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.743

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
cgaccgtcgacgaatcgctgtcggagtccgaatcg	Protospacer
.* * *    ************.***** ******

1563. spacer 2.24|2064449|47|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.809

catccgaatcgctgtcagagtccgagtcgctgtcagcatccgagtcg	CRISPR spacer
aatccgagtcgctgtcagagtccgaatcgctgtcagagtcactgtca	Protospacer
 ******.*****************.********** .**   ***.

1564. spacer 2.31|2064899|35|CP031810|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.743

agtcggagtcggagtcgctgtcggagtccgagtcg	CRISPR spacer
cgccaagatcggagtcactgtcagagtccgagtcc	Protospacer
 *.*....********.*****.***********

1565. spacer 2.36|2065217|59|CP031810|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.847

agtccgagtcactgtcagagtcggagtcggagtcgctgtcggaatcgctgtccgaatcc-	CRISPR spacer
aatccgagtcactgtcagagtcggagtcggagtcgctgtccga------gtccgaatcgc	Protospacer
*.************************************** **      *********

1566. spacer 2.48|2066069|29|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 9, identity: 0.69

agtcagaatcgctgtcagaatccgaatcg	CRISPR spacer
tgtcagagtcgctgtcagaatc-------	Protospacer
 ******.**************

1567. spacer 2.16|2063741|35|CP031810|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 12, identity: 0.657

tgtcagaatccgaatcgctgtcagagtcagaatcg	CRISPR spacer
----------cgaatcgctgtcggagtcagagtcg	Protospacer
          ************.********.***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

67213 : 153688

Enterobacteria_phage(19.57%)

terminase,tRNA,tail,integrase,holin,portal,protease

attL 90221:90244|attR 130935:130958

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXS33547.1\|67213_68632_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AXS33548.1\|68683_69076_-	hypothetical protein	NA	NA	NA	NA
AXS33549.1\|69079_69433_-	hypothetical protein	NA	NA	NA	NA
AXS33550.1\|70054_72268_+	EAL domain-containing protein	NA	NA	NA	NA
AXS33551.1\|72274_73477_-	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AXS33552.1\|73823_75065_+	divalent metal cation transporter	NA	NA	NA	NA
AXS33553.1\|75122_75482_-	DUF2502 domain-containing protein	NA	NA	NA	NA
AXS33554.1\|75612_76605_-	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
AXS38341.1\|76785_78447_+	indolepyruvate decarboxylase	NA	NA	NA	NA
AXS33555.1\|78443_79679_-	ion channel protein	NA	NA	NA	NA
AXS33556.1\|79942_80908_+	glucokinase	NA	NA	NA	NA
AXS38342.1\|80961_81699_-	DNA-binding response regulator	A0A2R2ZGH8	Clostridioides_phage	1.5e-14	26.3
AXS33557.1\|81710_83408_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-47	28.5
AXS33558.1\|83516_83702_-	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
AXS33559.1\|83790_85005_+	alanine transaminase	NA	NA	NA	NA
AXS38343.1\|85075_85147_-	membrane protein YpdK	NA	NA	NA	NA
AXS33560.1\|85485_86682_-	MFS transporter	NA	NA	NA	NA
AXS33561.1\|86678_87137_-	nucleoside deaminase	A0A0B5J096	Pandoravirus	9.4e-12	32.3
AXS33562.1\|87269_88178_+	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	7.8e-10	24.2
AXS33563.1\|88187_89069_-	hypothetical protein	A0A2H4JEC4	uncultured_Caudovirales_phage	1.5e-05	56.8
AXS33564.1\|89437_89920_-	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
90221:90244	attL	NA	NA	NA	NA
AXS33565.1\|90438_91623_+\|integrase	site-specific integrase	A0A2R2Z2Y0	Escherichia_phage	5.5e-197	82.7
AXS33566.1\|91647_92577_+	hypothetical protein	NA	NA	NA	NA
AXS38344.1\|92582_92768_-	DNA-binding protein	A0A2R2Z2X2	Escherichia_phage	2.6e-13	60.0
AXS33567.1\|92779_92962_-	hypothetical protein	NA	NA	NA	NA
AXS33568.1\|92958_93105_-\|integrase	integrase	NA	NA	NA	NA
AXS38345.1\|93280_94144_-	DNA-binding protein	A0A2H4J902	uncultured_Caudovirales_phage	2.0e-71	58.2
AXS33569.1\|94225_95038_-	DUF2303 family protein	NA	NA	NA	NA
AXS33570.1\|95081_95441_-	hypothetical protein	NA	NA	NA	NA
AXS33571.1\|95876_96812_+	hypothetical protein	NA	NA	NA	NA
AXS38346.1\|97629_98304_-	LexA family transcriptional repressor	U5P0T5	Shigella_phage	3.3e-114	86.8
AXS33572.1\|98394_98595_+	transcriptional regulator	U5P445	Shigella_phage	2.8e-21	76.9
AXS33573.1\|98638_99154_+	DNA-binding protein	A0A1C9II13	Salmonella_phage	2.6e-58	63.4
AXS33574.1\|99192_99471_+	hypothetical protein	NA	NA	NA	NA
AXS33575.1\|99632_99908_+	hypothetical protein	NA	NA	NA	NA
AXS33576.1\|99900_101430_+	DEAD/DEAH box helicase	A0A286N2P9	Klebsiella_phage	6.6e-203	66.9
AXS33577.1\|101426_102398_+	DNA primase	A0A286N2Q0	Klebsiella_phage	2.1e-109	61.1
AXS38347.1\|102367_103012_+	NinG family protein	A0A1W6JNX3	Morganella_phage	1.9e-39	54.3
AXS33578.1\|103008_103650_+	DNA methyltransferase	I6PDF5	Cronobacter_phage	1.3e-83	68.9
AXS33579.1\|103646_104225_+	DUF1133 family protein	A0A0U2S606	Escherichia_phage	1.7e-50	57.2
AXS33580.1\|104298_104895_-	hypothetical protein	NA	NA	NA	NA
AXS33581.1\|105024_105420_+	hypothetical protein	K7PHB9	Enterobacterial_phage	2.6e-63	98.5
AXS33582.1\|105406_105688_+\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	3.9e-37	80.6
AXS33583.1\|105687_106317_+	glycoside hydrolase family 19 protein	F1C591	Cronobacter_phage	2.7e-86	74.4
AXS33584.1\|106319_106595_+	hypothetical protein	G8C7W1	Escherichia_phage	1.3e-24	70.8
AXS33585.1\|106545_106743_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	5.0e-23	89.5
AXS33586.1\|106832_107174_+	hypothetical protein	NA	NA	NA	NA
AXS33587.1\|107317_107563_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	9.3e-35	96.3
AXS38348.1\|107788_108049_+	hypothetical protein	NA	NA	NA	NA
AXS33588.1\|108622_109114_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	1.4e-66	83.4
AXS33589.1\|109113_111222_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	83.6
AXS33590.1\|111218_111434_+	hypothetical protein	A5LH28	Enterobacteria_phage	1.5e-25	78.6
AXS33591.1\|111430_112930_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	4.3e-247	83.4
AXS33592.1\|112874_114890_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	0.0e+00	84.1
AXS33593.1\|114970_115297_+	DUF2190 family protein	K7PJY3	Enterobacterial_phage	8.1e-34	67.3
AXS33594.1\|115289_115583_+	ATP-binding protein	NA	NA	NA	NA
AXS33595.1\|115572_116124_+\|tail	phage tail protein	K7P7A8	Enterobacteria_phage	4.5e-53	67.3
AXS33596.1\|116120_116519_+\|tail	phage tail protein	K7PHM6	Enterobacterial_phage	3.2e-40	57.8
AXS33597.1\|116526_117009_+\|tail	phage tail protein	M9NYX0	Enterobacteria_phage	5.7e-60	68.6
AXS33598.1\|117051_117447_+\|tail	phage tail protein	M9NZD7	Enterobacteria_phage	2.4e-08	27.5
AXS33599.1\|117467_117785_+\|tail	phage tail assembly protein T	A0A0K2FJB3	Enterobacteria_phage	1.4e-19	51.5
AXS33600.1\|117765_120462_+\|tail	phage tail tape measure protein	K7PKR0	Enterobacteria_phage	1.3e-201	62.6
AXS33601.1\|120461_120935_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.7e-53	60.9
AXS33602.1\|120921_121404_+	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	2.1e-83	97.5
AXS33603.1\|121413_121794_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	4.0e-69	95.2
AXS33604.1\|121790_124859_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	97.5
AXS33605.1\|124934_127088_+	hypothetical protein	B5TAB2	Burkholderia_phage	8.1e-90	42.0
AXS33606.1\|127100_127835_+	hypothetical protein	NA	NA	NA	NA
AXS33607.1\|127889_128534_-	hypothetical protein	NA	NA	NA	NA
AXS38349.1\|128848_129388_+	DNA-invertase	A0A286S1P7	Klebsiella_phage	1.1e-59	79.6
AXS33608.1\|129438_129861_+	hypothetical protein	K7P834	Enterobacteria_phage	8.9e-25	43.8
AXS33609.1\|130272_130512_+	DNA polymerase V	I6PD82	Cronobacter_phage	9.8e-21	54.4
AXS33610.1\|130468_130840_+	hypothetical protein	K7PGV5	Enterobacterial_phage	9.2e-26	50.9
AXS33611.1\|131046_131976_-	hypothetical protein	E7DYY8	Enterobacteria_phage	5.2e-134	81.4
130935:130958	attR	NA	NA	NA	NA
AXS33612.1\|132265_133027_+	phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
AXS33613.1\|133088_134417_-	long-chain fatty acid transporter FadL	NA	NA	NA	NA
AXS33614.1\|134784_135069_+	DUF406 family protein	NA	NA	NA	NA
AXS33615.1\|135228_136539_+	acetyl-CoA C-acyltransferase FadI	NA	NA	NA	NA
AXS33616.1\|136538_138683_+	fatty acid oxidation complex subunit alpha FadJ	NA	NA	NA	NA
AXS33617.1\|138892_139378_+	phosphohistidine phosphatase SixA	NA	NA	NA	NA
AXS33618.1\|139398_139950_-	endonuclease SmrB	NA	NA	NA	NA
AXS33619.1\|140117_141050_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AXS33620.1\|141091_142177_+	chorismate synthase	A0A291AU41	Pandoravirus	4.5e-89	46.6
AXS33621.1\|142179_143004_+	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
AXS33622.1\|143003_143813_+	hypothetical protein	NA	NA	NA	NA
AXS33623.1\|143812_144361_+	elongation factor P hydroxylase	NA	NA	NA	NA
AXS33624.1\|144392_144674_+	YfcL family protein	NA	NA	NA	NA
AXS38350.1\|144735_146724_-\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
AXS33625.1\|146882_148103_+	beta-ketoacyl-ACP synthase I	NA	NA	NA	NA
AXS33626.1\|148312_149488_+	arabinose transporter	NA	NA	NA	NA
AXS33627.1\|149574_150552_-	flagella biosynthesis regulator Flk	NA	NA	NA	NA
AXS38351.1\|150686_151799_+	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	3.5e-20	28.0
AXS33628.1\|151862_152876_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AXS33629.1\|152875_153688_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA

DBSCAN-SWA_2

358328 : 365233

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXS38358.1\|358328_359192_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5
AXS33806.1\|359202_359976_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
AXS38359.1\|360216_361110_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.6e-15	29.8
AXS33807.1\|361355_362717_-	U32 family peptidase	Q6DW11	Phage_TP	1.8e-207	94.8
AXS33808.1\|363035_363758_-	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
AXS33809.1\|363754_365233_-	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	8.5e-30	28.3

DBSCAN-SWA_3

585948 : 653752

Klebsiella_phage(54.17%)

terminase,tRNA,capsid,tail,integrase,holin,portal,head,protease

attL 585801:585860|attR 624864:624988

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
585801:585860	attL	NA	NA	NA	NA
AXS33979.1\|585948_586983_-\|integrase	integrase	K7PLZ2	Enterobacterial_phage	7.0e-124	64.0
AXS33980.1\|586982_587213_-	DUF4224 domain-containing protein	NA	NA	NA	NA
AXS33981.1\|587245_587518_-	hypothetical protein	K7PKM4	Enterobacterial_phage	5.0e-13	44.8
AXS33982.1\|587514_587790_-	hypothetical protein	NA	NA	NA	NA
AXS33983.1\|587786_588269_-	class I SAM-dependent methyltransferase	H9C170	Pectobacterium_phage	1.4e-71	81.3
AXS33984.1\|588261_588606_-	hypothetical protein	NA	NA	NA	NA
AXS33985.1\|588733_589519_-	hypothetical protein	C7BGF1	Burkholderia_phage	4.0e-63	52.5
AXS33986.1\|589518_589818_-	hypothetical protein	K7PJS4	Enterobacterial_phage	9.4e-13	46.7
AXS33987.1\|590436_591093_-	helix-turn-helix domain-containing protein	K7PLZ5	Enterobacterial_phage	2.0e-108	87.2
AXS33988.1\|591191_591389_+	hypothetical protein	K7PHB1	Enterobacterial_phage	1.1e-25	86.2
AXS33989.1\|591534_591858_-	hypothetical protein	NA	NA	NA	NA
AXS33990.1\|591916_592384_+	hypothetical protein	K7PJS5	Enterobacterial_phage	7.4e-65	85.8
AXS33991.1\|592621_592801_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	1.6e-15	75.0
AXS33992.1\|592790_593759_+	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	9.3e-86	66.7
AXS33993.1\|593755_594565_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	2.7e-110	69.3
AXS33994.1\|594574_594952_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.3e-48	73.6
AXS33995.1\|594964_595945_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.1e-134	66.9
AXS33996.1\|595963_596305_+	antitermination protein	A0A0P0ZCW0	Stx2-converting_phage	2.5e-54	84.1
AXS33997.1\|596353_596839_-	hypothetical protein	NA	NA	NA	NA
AXS33998.1\|596863_597685_-	hypothetical protein	NA	NA	NA	NA
AXS33999.1\|599082_599394_+\|holin	holin	A0A286N2Q5	Klebsiella_phage	1.1e-40	83.5
AXS34000.1\|599390_599930_+	hypothetical protein	A0A286N2Q6	Klebsiella_phage	4.8e-100	97.2
AXS34001.1\|599926_600274_+	hypothetical protein	A0A286N2Q7	Klebsiella_phage	2.0e-38	78.3
AXS34002.1\|600270_600546_+	hypothetical protein	NA	NA	NA	NA
AXS34003.1\|600496_600688_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	3.4e-24	94.6
AXS34004.1\|601007_601253_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	1.1e-30	90.1
AXS34005.1\|601324_601531_+	DUF551 domain-containing protein	A0A286N2R2	Klebsiella_phage	2.7e-35	100.0
AXS34006.1\|601602_601893_+	HNH endonuclease	A0A286N2R3	Klebsiella_phage	6.9e-53	97.9
AXS34007.1\|601905_602115_+	serine acetyltransferase	A0A286N2R4	Klebsiella_phage	1.2e-25	88.4
AXS34008.1\|602236_602671_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	6.2e-74	100.0
AXS34009.1\|602680_604213_+\|terminase	terminase	A0A286S1M9	Klebsiella_phage	1.1e-295	99.8
AXS34010.1\|604215_605493_+\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	6.2e-247	100.0
AXS34011.1\|605498_606179_+\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.6e-124	100.0
AXS34012.1\|606190_607354_+\|capsid	phage major capsid protein	A0A286S1R4	Klebsiella_phage	1.0e-211	99.7
AXS34013.1\|607580_607907_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	7.5e-56	100.0
AXS34014.1\|607967_608165_+	hypothetical protein	A0A286S2A5	Klebsiella_phage	1.7e-26	100.0
AXS34015.1\|608166_608499_+\|head,tail	head-tail adaptor protein	A0A286S2A2	Klebsiella_phage	2.0e-56	99.1
AXS34016.1\|608491_609031_+	HK97 gp10 family phage protein	A0A286S249	Klebsiella_phage	1.0e-94	100.0
AXS34017.1\|609027_609393_+	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	1.9e-60	91.7
AXS34018.1\|609449_609941_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	2.5e-87	99.4
AXS34019.1\|609984_610338_+\|tail	phage tail protein	A0A286S1N4	Klebsiella_phage	3.8e-61	99.1
AXS34020.1\|610370_610634_+\|tail	phage tail protein	A0A286S1P2	Klebsiella_phage	1.7e-42	97.7
AXS34021.1\|610699_611167_+	hypothetical protein	NA	NA	NA	NA
AXS34022.1\|611211_613659_+\|tail	phage tail tape measure protein	A0A286S1S3	Klebsiella_phage	1.2e-275	66.1
AXS34023.1\|613658_614138_+	hypothetical protein	A0A286S298	Klebsiella_phage	8.1e-91	95.6
AXS34024.1\|614124_614607_+	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	1.1e-84	98.1
AXS34025.1\|614616_614997_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	1.4e-69	96.0
AXS34026.1\|614993_618062_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	98.1
AXS34027.1\|618136_620290_+	hypothetical protein	B5TAB2	Burkholderia_phage	3.6e-90	42.2
AXS34028.1\|620302_621037_+	hypothetical protein	NA	NA	NA	NA
AXS34029.1\|621048_621378_-	hypothetical protein	NA	NA	NA	NA
AXS34030.1\|621414_621744_-	hypothetical protein	NA	NA	NA	NA
AXS34031.1\|622096_622336_+	DNA polymerase V	I6PD82	Cronobacter_phage	1.5e-21	55.7
AXS34032.1\|622292_622661_+	hypothetical protein	K7PGV5	Enterobacterial_phage	2.3e-24	49.1
AXS34033.1\|622833_624213_-	hypothetical protein	NA	NA	NA	NA
AXS34034.1\|625147_626029_+	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
624864:624988	attR	NA	NA	NA	NA
AXS34035.1\|626127_626796_+	YecA family protein	NA	NA	NA	NA
AXS34036.1\|626820_628032_-	tyrosine transporter TyrP	NA	NA	NA	NA
AXS34037.1\|628223_628463_+	DUF2492 family protein	NA	NA	NA	NA
AXS34038.1\|628498_628996_-	non-heme ferritin	NA	NA	NA	NA
AXS34039.1\|629053_629233_-	hypothetical protein	NA	NA	NA	NA
AXS34040.1\|629404_630043_+	hypothetical protein	NA	NA	NA	NA
AXS34041.1\|630077_631502_-	MFS transporter	NA	NA	NA	NA
AXS34042.1\|631652_631904_+	DUF2766 domain-containing protein	NA	NA	NA	NA
AXS34043.1\|631941_633504_-	MFS transporter	NA	NA	NA	NA
AXS34044.1\|633518_633677_+	succinate dehydrogenase	NA	NA	NA	NA
AXS34045.1\|633747_634257_-	non-heme ferritin-like protein	NA	NA	NA	NA
AXS34046.1\|634350_634554_+	hypothetical protein	NA	NA	NA	NA
AXS34047.1\|635148_636129_+	arabinose ABC transporter substrate-binding protein	NA	NA	NA	NA
AXS34048.1\|636191_637706_+	L-arabinose ABC transporter ATP-binding protein AraG	A0A2R8FG22	Brazilian_cedratvirus	6.9e-11	30.0
AXS34049.1\|637720_638701_+	L-arabinose ABC transporter permease AraH	NA	NA	NA	NA
AXS34050.1\|638862_639651_+	trehalose-phosphatase	NA	NA	NA	NA
AXS34051.1\|639625_641050_+	trehalose-6-phosphate synthase	NA	NA	NA	NA
AXS34052.1\|641073_641502_-	universal stress protein UspC	NA	NA	NA	NA
AXS34053.1\|641854_643438_+	MFS transporter	NA	NA	NA	NA
AXS34054.1\|643442_644582_+	glycoside hydrolase family 105 protein	NA	NA	NA	NA
AXS34055.1\|644643_646377_-\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	8.0e-88	33.9
AXS34056.1\|646612_647182_+	VOC family protein	NA	NA	NA	NA
AXS34057.1\|647258_648002_+	copper homeostasis protein CutC	NA	NA	NA	NA
AXS34058.1\|648083_649088_-\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AXS34059.1\|649084_649828_-	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	4.1e-25	30.0
AXS34060.1\|649867_650263_-	hypothetical protein	NA	NA	NA	NA
AXS34061.1\|650315_651134_-	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	2.0e-60	82.7
AXS34062.1\|651130_651697_-	hydrolase	NA	NA	NA	NA
AXS34063.1\|651964_653752_+\|tRNA	aspartate--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.3e-11	27.2

DBSCAN-SWA_4

1462595 : 1473482

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXS34817.1\|1462595_1465703_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6
AXS34818.1\|1465757_1467023_+	MFS transporter	NA	NA	NA	NA
AXS34819.1\|1467053_1468142_-	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	4.0e-210	99.7
AXS34820.1\|1468228_1468489_-	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
AXS34821.1\|1468786_1469647_+	class A broad-spectrum beta-lactamase SHV-11	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AXS34822.1\|1469667_1470429_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AXS34823.1\|1470689_1471592_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
AXS34824.1\|1471603_1472869_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	7.8e-234	99.8
AXS34825.1\|1472861_1473482_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_5

2149822 : 2237960

Salmonella_phage(54.39%)

tRNA,lysis,tail,capsid,integrase,portal,plate,head,protease

attL 2205459:2205479|attR 2238697:2238717

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXS35426.1\|2149822_2151115_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.3e-94	44.7
AXS35427.1\|2151205_2152549_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	5.6e-81	40.8
AXS35428.1\|2152557_2153169_-	outer membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AXS35429.1\|2153291_2157545_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	5.2e-88	49.2
AXS35430.1\|2157680_2158175_-	leucine-responsive regulatory protein	NA	NA	NA	NA
AXS35431.1\|2158680_2159676_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.3e-62	44.0
AXS35432.1\|2159790_2161557_+	cysteine/glutathione ABC transporter permease/ATP-binding protein CydD	W8CYL7	Bacillus_phage	2.3e-21	25.9
AXS35433.1\|2161557_2163279_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	9.0e-15	34.0
AXS35434.1\|2163323_2164025_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AXS35435.1\|2164378_2164597_+	translation initiation factor IF-1	NA	NA	NA	NA
AXS35436.1\|2164715_2166995_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
AXS35437.1\|2167025_2167343_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
AXS35438.1\|2167668_2167890_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
AXS35439.1\|2167844_2168027_-	hypothetical protein	NA	NA	NA	NA
AXS35440.1\|2167966_2169907_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
AXS35441.1\|2169903_2171019_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
AXS35442.1\|2171165_2172824_-	DUF2813 domain-containing protein	NA	NA	NA	NA
AXS35443.1\|2173243_2173939_+	aquaporin Z	NA	NA	NA	NA
AXS35444.1\|2174054_2174954_+	lysine exporter LysO family protein	NA	NA	NA	NA
AXS38442.1\|2175097_2176750_+	hydroxylamine reductase	NA	NA	NA	NA
AXS35445.1\|2176760_2177729_+	NADH oxidoreductase	NA	NA	NA	NA
AXS35446.1\|2177940_2178375_-	DoxX family protein	NA	NA	NA	NA
AXS38443.1\|2178526_2180245_+	ubiquinone-dependent pyruvate dehydrogenase	NA	NA	NA	NA
AXS35447.1\|2180283_2181285_+	low-specificity L-threonine aldolase	NA	NA	NA	NA
AXS35448.1\|2181295_2182738_+	SDR family oxidoreductase	NA	NA	NA	NA
AXS35449.1\|2182825_2183839_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AXS35450.1\|2183835_2184666_-	N-acetylmuramoyl-L-alanine amidase	A0A1B0UZW5	Roseobacter_phage	4.1e-05	31.6
AXS35451.1\|2184697_2185837_-	GGDEF domain-containing protein	NA	NA	NA	NA
AXS35452.1\|2185889_2186069_+	hypothetical protein	NA	NA	NA	NA
AXS35453.1\|2186714_2187230_+	lipoprotein	NA	NA	NA	NA
AXS35454.1\|2187456_2188185_+	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	1.2e-29	37.1
AXS38444.1\|2188205_2188937_+	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
AXS35455.1\|2188943_2189660_+	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
AXS35456.1\|2189659_2190328_+	arginine ABC transporter permease ArtM	NA	NA	NA	NA
AXS35457.1\|2190511_2191243_+	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
AXS35458.1\|2191329_2192802_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	7.9e-28	31.8
AXS35459.1\|2192798_2193515_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.2e-34	36.9
AXS35460.1\|2193593_2194721_-	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A2K5B251	Erysipelothrix_phage	1.3e-19	25.6
AXS35461.1\|2194762_2195251_-	DUF2593 family protein	NA	NA	NA	NA
AXS35462.1\|2195308_2196154_-	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AXS35463.1\|2196150_2197104_-	putrescine ABC transporter permease PotH	NA	NA	NA	NA
AXS38445.1\|2197114_2198248_-	putrescine ABC transporter ATP-binding subunit PotG	G3M9Y6	Bacillus_virus	2.2e-30	34.9
AXS35464.1\|2198411_2199524_-	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AXS35465.1\|2199872_2200352_-	YbjN domain-containing protein	NA	NA	NA	NA
AXS35466.1\|2200440_2201343_-	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	7.7e-34	34.9
AXS35467.1\|2201457_2202180_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AXS35468.1\|2202163_2202451_-	DUF1418 family protein	NA	NA	NA	NA
AXS35469.1\|2202653_2202917_+	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	1.6e-27	73.1
AXS35470.1\|2202923_2203307_-	hypothetical protein	NA	NA	NA	NA
AXS38446.1\|2203573_2205259_+	transporter	NA	NA	NA	NA
2205459:2205479	attL	NA	NA	NA	NA
AXS35471.1\|2205480_2205699_-	transcriptional regulator	Q53ZE7	Salmonella_virus	8.3e-19	66.2
AXS35472.1\|2205785_2206883_-	phage late control D family protein	E5G6Q3	Salmonella_phage	1.3e-168	82.0
AXS35473.1\|2206879_2207365_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	5.0e-64	77.6
AXS35474.1\|2207361_2209992_-\|tail	phage tail tape measure protein	A0A2H4JGB2	uncultured_Caudovirales_phage	6.8e-115	38.9
AXS35475.1\|2209984_2210104_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	2.2e-13	87.2
AXS35476.1\|2210118_2210418_-\|tail	phage tail assembly protein	E5G6P9	Salmonella_phage	1.4e-32	77.0
AXS35477.1\|2210470_2210986_-\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	1.4e-80	84.2
AXS35478.1\|2210995_2212168_-\|tail	phage tail protein	A0A1S6KZY7	Salmonella_phage	5.4e-205	90.8
AXS35479.1\|2212306_2213467_-\|tail	phage tail protein	S4TP62	Salmonella_phage	1.2e-44	50.0
AXS35480.1\|2213544_2213820_-	hypothetical protein	NA	NA	NA	NA
AXS35481.1\|2213833_2216059_-	endo-N-neuraminidase	K4I5E8	Salmonella_phage	3.0e-10	41.3
AXS38447.1\|2216064_2216661_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	1.8e-55	56.0
AXS35482.1\|2216653_2217562_-\|plate	baseplate assembly protein	E5G6N8	Salmonella_phage	3.4e-106	66.9
AXS35483.1\|2217548_2217911_-\|plate	baseplate assembly protein	A0A1S6KZZ4	Salmonella_phage	9.9e-49	84.7
AXS35484.1\|2217907_2218480_-\|plate	phage baseplate assembly protein V	E5G6N6	Salmonella_phage	2.1e-77	72.3
AXS35485.1\|2218583_2219246_+	hypothetical protein	NA	NA	NA	NA
AXS35486.1\|2219258_2219711_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	6.5e-50	71.4
AXS35487.1\|2219703_2220135_-\|tail	phage tail protein	A0A1S6KZY0	Salmonella_phage	9.9e-64	82.5
AXS35488.1\|2220097_2220301_-	hypothetical protein	A0A1S6KZX6	Salmonella_phage	5.2e-23	78.5
AXS35489.1\|2220230_2220659_-\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	5.6e-51	77.9
AXS35490.1\|2220663_2221173_-	lysozyme	E5G6N1	Salmonella_phage	9.5e-82	83.4
AXS35491.1\|2221153_2221369_-	hypothetical protein	E5G6N0	Salmonella_phage	1.5e-28	85.9
AXS35492.1\|2221372_2221576_-\|tail	phage tail protein	A0A1S6KZY4	Salmonella_phage	1.3e-29	88.1
AXS35493.1\|2221575_2222040_-\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	6.7e-74	84.4
AXS35494.1\|2222136_2222787_-	hypothetical protein	E5G6M7	Salmonella_phage	2.1e-102	86.1
AXS35495.1\|2222790_2223843_-\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	2.1e-171	89.1
AXS35496.1\|2223859_2224693_-\|capsid	GPO family capsid scaffolding protein	A0A1S6KZW9	Salmonella_phage	2.2e-99	74.4
AXS35497.1\|2224832_2226596_+	oxidoreductase	A0A1S6KZW3	Salmonella_phage	0.0e+00	92.6
AXS35498.1\|2226595_2227624_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	6.2e-173	90.3
AXS35499.1\|2227670_2229335_-	hypothetical protein	X2KLG0	Campylobacter_phage	4.5e-11	24.9
AXS35500.1\|2229325_2229556_-	hypothetical protein	NA	NA	NA	NA
AXS35501.1\|2229630_2229816_-	hypothetical protein	E5G6M0	Salmonella_phage	5.6e-08	50.0
AXS35502.1\|2232332_2232560_-	TraR/DksA family transcriptional regulator	A0A1S6L007	Salmonella_phage	7.8e-28	80.0
AXS35503.1\|2232559_2232796_-	DUF2732 domain-containing protein	A0A0M3UL87	Salmonella_phage	8.2e-12	55.4
AXS35504.1\|2232863_2233205_-	hypothetical protein	E5G6L5	Salmonella_phage	1.3e-45	80.5
AXS35505.1\|2233168_2233369_-	DUF2724 domain-containing protein	Q6K1F7	Salmonella_virus	1.2e-24	80.3
AXS35506.1\|2233376_2233886_-	hypothetical protein	A0A1S6L008	Salmonella_phage	1.4e-72	82.1
AXS35507.1\|2233918_2234140_-	regulator	NA	NA	NA	NA
AXS35508.1\|2234265_2234826_+	phage repressor protein	A0A1S6KZZ7	Salmonella_phage	2.0e-40	44.8
AXS35509.1\|2234837_2235422_+	hypothetical protein	NA	NA	NA	NA
AXS35510.1\|2235432_2236506_+	N-acetyltransferase	Q6SE88	Lactobacillus_prophage	1.1e-68	40.0
AXS35511.1\|2236483_2236855_+	ASCH domain-containing protein	Q6SE87	Lactobacillus_prophage	6.2e-30	52.4
AXS35512.1\|2236934_2237960_+\|integrase	integrase	A0A218M4I3	Erwinia_phage	5.2e-103	55.8
2238697:2238717	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP031811

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP031810

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection