CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP022780	Ralstonia solanacearum strain SL3822 chromosome, complete genome	1 crisprs	WYL,cas3,csa3,DEDDh,DinG	2	2	6	0
CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1 crisprs	WYL	0	1	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022780_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022780_2

3719953-3720265

Orphan

Consensus_repeat	Method
CGGNGGNGNCGGCAACGAC	CRT

5 spacers

The CRISPR arrays of CP022780_2

>merge|CP022780|2|3719953-3720265|CRT
CGGTGGTGACGGCAACGACACCCTAGTCGCCAATGGCGGTAACGACCAACTTTACGGCGGCGCCGGCAACGACTCCCTGCGCATCAACGACAACGCCACCGCCTCTGTCGACGGTGGCGACGGCAACGACACCATCTCCGCCGACAGCGGCACCACCTCCACCATCTCTGCCGGCAACGGCGATGACATCGTCCAAATCGGTGCCTGGTCCTTCCGGAGCACCATCGATGGCGGCGCCGGCAACGACATCATCAAGATCGACACCTACGGTGCCTCTCAAGGCGCCGACATCACCGGTGGCACTGGCGACGAC

>CP022780|2|1|3719953-3720265|CRT
CGGTGGTGACGGCAACGAC	ACCCTAGTCGCCAATGGCGGTAACGACCAACTTTA
CGGCGGCGCCGGCAACGAC	TCCCTGCGCATCAACGACAACGCCACCGCCTCTGTCGA
CGGTGGCGACGGCAACGAC	ACCATCTCCGCCGACAGCGGCACCACCTCCAC
CATCTCTGCCGGCAACGGC	GATGACATCGTCCAAATCGGTGCCTGGTCCTTCCGGAGCACCATCGA
TGGCGGCGCCGGCAACGAC	ATCATCAAGATCGACACCTACGGTGCCTCTCAAGGCGCCGACATCAC
CGGTGGCACTGGCGACGAC

Protein	Signature genes	Signature genes Name	Protein_function
CP022780.1\|AXW34891.1\|3729615_3730446_+\|methylenetetrahydrofolate-reductase-[NAD(P)H]	unknown	unknown	gnl\|CDD\|273212
CP022780.1\|AXW34879.1\|3709728_3710208_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319910
CP022780.1\|AXW34881.1\|3712709_3713570_+\|hypothetical-protein	unknown	unknown	unknown
CP022780.1\|AXW34888.1\|3726969_3727521_+\|hypothetical-protein	unknown	unknown	unknown
CP022780.1\|AXW34885.1\|3723300_3724704_-\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|224699
CP022780.1\|AXW34887.1\|3726541_3726973_+\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
CP022780.1\|AXW35216.1\|3697599_3702618_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
CP022780.1\|AXW34883.1\|3721523_3722429_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|223428
CP022780.1\|AXW34882.1\|3721126_3721489_-\|hypothetical-protein	unknown	unknown	unknown
CP022780.1\|AXW34890.1\|3729260_3729602_+\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|224861
CP022780.1\|AXW34876.1\|3707388_3707616_+\|thiamine-biosynthesis-protein-ThiS	unknown	unknown	gnl\|CDD\|180768
CP022780.1\|AXW34875.1\|3706252_3707392_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274092
CP022780.1\|AXW34880.1\|3710379_3711870_-\|hypothetical-protein	unknown	unknown	unknown
CP022780.1\|AXW34874.1\|3704343_3706239_+\|phosphomethylpyrimidine-synthase-ThiC	unknown	unknown	gnl\|CDD\|236451
CP022780.1\|AXW34873.1\|3702657_3703926_-\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|224981
CP022780.1\|AXW34884.1\|3722499_3723219_-\|hypothetical-protein	unknown	unknown	unknown
CP022780.1\|AXW34878.1\|3708449_3709601_+\|thiamine-phosphate-synthase	unknown	unknown	gnl\|CDD\|237041
CP022780.1\|AXW34889.1\|3727769_3729194_+\|adenosylhomocysteinase	unknown	unknown	gnl\|CDD\|377487
CP022780.1\|AXW34877.1\|3707625_3708453_+\|thiazole-synthase	unknown	unknown	gnl\|CDD\|234687
CP022780.1\|AXW34886.1\|3724723_3726175_-\|alkaline-phosphatase	unknown	unknown	gnl\|CDD\|224699

Protein	Function_ID	Function_description	E-value
CP022780.1\|AXW34891.1\|3729615_3730446_+\|methylenetetrahydrofolate-reductase-[NAD(P)H]	gnl\|CDD\|273212	TIGR00676, 510-methylenetetrahydrofolate_reductase., 5,10-methylenetetrahydrofolate reductase, prokaryotic form. The enzyme activities methylenetetrahydrofolate reductase (EC 1.5.1.20) and 5,10-methylenetetrahydrofolate reductase (FADH) (EC 1.7.99.5) differ in that 1.5.1.20 (assigned in many eukaryotes) is defined to use NADP+ as an acceptor, while 1.7.99.5 (assigned in many bacteria) is flexible with respect to the acceptor; both convert 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. From a larger set of proteins assigned as 1.5.1.20 and 1.7.99.5, this model describes the subset of proteins found in bacteria, and currently designated 1.7.99.5. This protein is an FAD-containing flavoprotein. [Amino acid biosynthesis, Aspartate family].	2.91618e-141
CP022780.1\|AXW34879.1\|3709728_3710208_+\|VOC-family-protein	gnl\|CDD\|319910	cd07246, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	9.16549e-51
CP022780.1\|AXW34885.1\|3723300_3724704_-\|alkaline-phosphatase	gnl\|CDD\|224699	COG1785, PhoA, Alkaline phosphatase [Inorganic ion transport and metabolism].	9.75583e-154
CP022780.1\|AXW34883.1\|3721523_3722429_-\|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase	gnl\|CDD\|223428	COG0351, ThiD, Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism].	2.95936e-115
CP022780.1\|AXW35216.1\|3697599_3702618_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	1.16146e-37
CP022780.1\|AXW34890.1\|3729260_3729602_+\|phage-holin-family-protein	gnl\|CDD\|224861	COG1950, COG1950, Predicted membrane protein [Function unknown].	7.22347e-22
CP022780.1\|AXW34876.1\|3707388_3707616_+\|thiamine-biosynthesis-protein-ThiS	gnl\|CDD\|180768	PRK06944, PRK06944, sulfur carrier protein ThiS; Provisional.	1.69525e-23
CP022780.1\|AXW34875.1\|3706252_3707392_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|274092	TIGR02352, Glycine_oxidase, glycine oxidase ThiO. This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as E. coli that instead use tyrosine and the ThiH protein. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine].	1.01234e-62
CP022780.1\|AXW34874.1\|3704343_3706239_+\|phosphomethylpyrimidine-synthase-ThiC	gnl\|CDD\|236451	PRK09284, PRK09284, thiamine biosynthesis protein ThiC; Provisional.	0
CP022780.1\|AXW34873.1\|3702657_3703926_-\|nitronate-monooxygenase	gnl\|CDD\|224981	COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only].	3.81357e-79
CP022780.1\|AXW34887.1\|3726541_3726973_+\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	8.37095e-26
CP022780.1\|AXW34877.1\|3707625_3708453_+\|thiazole-synthase	gnl\|CDD\|234687	PRK00208, thiG, thiazole synthase; Reviewed.	3.36068e-152
CP022780.1\|AXW34889.1\|3727769_3729194_+\|adenosylhomocysteinase	gnl\|CDD\|377487	pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase.	0
CP022780.1\|AXW34878.1\|3708449_3709601_+\|thiamine-phosphate-synthase	gnl\|CDD\|237041	PRK12290, thiE, thiamine phosphate synthase.	3.25628e-70
CP022780.1\|AXW34886.1\|3724723_3726175_-\|alkaline-phosphatase	gnl\|CDD\|224699	COG1785, PhoA, Alkaline phosphatase [Inorganic ion transport and metabolism].	4.23668e-154

>CP022780.1|AXW34881.1|3712709_3713570_+|hypothetical-protein
MKLKKKVVIPLFIVLLLATAWMALFKPRLLPKPIQRHLFADWMIQEERRTDPAVGHLGGIPVSIPRPYAHFLEYDGDPGFTEPRKGPRPERTFESGIRSFGFEVHYPDMEVASVANLDKRKQESIYTSTWLSVGISSNNDYPGQYYPEGQVLGMENRHYKYKRADRNEYGLETYVPINVDEEARRKGGGAADMFDYNVYYHKDESGHVDTYIRCINVAHEAAPCRQMFNLYPAMKAGITVGYRRGLLKDWREIQSSVSKIIFEFKTTKIQTQKIKKPCRKPSSVTI
>CP022780.1|AXW34880.1|3710379_3711870_-|hypothetical-protein
MWVPMLFGSCTIAIALSCMAESAPVKPNNVESLINRNKWKEASRAIFLEARSVDKFEWSIPAGQARAGFLEDALDTIADVAPNSQPGALLALVADVPSIPPEKKAELVKAALDMARKGSGKSSNYSRSGDLTGVALFYARTGAVPESRVVFEEALRCAESGIGEKGSGAYRRVTETMARESTGNQDWMIQLAMQHLQRAGKTADSAYSYLDLAQVAVRLQRKELASELVDLGISAAKAIDRALMRKSALEQLANVAMEAGYTKRLPEPSPSTLAVQEARSGHPEKALAIASGLSETLYVDSGLEAYRRVFDDAVKREDLETARYFAEHPIKKLASMKIVVWRRVAELQVKKGLQKDAANSYRRATATILDDLGTTRYVTEVEAIAALGESMRQNGFDAEGRKAILEAVSMIDQIPERQADGRIQAGILLSKTLWRSGMHADAKQQILRAYRAANTYSDKVGIRKGDLLSAIGQTTSIFISEVSANEPTKTPRKSRL
>CP022780.1|AXW34879.1|3709728_3710208_+|VOC-family-protein
MAVKPIPEGYHSVTPYLSIKGADKALDFYKQAFGATEIMRMAGPNGAIAHAEIRIGDSPVMMADEMPNMSCASPDTLQSTSVGLMIYVKDVDAVFANAIKTGATEVRPVQNQFYGDRSGTLKDPFGHVWTISTHVEDVAPDEMKRRMDKWTQEQAGATA
>CP022780.1|AXW34878.1|3708449_3709601_+|thiamine-phosphate-synthase
MSASALRFASAWPDAAALADRLIDRHADAFGRAPHAWSVTDRADDAATAAVLLTTDAAQADRAHAAGAAVVLSEARNGERIDTVHDRLGTYRFAAPATGAVFGERFVAMFGAALALAFEPRDALCVARAWIAEAAADALAWPARFDALPRVLEPALPCAASPDLAFAPCPPRLGVYAVVPDAEWVERLVALKVPTVQLRVKSDDARAVAGQVRRAAAAARGSQTRLFINDHWRVALDVHAQTPDSGLYGIHLGQEDIDDADLAAIRASGLRLGISTHGYAEMLRVAALNPSYLALGAVFATPTKTMPTVPQGLGRLFAHAAAMRSRVPAPPLVAIGGIDLAAMPRVLESGVGGVAVVRAITQAEDVPAAVQALQATFAAHARA
>CP022780.1|AXW34877.1|3707625_3708453_+|thiazole-synthase
MTTTNLSALADPLRLYDEVFGSRLLLGTARYPSPQSLEDAVRACGPAMLTVALRRQSAGTPEGGAGFWKMLRALGVPVLPNTAGCYSADEAYTLAQMSREVFETDWIKLEVIGDDYTLQPDTLALPAAAERLIRDGFKVLPYCTEDLVLCRRLLDVGCRALMPWAAPIGTGRGPTNPYGLRLLRERLPDVPLIVDAGLGVPSHATQVMEWGYDGVLLNTAVAQAGDPVAMARAFAMATQAGRLARLSGPMPERDVAQASTPVVGLPFWHADKNSA
>CP022780.1|AXW34876.1|3707388_3707616_+|thiamine-biosynthesis-protein-ThiS
MTLNVTLNDLSLALPAGSTLADAIAFVTTTAAPQLQIAPPFAASVNGDFVPKARHAQHALRSGDRIALVQPVVGG
>CP022780.1|AXW34875.1|3706252_3707392_+|FAD-dependent-oxidoreductase
MPTPFDVTILGGGLAGRLCAWQLAQTGVPPARIAVVERGARDGSGSAAYVAAAMLAPLAEAAVADRFVVELGLASLTLWRDWLPMLRTPVFFQQAGTLVVWHPADRGEASLFANHVRAATPLERIAADLRAVDAEGIGTLEPALAQRFSQGLYLAGEGQLDNRAVLDALATELEALGVQLRWNTAVADPHPQALAAAGLGARLVLDCRGLGAKPQWPQLRGLRGEVARIHAPDVTLTRPVRMLHPRYPIYIAPKPGHVYVIGATEIESDDMSPVSVRSTLELLSAAYAVHPAFGEARVLELCTQCRPTLPDHRPAIRWDGAGTLSVNGLYRHGYMIAPAVAQAAVAAAHALLDGRAIDAPASAWPGLFAAPASPEPVLP
>CP022780.1|AXW34874.1|3704343_3706239_+|phosphomethylpyrimidine-synthase-ThiC
MPQAKNAPAASFDSLQTELDQKFAYPASSKTYIAGSRPDLRVPMRTIKQTATRTDQGEMLNPPIPVYDTSGPYSDPDVHIDLKAGLAPLRAKWIDERGDTVVLPGLSSEYGQARAHDPATAHLRFAQLTNPRRAKPGANVSQMHYARRGIITPEMEYVALRESLNLQALQDKPEYRKLLKQHPGFSYGANLPQRPEDITPEFVRQEIAAGRAIIPANINHVELEPMAIGRNFRVKINGNLGNSAVTSSLAEEVEKMVWSIRWGADTIMDLSTGKHIHETREWILRNSPVPVGTVPIYQALDKTGGVAEDLTWEMFRDTLIEQAEQGVDYFTIHAGVLLRYVPLTADRITGIVSRGGSIMAKWCLAHHKENFLYTHFDEICEIMKAYDVSFSLGDGLRPGCIADSNDAAQFGELYTLGELTKKAWEHDVQVMIEGPGHVPLQRVQANMDEELKHCFEAPFYTLGPLVTDIAPGYDHITSGIGAANIGWYGTAMLCYVTPKEHLGLPDKEDVREGIITYKIAAHAADLAKGWPGAQLRDNALSKARFEFRWEDQFNLGLDPEKARAFHDETLPAEGAKIAHFCSMCGPKFCSMKITQEVRDYAASLDANATAAEHGMEEKSIEFRKAGAKIYS
>CP022780.1|AXW34873.1|3702657_3703926_-|nitronate-monooxygenase
MLNRRFTLAGRSLVPIVQGGMGVGISAHRLAGAVAREGGVGTIASIDLRHHHADLAAATEKSHDKAAINAANLVALDREIRAAREGSQGNGLIAVNVMKAVESHAALVRQACESGADAIVMGAGLPLDLPEMTAEHPKVALIPILSDARGVGVVLKRWMKKARLPDAVVIEHPAHAGGHLGAARIEDLSDERFSFSRVLDECRELFVKLGLATEQIPLILAGGIDSHAKVRHWLDKGAAAVQLGTAFAVTEEGDAHPRFKRVLTGAEDGDITEFISVAGLPARAVMTPWLSRYLSRETALQAKAKVRDCLQGFDCLQTCGLRDGLGKVGQFCIDLKLAQALRGDVERGLFFRGAGKLPFGQAIRPVRELMHYLLTGEKTFAESQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQSQEPAVAG
>CP022780.1|AXW35216.1|3697599_3702618_+|autotransporter-outer-membrane-beta-barrel-domain-containing-protein
MRKLIQTILLGWRLLAGLPVLGHLMARPCARTRQGVLAMLALGACQMMLSSPAWAAACTVSFSTTANTQKSYVFTSGNTSSCDPFLIGIAYDSAGDANSSTGPVFNTATSQGGTIAIYNGSVPPSGDPNTNGFVYTPPTNFSGTDTATFYTSNDGVTWLPNGTVSITVTSTAPTVTGISPSSGGTGGGTSVAVTGTGFTGATAVKFGSTNAGSFTVNSATSITATSPAGSAGTVDLTVTTSGGTSATSSADQFTYAAPPTANASSATVAHGSSSNAITLSISGGTPTSVAVSTAASHGTATASGTSITYTPTASYSGTDTFAYTASNAGGTSAAATVTITVSSATVSYAPASPAGGTVGTAYSQSVASASGGTSPYTYALASGSLPPGLTLSTGGTLSGTPTSAGTFSFTVTATDSSTGTGPFSATSGTLSLTIAAPTITVSPSTLTSPTVGAASSQSVSASGGTSPYTYAVTAGALPAGMSLSSAGTLSGTPTAGGAFSFTATATDSTGGTGPYTGSRSYTLTVNAPTLSITPAAGSLSATSGVAYSQAFVAASGTAPYTYALSVNSGALPTGLSFNTATGVLSGTPTTAGTANFTVTGTDSSTGTGPYTVSATYTLTTSAPTISLAPATLTGATVGTAYSQSVTASGGATPYTYAITSGALPAGLSLNTGTGALTGTPTAAGTFSFTMRGTDANAFSGTRSYSLTVAAPTIALTPTTLAGATVSSAYSQSVAASGGTAPYTYAVTSGALPAGLSLSSAGVLSGTPTAGGSFSVTISATDSTTGSGPFTGSRAYTLTVGSPTLTISPASTAGLTAMAGTSYSQSFSAGGGVSPYTYALTVNTGTMPAGLSFHAASATLSGTPTTAGTVSFTVTATDGSSGAGPYAVSGTYTLTVSAPTLTVAPATLPNPAIGTAYSQSITASSGTAPYTYAVTSGALPAGLSLSSAGVLSGTPTAGGSFGFTVTATDANSFTASRAYSITIGAATVALNPATVPGATLNTAYSQTFTASGGIGPYTYAVASGTLPAGVSLNSTTGVLSGTPTALGSSTFSIRATDSSTGAGAPYTGTRGYTLVVGQAIGTAPPVTATTTSTAPVTLHPTANATGGPFSSVVIVAAPASGTAVVNGMDIVYTPTPTTSGNVAFTFALVNTAGTSAPIQATVTVNAVPIAVAQKTASTAAGQAVNVDLTDGATGGPFTGAAIVSVVPANAGTATIMQQTSQTTAGVKALAAAAPVYLLSFTPASAFSGTATLTYTLSNAVSTSTPAVVQVSVAPRRDPSTDPDVNGLINAQIQAARRFATTQIANYHQRLEALHGTGRAPSGNGLTVALPGPRGDAQARCQDVFGIAARDACLRGDSTAGKPAFARGKRNADLQASRGDADAGPDLPGADATADAGQPDLAFWTAGTLDFGFANTSAQRSGFRFTTGGITAGADYRVSDRLSVGAGFGYGRDSTDIGNAGTKSTGDSYSVALYGSYRPLPTLFVDGVAGFGTLSFDSRRWVSDANDYAMGSRNGHQVFASVSAGYEHRDSVWLFSPYGRLSVSESTLDPFSETSAGLNALTYFQQTVTTVSGTLGLRTEYTQKTRWGTFLPYARVEYQHDFNGQSNAGLAYADLASAGPAYYVMGSPYGRDRMQVGLGTKFRTGPLTFGLDYSVMVGMGGLQQGVRLTFAAPF
>CP022780.1|AXW34882.1|3721126_3721489_-|hypothetical-protein
MTSARITLSRCLAGTALCLLAGACDVGFVAVIGSTLSIGGTVTGLPANQSLVLLDNGRDALTITANGPFVFAATVPFNGGYAVMIGTQPSSASCAVSNGSGIATADVTSVVVTCQPVGSA
>CP022780.1|AXW34883.1|3721523_3722429_-|bifunctional-hydroxymethylpyrimidine-kinase/phosphomethylpyrimidine-kinase
MTITDPTLAIVAPASHVPRVLTIAGSDSGGGAGIQADLKTFAALGCYGMSAITAVTAQNTLGVAAVESLTPDIVGAQIDAVAQDIGVDAAKTGMLGSPAVVEAIVSALARHPIAALVVDPVMVSTSGAQLGSDATAQAMAKWLFPRALLITPNLPEASALLGRAVRTADDMLPAARDLLTLGSRAVLLKGGHLADVAIPGEDGVLQDVLVTADGIERIYTHTQIDTPHTHGTGCTLSAAIAAHLARGEPLEAAVELSLDYLLHAIGAGRHLALGRGAGPLNHGFAPRPLAAPRAVDVGDAD
>CP022780.1|AXW34884.1|3722499_3723219_-|hypothetical-protein
MHPIRLTILPLLLAASLAHAADKAPAAPAVPAAPVTAPMTVLRVEHHLAALGADGVQRDVRFAERVYRQGGRVWIARELPAAALHADPDHDSPHAGHKHVETDTVPRWIERGADGALTVRVVSEAQQKAYRVEPAEYGNIGFDGAWATAYHLLDPASLKAMRTEGPVHSGVQTYRARQGERTVTVDWDVAGQYPRRVESRNADGTQRKLTRVSVLPAPAVAPWTRAQRYPSADYTDLMD
>CP022780.1|AXW34885.1|3723300_3724704_-|alkaline-phosphatase
MTKQSNRILRAGALALAAAAALPVLPARAAGEARNVIFFLGDGMGPTTVTAARIYKAGEAGQLTMESLKRTARIKTYSNDAQTTDSAPSMSAYMTGVKMNNEVISMSADTKASDSAGKGYVSGADTTCPAGNGTPATTLLELAKAAGKSVGAVTTTRVTHATPAATYSHLCHRDGENQIAAQGTPGNALYNAALKDGLDVLLGGGRRHFLPQGTTGSKRTDTTDLIAQFQAASYTYVSTGTQLAAVDPAATTRLLGLFNLDHMNYELDRVNKRVDEPSLADMTEKAIRILQKNGNGYFLMVEGGRIDHALHGTNAKRALEDTVAFDEAIKRALSLVDRGNTLIVVTADHDHTMTINGYAHRGNPILGLSTDLKTRQPQLAADGLPYTTLVFGNGGNTRKATRDNLAAVDTTADDYLQDVGVQLGNPGSETHGGGDVMLFSSGPGSAPLKGTLDNTRVFGAVRSAMGL
>CP022780.1|AXW34886.1|3724723_3726175_-|alkaline-phosphatase
MHRLSLLSVAALAALALVACGSDGTSTGVATPDAGAITTGPTRNVVFFLGDGMGLATMTAARIYKVGEDGELTMDTLPETGFVRTFSNNAQVTDSAPSMSAYMTGVKMNNEVISMSSDTAAFDAGGKDYVSGADSTCPAGGNGKPVTTLLELMKAAGYGTGVVTTTRVTHATPAATYAHLCHRDGENTIAAQLVPAGAGYNAALGDGVDVVFGGGRKHFQPSAAGGARTDGRDLVAELKAAGYRYAGNKAEFDTLSAGDSKVVGLFTSSHMAYDLDRDAAKEPSLVEMTTKAIDVLAAKKKGFFLMVEGGRIDHALHETTARKALQDTVAFDAAIRGALDKLSTIDPGLKNTLVVVTADHDHTLVLNGYAKRTGPTSDSNPGVLGLLKSYVNGATATDVGGNPYTILGFGTGENRPAARTALTDAAVYDKAYHQEAVIPTSAGGETHGGTDVFVGARGLGAERFTGVMDNTEVFGLIKQAVGL
>CP022780.1|AXW34887.1|3726541_3726973_+|L,D-transpeptidase
MPTPTKKPSTKSRPKAPRTLKTIKVNLTSQIVEAFDSNNRVFRFECVSGDRDHPTDRGIFRVLWKAESHRSRAYDVQMDYALFFTNDGKALHQYHGVAPLALIRAARGNISEWFGSHGCVRLAEADAKALFAWASIGTIVQVS
>CP022780.1|AXW34888.1|3726969_3727521_+|hypothetical-protein
MITAMKRFLMIGVALLVGCLIGAGVAHWAFSAAHPTSHVIDPGTDALSILDEEIMSITYATHRLTVTAQRTKPADRFAVQVTFSDGSPARQCIASPMLNGLLPGMATLTAKRQIPLDQVAVAFPKPLGRLEFRNRETVELISPVEFRTTAANSAVLAVFSGMAFEVAAPIDFQKLEALCAQRH
>CP022780.1|AXW34889.1|3727769_3729194_+|adenosylhomocysteinase
MNAVTDLKHDYLVADIKLADWGRKEIAIAETEMPGLMAIRDEFAASQPLKGARIAGSLHMTIQTAVLIETLKALGADVRWASCNIFSTQDHAAAAIAASGTPVFAFKGESLKEYWDFTHRIFEWADGGTPNMILDDGGDATLLLHLGAKAEQDASVIAKPGSEEETFLFAAIKEKLAKDATFYSRNLDAIKGVTEETTTGVHRLYQMAQRGELRFPAINVNDSVTKSKFDNLYGCRESLVDGIKRATDVMIAGKVAVVAGYGDVGKGSAQALRALSAQVWVTEIDPICALQAAMEGYRVVTMDYAAEHGDIFVTCTGNYHVITHDHMAKMKDQAIVCNIGHFDNEIDIASVEQYQWEEIKPQVDHVIFPDGKKIIILAKGRLVNLGCATGHPSYVMSSSFANQTIAQIELWTEAQKGSSKYPVGVYTLPKHLDEKVARLQLKKLNAQLTVLTDKQAAYIGVSKEGPYKADHYRY
>CP022780.1|AXW34890.1|3729260_3729602_+|phage-holin-family-protein
MRLLAVWVINALALLLVAYLLNGIHVNGFTSALIAALVLGLVNTLIRPILVILTLPVTVLTLGLFIFVINALLFMFVGNVLAGFHVASFGAALLGSVLYSVISWLLSSLLLRD
>CP022780.1|AXW34891.1|3729615_3730446_+|methylenetetrahydrofolate-reductase-[NAD(P)H]
MQDRQFSFEFFPPKTAEGAEKLRNTRAQLSPLKPRFISVTFGAGGTTQQGTLDAVVEIQREGIEAAPHLSCVGSSRESIRAILDTYREHGIRRIVALRGDMPSGMGEIGEFRFANELVEFIRKEMNDTFHIEVAAYPEYHPQARSSRQDLENFARKVKAGANSAITQYFFNADAYFQFVDDARKLGVDVPIVPGIMPITNSSQLMRFSEMCGAEIPRWIAKRLESFGDDRESIRAFGLDVVTALCDRLLAGGAPGLHFYTLNAAAATRAIWQRLGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP022780_2	2.1\|3719972\|35\|CP022780\|CRT	3719972-3720006	35	CP022780.1	3716618-3716652	2	0.943
CP022780_2	2.1\|3719972\|35\|CP022780\|CRT	3719972-3720006	35	CP022780.1	3717290-3717324	2	0.943
CP022780_2	2.2\|3720026\|38\|CP022780\|CRT	3720026-3720063	38	CP022780.1	3716672-3716709	2	0.947
CP022780_2	2.2\|3720026\|38\|CP022780\|CRT	3720026-3720063	38	CP022780.1	3717344-3717381	2	0.947
CP022780_2	2.2\|3720026\|38\|CP022780\|CRT	3720026-3720063	38	CP022780.1	3718016-3718053	2	0.947
CP022780_2	2.2\|3720026\|38\|CP022780\|CRT	3720026-3720063	38	CP022780.1	3718685-3718722	2	0.947
CP022780_2	2.2\|3720026\|38\|CP022780\|CRT	3720026-3720063	38	CP022780.1	3719354-3719391	2	0.947

1. spacer 2.1|3719972|35|CP022780|CRT matches to position: 3716618-3716652, mismatch: 2, identity: 0.943

accctagtcgccaatggcggtaacgaccaacttta	CRISPR spacer
accctagtcgctaatggcggtaacgaccagcttta	Protospacer
***********.*****************.*****

2. spacer 2.1|3719972|35|CP022780|CRT matches to position: 3717290-3717324, mismatch: 2, identity: 0.943

accctagtcgccaatggcggtaacgaccaacttta	CRISPR spacer
accctagtcgctaatggcggtaacgaccagcttta	Protospacer
***********.*****************.*****

3. spacer 2.2|3720026|38|CP022780|CRT matches to position: 3716672-3716709, mismatch: 2, identity: 0.947

tccctgcgcatcaacgacaacgccaccgcctctgtcga	CRISPR spacer
tccctgcgtgtcaacgacaacgccaccgcctctgtcga	Protospacer
********..****************************

4. spacer 2.2|3720026|38|CP022780|CRT matches to position: 3717344-3717381, mismatch: 2, identity: 0.947

tccctgcgcatcaacgacaacgccaccgcctctgtcga	CRISPR spacer
tccctgcgtgtcaacgacaacgccaccgcctctgtcga	Protospacer
********..****************************

5. spacer 2.2|3720026|38|CP022780|CRT matches to position: 3718016-3718053, mismatch: 2, identity: 0.947

tccctgcgcatcaacgacaacgccaccgcctctgtcga	CRISPR spacer
tccctgcgcatcaacaacaacgccaccgcctctgccga	Protospacer
***************.******************.***

6. spacer 2.2|3720026|38|CP022780|CRT matches to position: 3718685-3718722, mismatch: 2, identity: 0.947

tccctgcgcatcaacgacaacgccaccgcctctgtcga	CRISPR spacer
tccctgcgcatcaacaacaacgccaccgcctctgccga	Protospacer
***************.******************.***

7. spacer 2.2|3720026|38|CP022780|CRT matches to position: 3719354-3719391, mismatch: 2, identity: 0.947

tccctgcgcatcaacgacaacgccaccgcctctgtcga	CRISPR spacer
tccctgcgcatcaacaacaacgccaccgcctctgccga	Protospacer
***************.******************.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022780_1	1.1\|2258546\|57\|CP022780\|CRISPRCasFinder	2258546-2258602	57	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1200220-1200276	0	1.0
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	171477-171508	5	0.844
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	2016115-2016146	7	0.781
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	294232-294263	7	0.781
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	AP021850	Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome	347010-347041	7	0.781
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	628735-628766	7	0.781
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NC_007959	Nitrobacter hamburgensis X14 plasmid 1, complete sequence	263925-263956	7	0.781
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NC_007959	Nitrobacter hamburgensis X14 plasmid 1, complete sequence	270844-270875	7	0.781
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	382989-383020	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	118315-118346	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	JX042579	Mycobacterium virus MacnCheese, complete genome	1170-1201	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP014073	Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence	120464-120495	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP029448	Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence	186257-186288	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP031811	Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence	158787-158818	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	MN310379	Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence	179268-179299	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	MN310380	Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence	152399-152430	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP009275	Klebsiella variicola strain DX120E plasmid pKV1, complete sequence	64724-64755	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP029598	Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence	149614-149645	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP038276	Raoultella ornithinolytica strain WLK218 plasmid pWLK-107717, complete sequence	25590-25621	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	638322-638353	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP011641	Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence	128680-128711	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP024510	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed4, complete sequence	48060-48091	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP014697	Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence	40793-40824	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP018361	Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence	255316-255347	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP013986	Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence	14472-14503	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP035211	Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence	124635-124666	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP024543	Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence	58171-58202	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP045691	Klebsiella pneumoniae strain TK421 plasmid pTK421_1, complete sequence	68892-68923	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_LT882698	Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence	259691-259722	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP032357	Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence	170248-170279	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_MG462728	Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence	179386-179417	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP054255	Klebsiella variicola strain FH-1 plasmid unnamed, complete sequence	95222-95253	8	0.75
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	MK524488	Mycobacterium phage Patt, complete genome	25089-25120	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP049029	Fluviibacterium aquatile strain SC52 plasmid pSC52_1, complete sequence	340918-340949	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	528488-528519	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	518076-518107	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NC_012523	Rhodococcus opacus B4 plasmid pKNR, complete sequence	24899-24930	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	4233193-4233224	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	483407-483438	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP024936	Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence	419996-420027	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	528525-528556	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	528525-528556	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	528517-528548	9	0.719
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	419523-419554	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	705655-705686	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1234106-1234137	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	898267-898298	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	KY783914	Mycobacterium phage GardenSalsa, complete genome	17575-17606	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	MT658802	Mycobacterium phage Aziz, complete genome	17602-17633	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	MF319184	Mycobacterium phage GenevaB15, complete genome	17602-17633	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	KY223999	Mycobacterium phage MrMagoo, complete genome	17575-17606	10	0.688
CP022780_2	2.3\|3720083\|32\|CP022780\|CRT	3720083-3720114	32	NC_015724	Cupriavidus necator N-1 plasmid pBB2, complete sequence	277342-277373	10	0.688

1. spacer 1.1|2258546|57|CP022780|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 0, identity: 1.0

tgggaagcgctgttggcggcgcgcccggacggggcgccctgctccggcagcggaggc	CRISPR spacer
tgggaagcgctgttggcggcgcgcccggacggggcgccctgctccggcagcggaggc	Protospacer
*********************************************************

2. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

accatctccgccgacagcggcaccacctccac	CRISPR spacer
accatctccgccgaccgcggcagcaccagcgc	Protospacer
*************** ****** ****  *.*

3. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acgatcgccgccgacagcggcaccatccgctt	Protospacer
** *** ******************.*. * .

4. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
accatctccgcggaccgcggcaccgcaagcgc	Protospacer
*********** *** ********.*   *.*

5. spacer 2.3|3720083|32|CP022780|CRT matches to AP021850 (Deinococcus grandis ATCC 43672 plasmid: pDEGR-1 DNA, complete genome) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agccttctcgccgcctgcggcaccacctccac	Protospacer
* * *...***** * ****************

6. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacc-tccac	CRISPR spacer
cgcgtctccgccgacacccgcaccaccgtgca-	Protospacer
  *.************ * ******** * **

7. spacer 2.3|3720083|32|CP022780|CRT matches to NC_007959 (Nitrobacter hamburgensis X14 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agcagcagcgccgccagcggcaccaccgccat	Protospacer
* ** *  ***** ************* ***.

8. spacer 2.3|3720083|32|CP022780|CRT matches to NC_007959 (Nitrobacter hamburgensis X14 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.781

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agcagcagcgccgccagcggcaccaccgccat	Protospacer
* ** *  ***** ************* ***.

9. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcggcgccgccgacagcggcatcacctccga	Protospacer
. *. * ***************.*******.

10. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
agcatctccgccaacggcggcaccaccaatgg	Protospacer
* **********.**.***********  ..

11. spacer 2.3|3720083|32|CP022780|CRT matches to JX042579 (Mycobacterium virus MacnCheese, complete genome) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcggcgcccgccgacggcggcaccccctccac	Protospacer
.* .. .********.******** *******

12. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP014073 (Klebsiella quasipneumoniae strain FDAARGOS_93 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

13. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP029448 (Serratia marcescens strain CAV1761 plasmid pCAV1761-205, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

14. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP031811 (Klebsiella pneumoniae strain INF014-sc-2279884 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

15. spacer 2.3|3720083|32|CP022780|CRT matches to MN310379 (Klebsiella quasipneumoniae strain A2508 plasmid pA2508-NR, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

16. spacer 2.3|3720083|32|CP022780|CRT matches to MN310380 (Raoultella ornithinolytica strain 170602815 plasmid p602815-NR, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

17. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP009275 (Klebsiella variicola strain DX120E plasmid pKV1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

18. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP029598 (Klebsiella quasipneumoniae subsp. similipneumoniae strain ATCC 700603 plasmid pDA33145-152, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

19. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP038276 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-107717, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

20. spacer 2.3|3720083|32|CP022780|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgatctccgccgacttcggcaccaccgtgtc	Protospacer
.* ************  ********** .  *

21. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP011641 (Serratia marcescens strain CAV1492 plasmid pCAV1492-199, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

22. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP024510 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

23. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP014697 (Klebsiella quasipneumoniae strain ATCC 700603 isolate K6 plasmid pKQPS1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

24. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP018361 (Klebsiella oxytoca strain CAV1752 plasmid pCAV1752-278, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

25. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP013986 (Klebsiella variicola strain LMG 23571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

26. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP035211 (Klebsiella pneumoniae strain TH164 plasmid pTH164-2, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

27. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP024543 (Klebsiella pneumoniae strain INF042 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

28. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP045691 (Klebsiella pneumoniae strain TK421 plasmid pTK421_1, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

29. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_LT882698 (Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

30. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP032357 (Klebsiella variicola strain 15WZ-82 plasmid p15WZ-82_res, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

31. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_MG462728 (Escherichia coli strain AMA1416 plasmid pAMA1416, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

32. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP054255 (Klebsiella variicola strain FH-1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ttgaccagcgccgacagcggcaccatctcaac	Protospacer
 . *.*  *****************.*** **

33. spacer 2.3|3720083|32|CP022780|CRT matches to MK524488 (Mycobacterium phage Patt, complete genome) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcatctccgccgccggcggcaccacaggcgg	Protospacer
. *********** *.**********   *.

34. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP049029 (Fluviibacterium aquatile strain SC52 plasmid pSC52_1, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
aatctcgccgccgacagcggccccaccagcgt	Protospacer
* . ** ************** *****  *..

35. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

36. spacer 2.3|3720083|32|CP022780|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

37. spacer 2.3|3720083|32|CP022780|CRT matches to NC_012523 (Rhodococcus opacus B4 plasmid pKNR, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gagaccgccgccgacggcgccaccacctcccg	Protospacer
.  *.* ********.*** **********

38. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
cccgcctccgccgacagcgtgaccaccttgtg	Protospacer
 **..**************  *******.

39. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

40. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP024936 (Paraburkholderia graminis strain PHS1 plasmid pPHS1_P, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acgatctccgccgacaccggcacgtcgagatc	Protospacer
** ************* ******  *     *

41. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

42. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

43. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gcgttgcgcgccgacagcggcaccagcaccat	Protospacer
.*  * . ***************** * ***.

44. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

45. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

46. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

47. spacer 2.3|3720083|32|CP022780|CRT matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
acctgctccgccgacagcggcacgcgggcgga	Protospacer
***  ******************     * .

48. spacer 2.3|3720083|32|CP022780|CRT matches to KY783914 (Mycobacterium phage GardenSalsa, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

49. spacer 2.3|3720083|32|CP022780|CRT matches to MT658802 (Mycobacterium phage Aziz, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gacatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

50. spacer 2.3|3720083|32|CP022780|CRT matches to MF319184 (Mycobacterium phage GenevaB15, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gacatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

51. spacer 2.3|3720083|32|CP022780|CRT matches to KY223999 (Mycobacterium phage MrMagoo, complete genome) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
ggcatcgccgccgacagcgccaccactagtca	Protospacer
. **** ************ ******.  .

52. spacer 2.3|3720083|32|CP022780|CRT matches to NC_015724 (Cupriavidus necator N-1 plasmid pBB2, complete sequence) position: , mismatch: 10, identity: 0.688

accatctccgccgacagcggcaccacctccac	CRISPR spacer
gtgttctccggcgccagcggcaccaccgagcc	Protospacer
..  ****** ** *************    *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

213992 : 227787

Acidithiobacillus_phage(75.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW34987.1\|213992_214976_-	ATP-binding protein	R4TQL5	Phaeocystis_globosa_virus	5.1e-15	27.7
AXW32032.1\|215732_217970_-	hypothetical protein	K4I1D0	Acidithiobacillus_phage	1.1e-291	66.5
AXW32033.1\|218019_218481_-	excisionase	K4ICM4	Acidithiobacillus_phage	3.4e-46	63.4
AXW32034.1\|218708_218972_+	DNA-binding protein	K4I3X3	Acidithiobacillus_phage	5.3e-20	69.3
AXW32035.1\|218982_219465_+	hypothetical protein	K4HZ96	Acidithiobacillus_phage	3.4e-44	58.2
AXW32036.1\|219772_220225_+	HNH endonuclease	A0A1B0TRC1	Escherichia_phage	3.4e-22	39.3
AXW32037.1\|220211_220970_+	hypothetical protein	K4HZA0	Acidithiobacillus_phage	2.9e-82	61.7
AXW32038.1\|220966_221227_+	hypothetical protein	K4I1D6	Acidithiobacillus_phage	8.4e-18	76.8
AXW32039.1\|221223_223512_+	hypothetical protein	K4HZY1	Acidithiobacillus_phage	1.4e-286	63.5
AXW32040.1\|223642_224107_+	hypothetical protein	K4ICN3	Acidithiobacillus_phage	1.0e-53	67.6
AXW32041.1\|224108_224318_+	hypothetical protein	NA	NA	NA	NA
AXW32042.1\|224310_224694_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AXW32043.1\|224748_225015_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
AXW32044.1\|225014_225314_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AXW32045.1\|225267_225483_+	hypothetical protein	NA	NA	NA	NA
AXW32046.1\|225416_225713_-	hypothetical protein	NA	NA	NA	NA
AXW34988.1\|225847_226393_+	hypothetical protein	A0A2H4P763	Pseudomonas_phage	2.0e-24	39.6
AXW32047.1\|226374_227787_+	DNA modification methylase	K4I3Y2	Acidithiobacillus_phage	1.3e-152	59.3

DBSCAN-SWA_2

232251 : 280103

uncultured_Caudovirales_phage(20.0%)

head,transposase,terminase,capsid,portal,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW32051.1\|232251_232728_-	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	5.5e-23	60.0
AXW32052.1\|233544_233766_-	hypothetical protein	NA	NA	NA	NA
AXW32053.1\|233863_234400_+	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	1.5e-72	82.6
AXW34989.1\|234402_236370_+\|terminase	terminase	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	85.8
AXW32054.1\|236413_236923_+	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	2.8e-25	44.4
AXW32055.1\|236933_237326_+	hypothetical protein	NA	NA	NA	NA
AXW32056.1\|237326_237548_+	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	5.9e-12	58.9
AXW32057.1\|237547_239095_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	7.3e-149	57.1
AXW32058.1\|239104_240355_+\|protease	Clp protease ClpP	K4HZZ6	Acidithiobacillus_phage	2.4e-62	45.0
AXW32059.1\|240364_240742_+\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	6.1e-25	49.6
AXW32060.1\|240750_241755_+\|capsid	major capsid protein	A0A1B2LRS0	Wolbachia_phage	9.6e-110	66.6
AXW32061.1\|241757_242060_+	hypothetical protein	NA	NA	NA	NA
AXW32062.1\|242065_242512_+	hypothetical protein	NA	NA	NA	NA
AXW32063.1\|242612_243386_+	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	3.1e-47	43.6
AXW32064.1\|243394_243790_+	hypothetical protein	NA	NA	NA	NA
AXW34990.1\|243786_244008_+	hypothetical protein	NA	NA	NA	NA
AXW32065.1\|243982_244627_+	hypothetical protein	NA	NA	NA	NA
AXW32066.1\|244669_244960_-	DNA-binding protein	NA	NA	NA	NA
AXW32067.1\|245145_246612_-	YOPP/AvrRxv family protein	NA	NA	NA	NA
AXW34991.1\|247221_248349_+	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	1.1e-98	53.5
AXW32068.1\|248414_252518_+	hypothetical protein	A0A0P0ZCJ4	Stx2-converting_phage	6.0e-25	27.8
AXW32069.1\|252523_252919_+	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.6e-31	52.3
AXW32070.1\|252919_256510_+	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.7
AXW32071.1\|256532_257699_+	hypothetical protein	NA	NA	NA	NA
AXW32072.1\|257702_258185_+	hypothetical protein	A0A0M4TU90	Ralstonia_phage	3.1e-13	44.0
AXW32073.1\|258181_258580_+	hypothetical protein	NA	NA	NA	NA
AXW32074.1\|258584_260429_+	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	2.4e-106	46.1
AXW32075.1\|260438_260663_+	hypothetical protein	NA	NA	NA	NA
AXW32076.1\|260730_261021_+	hypothetical protein	K4I011	Acidithiobacillus_phage	4.1e-13	46.4
AXW32077.1\|261017_261494_+	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	85.9
AXW32078.1\|261490_261952_+	glycoside hydrolase	K4I410	Acidithiobacillus_phage	2.3e-66	81.6
AXW32079.1\|262019_262319_+	hypothetical protein	NA	NA	NA	NA
AXW32080.1\|262381_262720_-	DUF1484 domain-containing protein	NA	NA	NA	NA
AXW32081.1\|272702_272891_+	hypothetical protein	NA	NA	NA	NA
AXW32082.1\|273435_273678_+	hypothetical protein	NA	NA	NA	NA
AXW32083.1\|273652_276193_+	hemagglutinin	A0A0R6PJK4	Moraxella_phage	7.5e-18	31.2
AXW32084.1\|276204_277956_+	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
AXW32085.1\|277968_278814_+	hypothetical protein	NA	NA	NA	NA
AXW34992.1\|279314_280103_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_3

854416 : 919687

Lake_Baikal_phage(25.0%)

transposase,protease,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW32551.1\|854416_855382_-\|transposase	IS5/IS1182 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
AXW32552.1\|855753_863229_+	hypothetical protein	NA	NA	NA	NA
AXW32553.1\|863878_864196_-	hypothetical protein	NA	NA	NA	NA
AXW32554.1\|864677_864890_-	hypothetical protein	NA	NA	NA	NA
AXW32555.1\|864988_865243_-	translation initiation factor 1	NA	NA	NA	NA
AXW32556.1\|865325_865556_-	isochorismatase	NA	NA	NA	NA
AXW32557.1\|866011_866176_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	3.2e-07	57.1
AXW32558.1\|866224_867553_-\|transposase	DDE transposase	NA	NA	NA	NA
AXW32559.1\|868064_868391_+	hypothetical protein	NA	NA	NA	NA
AXW35031.1\|868484_868769_+	hypothetical protein	NA	NA	NA	NA
AXW35032.1\|868855_869230_+	hypothetical protein	NA	NA	NA	NA
AXW32560.1\|870107_870425_+	hypothetical protein	NA	NA	NA	NA
AXW35033.1\|870577_870874_+	hypothetical protein	NA	NA	NA	NA
AXW32561.1\|870970_871831_+	transglutaminase family protein	NA	NA	NA	NA
AXW32562.1\|871847_872108_-	hypothetical protein	NA	NA	NA	NA
AXW32563.1\|873453_873957_+\|coat	spore coat protein	NA	NA	NA	NA
AXW32564.1\|874006_874510_+\|coat	spore coat protein	NA	NA	NA	NA
AXW32565.1\|874628_875348_+	phytochrome sensor protein	NA	NA	NA	NA
AXW32566.1\|875397_877662_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AXW32567.1\|877658_878168_+	hypothetical protein	NA	NA	NA	NA
AXW32568.1\|878237_878780_+	hypothetical protein	NA	NA	NA	NA
AXW32569.1\|879385_880330_+	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	4.0e-09	23.9
AXW32570.1\|880548_880797_+	hypothetical protein	NA	NA	NA	NA
AXW32571.1\|880855_881098_+	hypothetical protein	NA	NA	NA	NA
AXW32572.1\|881256_881757_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	2.1e-20	36.2
AXW32573.1\|881830_882706_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
AXW32574.1\|882702_882981_-	hypothetical protein	NA	NA	NA	NA
AXW32575.1\|883002_883827_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AXW32576.1\|883861_884584_-	YggS family pyridoxal phosphate enzyme	NA	NA	NA	NA
AXW32577.1\|884708_885752_+	type IV pili twitching motility protein PilT	NA	NA	NA	NA
AXW32578.1\|885804_886944_+	type IV pili twitching motility protein PilT	NA	NA	NA	NA
AXW32579.1\|887138_887579_+	type IV pilin protein	NA	NA	NA	NA
AXW32580.1\|887582_888071_+	general secretion pathway protein GspH	NA	NA	NA	NA
AXW32581.1\|888067_888658_+	type IV pilus modification protein PilV	NA	NA	NA	NA
AXW32582.1\|888654_889683_+	pilus assembly protein PilW	NA	NA	NA	NA
AXW32583.1\|889686_890223_+	pilus assembly protein	NA	NA	NA	NA
AXW32584.1\|890254_893467_+	pilus assembly protein PilY	NA	NA	NA	NA
AXW35034.1\|893562_894060_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	3.3e-26	40.0
AXW32585.1\|894076_894775_-	YafY family transcriptional regulator	NA	NA	NA	NA
AXW32586.1\|894817_895297_-	cupin	NA	NA	NA	NA
AXW32587.1\|895347_895743_-	VOC family protein	NA	NA	NA	NA
AXW32588.1\|895901_896624_-	LrgB family protein	NA	NA	NA	NA
AXW32589.1\|896620_896998_-	CidA/LrgA family protein	NA	NA	NA	NA
AXW32590.1\|897049_898297_-	glycolate oxidase iron-sulfur subunit	NA	NA	NA	NA
AXW32591.1\|898306_899425_-	glycolate oxidase subunit GlcE	NA	NA	NA	NA
AXW32592.1\|899435_900929_-	FAD-binding oxidoreductase	NA	NA	NA	NA
AXW32593.1\|901099_901990_-	LysR family transcriptional regulator	NA	NA	NA	NA
AXW32594.1\|902000_903419_-	2-hydroxy-acid oxidase	NA	NA	NA	NA
AXW32595.1\|903539_904097_+	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AXW32596.1\|904169_905066_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AXW32597.1\|905350_905686_+	transcriptional regulator	NA	NA	NA	NA
AXW32598.1\|905809_906889_-	3-deoxy-7-phosphoheptulonate synthase	A0A2I6UFP9	Klebsiella_phage	1.1e-76	45.0
AXW32599.1\|907281_908742_-\|protease	metalloprotease TldD	NA	NA	NA	NA
AXW32600.1\|908769_909639_-	acyltransferase	M1H5W0	Paramecium_bursaria_Chlorella_virus	8.3e-09	25.3
AXW32601.1\|909644_913925_-	TIGR02099 family protein	NA	NA	NA	NA
AXW32602.1\|914104_916972_+	bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase	NA	NA	NA	NA
AXW32603.1\|916968_917589_+	rhombosortase	NA	NA	NA	NA
AXW32604.1\|917644_919687_-\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	A0A1B0T6A2	Bacillus_phage	6.0e-10	34.7

DBSCAN-SWA_4

936693 : 946832

Hokovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW32621.1\|936693_938655_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-149	50.8
AXW32622.1\|938789_939932_+	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	2.9e-22	32.7
AXW32623.1\|939967_941848_+	aminodeoxychorismate synthase component I	A0A0B5J984	Pandoravirus	6.1e-57	37.3
AXW32624.1\|941803_942490_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.5e-13	27.2
AXW32625.1\|942497_943205_-	ABC transporter permease	NA	NA	NA	NA
AXW32626.1\|943216_944041_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.4e-34	31.3
AXW32627.1\|944097_944742_-	deoxynucleoside kinase	M1IA15	Paramecium_bursaria_Chlorella_virus	8.3e-06	27.3
AXW32628.1\|944775_945285_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AXW32629.1\|945284_946832_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.6e-23	33.6

DBSCAN-SWA_5

2735994 : 2794605

Acidithiobacillus_phage(27.78%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW34075.1\|2735994_2737323_+\|transposase	DDE transposase	NA	NA	NA	NA
AXW34076.1\|2737374_2738277_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.2e-52	40.8
AXW34077.1\|2738380_2738698_-	competence protein ComE	NA	NA	NA	NA
AXW34078.1\|2738827_2739823_-	ADP-L-glycero-D-mannoheptose-6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	32.3
AXW34079.1\|2739819_2740767_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	9.0e-17	27.6
AXW34080.1\|2740793_2742167_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.9
AXW34081.1\|2742226_2743504_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AXW34082.1\|2743507_2743828_-	DUF1049 domain-containing protein	NA	NA	NA	NA
AXW34083.1\|2744013_2744436_-	integration host factor subunit beta	A7KV42	Bacillus_phage	4.7e-10	38.9
AXW34084.1\|2744472_2746161_-	30S ribosomal protein S1	NA	NA	NA	NA
AXW34085.1\|2746300_2746993_-	cytidylate kinase	NA	NA	NA	NA
AXW34086.1\|2747016_2748327_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AXW34087.1\|2748348_2749245_-	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AXW34088.1\|2749341_2750466_-	histidinol-phosphate aminotransferase	A0A142C026	Faustovirus	1.2e-15	27.7
AXW34089.1\|2750524_2751640_-	chorismate mutase	NA	NA	NA	NA
AXW34090.1\|2751728_2752865_-	3-phosphoserine/phosphohydroxythreonine aminotransferase	M1Q1P2	Streptococcus_phage	4.4e-87	46.6
AXW34091.1\|2752979_2753540_-	DUF2059 domain-containing protein	NA	NA	NA	NA
AXW34092.1\|2753666_2756324_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.0e-102	33.5
AXW34093.1\|2756732_2757389_+	hypothetical protein	NA	NA	NA	NA
AXW34094.1\|2757546_2758050_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
AXW34095.1\|2758211_2758928_+	bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase	NA	NA	NA	NA
AXW34096.1\|2758924_2759614_+	phosphoglycolate phosphatase	NA	NA	NA	NA
AXW34097.1\|2759722_2763508_+	DUF748 domain-containing protein	NA	NA	NA	NA
AXW35129.1\|2764186_2764300_-	elements of external origin	NA	NA	NA	NA
AXW34098.1\|2764566_2764857_-	hypothetical protein	NA	NA	NA	NA
AXW34099.1\|2765323_2765638_+	hypothetical protein	NA	NA	NA	NA
AXW34100.1\|2766132_2767458_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AXW34101.1\|2767586_2768027_-	LacI family transcriptional regulator	NA	NA	NA	NA
AXW34102.1\|2768059_2769442_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	9.1e-135	59.3
AXW34103.1\|2769438_2769936_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	4.5e-20	38.8
AXW34104.1\|2770515_2771949_-\|transposase	transposase	NA	NA	NA	NA
AXW34105.1\|2771972_2773745_-	hypothetical protein	NA	NA	NA	NA
AXW34106.1\|2774056_2774317_-	hypothetical protein	NA	NA	NA	NA
AXW34107.1\|2775701_2785184_-	filamentous hemagglutinin	A0A0R6PJK4	Moraxella_phage	1.3e-35	35.2
AXW34108.1\|2785399_2786356_+\|transposase	IS5/IS1182 family transposase IS1420	A0A1V0E8E1	Vibrio_phage	4.6e-61	44.4
AXW35130.1\|2788103_2788442_+	DUF1484 domain-containing protein	NA	NA	NA	NA
AXW34109.1\|2788504_2788804_-	hypothetical protein	NA	NA	NA	NA
AXW35131.1\|2788871_2789333_-	glycoside hydrolase	K4I410	Acidithiobacillus_phage	1.1e-65	80.3
AXW34110.1\|2789329_2789812_-	HNH endonuclease	A0A076YKQ7	Mycobacterium_phage	2.8e-22	48.3
AXW34111.1\|2789798_2790281_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	4.8e-59	71.6
AXW34112.1\|2790277_2790568_-	hypothetical protein	K4I011	Acidithiobacillus_phage	7.0e-13	47.6
AXW34113.1\|2790634_2790859_-	hypothetical protein	NA	NA	NA	NA
AXW34114.1\|2791189_2792176_-\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AXW34115.1\|2792451_2792829_-	hypothetical protein	NA	NA	NA	NA
AXW34116.1\|2793186_2793723_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.8e-46	50.3
AXW34117.1\|2793780_2794605_+\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2813281 : 2935056

115

Acidithiobacillus_phage(37.21%)

head,transposase,terminase,capsid,portal,integrase,protease

attL 2848029:2848088|attR 2914013:2915143

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW34132.1\|2813281_2814432_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-95	60.7
AXW34133.1\|2814748_2815021_-	hypothetical protein	NA	NA	NA	NA
AXW35135.1\|2815020_2816490_-	virulence factor	NA	NA	NA	NA
AXW34134.1\|2816498_2818706_-	hypothetical protein	A0A077K801	Ralstonia_phage	1.9e-41	32.9
AXW34135.1\|2818710_2821431_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.3e-88	31.9
AXW34136.1\|2821886_2822120_+	hypothetical protein	NA	NA	NA	NA
AXW34137.1\|2822165_2822573_-	hypothetical protein	NA	NA	NA	NA
AXW34138.1\|2822562_2822772_-	hypothetical protein	NA	NA	NA	NA
AXW34139.1\|2823006_2825304_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	0.0e+00	72.1
AXW34140.1\|2825287_2825677_-	hypothetical protein	NA	NA	NA	NA
AXW34141.1\|2825682_2826087_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	6.3e-28	50.4
AXW34142.1\|2826159_2826792_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	8.0e-62	67.5
AXW34143.1\|2826809_2827682_-	hypothetical protein	K4HZX9	Acidithiobacillus_phage	2.4e-101	65.7
AXW34144.1\|2827678_2828176_-	hypothetical protein	NA	NA	NA	NA
AXW34145.1\|2828172_2828457_-	hypothetical protein	NA	NA	NA	NA
AXW34146.1\|2828878_2829484_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AXW34147.1\|2829638_2830451_+	oxidoreductase	NA	NA	NA	NA
AXW34148.1\|2830660_2831662_+	NADPH:quinone oxidoreductase	NA	NA	NA	NA
AXW34149.1\|2832090_2833065_-	hypothetical protein	NA	NA	NA	NA
AXW35136.1\|2833061_2834285_-	glycine hydroxymethyltransferase	NA	NA	NA	NA
AXW34150.1\|2834682_2835789_-	serine/threonine acetyltransferase	NA	NA	NA	NA
AXW34151.1\|2836448_2836889_-	LacI family transcriptional regulator	NA	NA	NA	NA
AXW34152.1\|2836921_2838304_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	4.5e-134	59.9
AXW34153.1\|2838300_2838798_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	1.2e-20	38.8
AXW34154.1\|2839810_2840902_-\|transposase	transposase	NA	NA	NA	NA
AXW34155.1\|2841099_2841933_-	hypothetical protein	NA	NA	NA	NA
AXW34156.1\|2841945_2843697_-	peptide transporter	NA	NA	NA	NA
AXW34157.1\|2843708_2846255_-	hemagglutinin	A0A0R6PJK4	Moraxella_phage	4.9e-17	30.7
AXW34158.1\|2846659_2847985_+\|transposase	IS4 family transposase	NA	NA	NA	NA
2848029:2848088	attL	NA	NA	NA	NA
AXW34159.1\|2848082_2849039_-\|transposase	IS5/IS1182 family transposase IS1420	A0A1V0E8E1	Vibrio_phage	4.6e-61	44.4
AXW34160.1\|2849360_2849648_-	hypothetical protein	NA	NA	NA	NA
AXW34161.1\|2850124_2850616_-	hypothetical protein	NA	NA	NA	NA
AXW34162.1\|2850625_2859166_-	hemagglutinin	NA	NA	NA	NA
AXW34163.1\|2860287_2860620_+	DUF1484 domain-containing protein	NA	NA	NA	NA
AXW35137.1\|2860671_2860968_-	hypothetical protein	NA	NA	NA	NA
AXW35138.1\|2861035_2861497_-	glycoside hydrolase	K4I410	Acidithiobacillus_phage	1.1e-65	80.3
AXW34164.1\|2861493_2861976_-	HNH endonuclease	A0A076YKQ7	Mycobacterium_phage	4.7e-22	48.3
AXW34165.1\|2861962_2862445_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	5.3e-58	71.0
AXW34166.1\|2862441_2862732_-	hypothetical protein	K4I011	Acidithiobacillus_phage	2.7e-12	46.4
AXW34167.1\|2862798_2863023_-	hypothetical protein	A0A088C533	Shewanella_sp._phage	2.2e-06	47.0
AXW34168.1\|2863032_2864877_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.1e-106	46.4
AXW34169.1\|2864881_2865280_-	hypothetical protein	NA	NA	NA	NA
AXW34170.1\|2865276_2865759_-	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.5e-12	42.7
AXW34171.1\|2865762_2866929_-	hypothetical protein	NA	NA	NA	NA
AXW34172.1\|2866940_2870531_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.7
AXW34173.1\|2870531_2870927_-	hypothetical protein	A0A0M4UTA7	Ralstonia_phage	1.6e-31	52.3
AXW34174.1\|2870932_2875036_-	hypothetical protein	A0A0P0ZCJ4	Stx2-converting_phage	1.3e-24	27.5
AXW35139.1\|2875101_2876229_-	DNA cytosine methyltransferase	Q6J1P4	Burkholderia_virus	9.1e-101	54.6
AXW34175.1\|2878204_2878624_-	hypothetical protein	NA	NA	NA	NA
AXW34176.1\|2878993_2879638_-	hypothetical protein	NA	NA	NA	NA
AXW34177.1\|2879612_2879834_-	hypothetical protein	NA	NA	NA	NA
AXW34178.1\|2879830_2880220_-	hypothetical protein	NA	NA	NA	NA
AXW34179.1\|2880228_2881002_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	1.2e-46	43.6
AXW34180.1\|2881102_2881549_-	hypothetical protein	NA	NA	NA	NA
AXW34181.1\|2881554_2881857_-	hypothetical protein	NA	NA	NA	NA
AXW34182.1\|2881859_2882864_-\|capsid	minor capsid protein E	A0A1B2LRS0	Wolbachia_phage	2.1e-109	66.9
AXW34183.1\|2882870_2883248_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	2.7e-25	52.0
AXW34184.1\|2883257_2884499_-\|protease	Clp protease ClpP	K4HZZ6	Acidithiobacillus_phage	1.1e-59	40.3
AXW34185.1\|2884510_2886079_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	3.3e-149	57.1
AXW34186.1\|2886078_2886300_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	3.8e-11	56.2
AXW34187.1\|2886300_2886693_-	hypothetical protein	NA	NA	NA	NA
AXW34188.1\|2886703_2887213_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	1.3e-25	45.0
AXW35140.1\|2887256_2889236_-\|terminase	terminase	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	86.3
AXW34189.1\|2889238_2889775_-	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	2.0e-74	82.0
AXW34190.1\|2889871_2890366_+	hypothetical protein	A0A2H4JE21	uncultured_Caudovirales_phage	3.1e-21	57.3
AXW35141.1\|2890493_2890844_+	hypothetical protein	NA	NA	NA	NA
AXW34191.1\|2890940_2891129_+	hypothetical protein	K4HZY7	Acidithiobacillus_phage	7.7e-13	64.2
AXW34192.1\|2891353_2891719_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	3.4e-33	58.8
AXW35142.1\|2891972_2892629_+	type III secretion system effector protein	NA	NA	NA	NA
AXW34193.1\|2892636_2893905_-	DNA methylase N-4	A0A2H4JGF1	uncultured_Caudovirales_phage	2.2e-196	79.6
AXW34194.1\|2893901_2895302_-	DNA modification methylase	K4I3Y2	Acidithiobacillus_phage	8.5e-165	62.3
AXW34195.1\|2895799_2896207_-	hypothetical protein	NA	NA	NA	NA
AXW34196.1\|2896196_2896409_-	hypothetical protein	NA	NA	NA	NA
AXW34197.1\|2896640_2898938_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	1.1e-294	65.1
AXW34198.1\|2898921_2899320_-	hypothetical protein	NA	NA	NA	NA
AXW34199.1\|2899325_2899730_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	6.9e-27	48.9
AXW35143.1\|2899802_2900435_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	1.6e-62	60.5
AXW34200.1\|2900453_2901326_-	hypothetical protein	K4HZX9	Acidithiobacillus_phage	6.4e-102	66.1
AXW34201.1\|2901322_2901820_-	hypothetical protein	NA	NA	NA	NA
AXW34202.1\|2901816_2902107_-	hypothetical protein	NA	NA	NA	NA
AXW34203.1\|2902844_2903501_-	hypothetical protein	NA	NA	NA	NA
AXW34204.1\|2903633_2904287_-	hypothetical protein	NA	NA	NA	NA
AXW34205.1\|2904594_2904801_+\|integrase	integrase	NA	NA	NA	NA
AXW35144.1\|2904989_2906270_+	hypothetical protein	NA	NA	NA	NA
AXW34206.1\|2906484_2907459_-	hypothetical protein	NA	NA	NA	NA
AXW35145.1\|2907455_2908679_-	glycine hydroxymethyltransferase	NA	NA	NA	NA
AXW34207.1\|2908954_2909920_+\|transposase	IS5/IS1182 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
AXW34208.1\|2910998_2911415_-	hypothetical protein	NA	NA	NA	NA
AXW34209.1\|2911610_2912597_+\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AXW34210.1\|2914066_2915023_-\|transposase	IS5/IS1182 family transposase IS1420	A0A1V0E8E1	Vibrio_phage	4.6e-61	44.4
AXW34211.1\|2915832_2916075_+	hypothetical protein	NA	NA	NA	NA
2914013:2915143	attR	NA	NA	NA	NA
AXW34212.1\|2916078_2916486_+	hypothetical protein	NA	NA	NA	NA
AXW34213.1\|2916487_2917942_+	molybdopterin biosynthesis protein MoeB	NA	NA	NA	NA
AXW34214.1\|2918254_2918458_-	hypothetical protein	NA	NA	NA	NA
AXW34215.1\|2918916_2919213_-	hypothetical protein	NA	NA	NA	NA
AXW34216.1\|2919389_2919590_+	hypothetical protein	NA	NA	NA	NA
AXW34217.1\|2920618_2920924_-	hypothetical protein	NA	NA	NA	NA
AXW34218.1\|2920944_2921673_-	nitroreductase family protein	NA	NA	NA	NA
AXW35146.1\|2921806_2922406_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AXW34219.1\|2922636_2922843_+	hypothetical protein	NA	NA	NA	NA
AXW34220.1\|2922857_2923664_-	endoglucanase	NA	NA	NA	NA
AXW35147.1\|2924058_2924679_-	glutathione transferase GstA	NA	NA	NA	NA
AXW34221.1\|2924842_2925097_+	transcriptional regulator	NA	NA	NA	NA
AXW34222.1\|2925168_2925567_-	hypothetical protein	NA	NA	NA	NA
AXW34223.1\|2925955_2926588_+	LysE family translocator	NA	NA	NA	NA
AXW34224.1\|2926659_2927910_+	oxidase	NA	NA	NA	NA
AXW34225.1\|2927920_2928292_+	sulfite:cytochrome C oxidoreductase subunit B	NA	NA	NA	NA
AXW34226.1\|2928305_2928533_-	SirA family protein	NA	NA	NA	NA
AXW34227.1\|2928572_2929154_-	NUDIX hydrolase	NA	NA	NA	NA
AXW34228.1\|2929172_2930210_-	low specificity L-threonine aldolase	NA	NA	NA	NA
AXW34229.1\|2930262_2930451_-	tautomerase	NA	NA	NA	NA
AXW34230.1\|2930463_2931249_-	class II aldolase	NA	NA	NA	NA
AXW35148.1\|2931331_2932552_-	MFS transporter	NA	NA	NA	NA
AXW34231.1\|2932660_2933569_+	LysR family transcriptional regulator	NA	NA	NA	NA
AXW34232.1\|2933643_2935056_+\|protease	serine protease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP022781

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022781_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022781_1

625697-625813

Orphan

Consensus_repeat	Method
TACTGCGCAGAATCTCTCATCCTTGAATTTCCAAACGGGCTCT	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of CP022781_1

>merge|CP022781|1|625697-625813|CRISPRCasFinder
TACTGCGCAGAATCTCTCATCCTTGAATTTCCAAACGGGCTCTTAGATGATTCATATCGCGATGAGCGGCTTGCTACTGCGCAGAATCGCTCATCCTTGAATTTCCAAACGGGCTCT

>CP022781|1|1|625697-625813|CRISPRCasFinder
TACTGCGCAGAATCTCTCATCCTTGAATTTCCAAACGGGCTCT	TAGATGATTCATATCGCGATGAGCGGCTTGC
TACTGCGCAGAATCGCTCATCCTTGAATTTCCAAACGGGCTCT

Protein	Signature genes	Signature genes Name	Protein_function
CP022781.1\|AXW35636.1\|622471_622840_+\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|367760
CP022781.1\|AXW35630.1\|617532_617910_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|224278
CP022781.1\|AXW35637.1\|622860_623793_+\|alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176228
CP022781.1\|AXW35646.1\|632123_635333_-\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
CP022781.1\|AXW35648.1\|636990_638064_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369561
CP022781.1\|AXW35645.1\|630577_632104_-\|RND-transporter	unknown	unknown	gnl\|CDD\|273830
CP022781.1\|AXW35641.1\|627397_628075_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377009
CP022781.1\|AXW35644.1\|629587_630400_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
CP022781.1\|AXW35639.1\|626375_626864_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP022781.1\|AXW35634.1\|620782_621082_-\|superoxide-dismutase	unknown	unknown	gnl\|CDD\|171782
CP022781.1\|AXW35642.1\|628009_628195_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236025
CP022781.1\|AXW35635.1\|621319_622324_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176164
CP022781.1\|AXW35640.1\|626941_627349_+\|DUF2000-domain-containing-protein	unknown	unknown	gnl\|CDD\|227290
CP022781.1\|AXW35629.1\|616114_616852_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226476
CP022781.1\|AXW35647.1\|635369_636686_-\|efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
CP022781.1\|AXW35631.1\|618026_619007_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
CP022781.1\|AXW35633.1\|619694_620759_-\|hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|176186
CP022781.1\|AXW36726.1\|623795_624500_+\|transcriptional-regulator	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
CP022781.1\|AXW35643.1\|628275_629373_-\|low-specificity-L-threonine-aldolase	unknown	unknown	gnl\|CDD\|224919
CP022781.1\|AXW35632.1\|619008_619698_-\|type-1-glutamine-amidotransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|153235

Protein	Function_ID	Function_description	E-value
CP022781.1\|AXW35636.1\|622471_622840_+\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|367760	pfam03992, ABM, Antibiotic biosynthesis monooxygenase. This domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species. It's occurrence as a repeat in Streptomyces coelicolor SCO1909 is suggestive that the other proteins function as multimers. There is also a conserved histidine which is likely to be an active site residue.	1.26792e-10
CP022781.1\|AXW35630.1\|617532_617910_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|224278	COG1359, COG1359, Uncharacterized conserved protein [Function unknown].	7.83542e-17
CP022781.1\|AXW35637.1\|622860_623793_+\|alcohol-dehydrogenase	gnl\|CDD\|176228	cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	1.92571e-100
CP022781.1\|AXW35646.1\|632123_635333_-\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
CP022781.1\|AXW35648.1\|636990_638064_-\|alpha/beta-hydrolase	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	3.55137e-56
CP022781.1\|AXW35645.1\|630577_632104_-\|RND-transporter	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	1.07376e-97
CP022781.1\|AXW35641.1\|627397_628075_+\|hypothetical-protein	gnl\|CDD\|377009	pfam03243, MerB, Alkylmercury lyase. Alkylmercury lyase (EC:4.99.1.2) cleaves the carbon-mercury bond of organomercurials such as phenylmercuric acetate.	6.32032e-45
CP022781.1\|AXW35644.1\|629587_630400_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.30085e-28
CP022781.1\|AXW35639.1\|626375_626864_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	6.27737e-40
CP022781.1\|AXW35634.1\|620782_621082_-\|superoxide-dismutase	gnl\|CDD\|171782	PRK12865, PRK12865, YciI-like protein; Reviewed.	0.00417821
CP022781.1\|AXW35642.1\|628009_628195_-\|hypothetical-protein	gnl\|CDD\|236025	PRK07476, eutB, threonine dehydratase; Provisional.	0.000190556
CP022781.1\|AXW35635.1\|621319_622324_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176164	cd08475, PBP2_CrgA_like_6, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 6. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.31481e-98
CP022781.1\|AXW35640.1\|626941_627349_+\|DUF2000-domain-containing-protein	gnl\|CDD\|227290	COG4954, COG4954, Uncharacterized protein conserved in bacteria [Function unknown].	3.88788e-92
CP022781.1\|AXW35629.1\|616114_616852_-\|oxidoreductase	gnl\|CDD\|226476	COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane].	1.80835e-118
CP022781.1\|AXW35647.1\|635369_636686_-\|efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	5.99344e-73
CP022781.1\|AXW35631.1\|618026_619007_-\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	9.45268e-39
CP022781.1\|AXW35633.1\|619694_620759_-\|hydroxyacid-dehydrogenase	gnl\|CDD\|176186	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD). Cinnamyl alcohol dehydrogenases (CAD), members of the medium chain dehydrogenase/reductase family, reduce cinnamaldehydes to cinnamyl alcohols in the last step of monolignal metabolism in plant cells walls. CAD binds 2 zinc ions and is NADPH- dependent. CAD family members are also found in non-plant species, e.g. in yeast where they have an aldehyde reductase activity. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	0
CP022781.1\|AXW36726.1\|623795_624500_+\|transcriptional-regulator	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	1.38572e-47
CP022781.1\|AXW35643.1\|628275_629373_-\|low-specificity-L-threonine-aldolase	gnl\|CDD\|224919	COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism].	1.14324e-150
CP022781.1\|AXW35632.1\|619008_619698_-\|type-1-glutamine-amidotransferase-domain-containing-protein	gnl\|CDD\|153235	cd03141, GATase1_Hsp31_like, Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein. Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein (EcHsp31). This group includes EcHsp31 and Saccharomyces cerevisiae Ydr533c protein. EcHsp31 has chaperone activity. Ydr533c is upregulated in response to various stress conditions along with the heat shock family. EcHsp31 coordinates a metal ion using a 2-His-1-carboxylate motif present in various ions that use iron as a cofactor such as Carboxypeptidase A. The catalytic triad typical of GATase1 domains is not conserved in this GATase1-like domain. However, in common with a typical GATase1 domain, a reactive Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For EcHsp31, this Cys together with a different His and, an Asp (rather than a Glu) residue form a different catalytic triad from the typical GATase1 domain. For Ydr533c a catalytic triad forms from the conserved Cys together with a different His and Glu from that of the typical GATase1domain. Ydr533c protein and EcHsp31 are homodimers.	2.07607e-106

>CP022781.1|AXW36726.1|623795_624500_+|transcriptional-regulator
MSRSHRLFDLMQVLRRHRRTVSGQALARELGVSLRTIRRDVATLQGMGADIDAEPGVGYILQPGFLLPPLSFTEEEIQALVIGAQWVSRQTDDTLALAVKNALAKIYAVLPSDMRSALDDDTVYVGHPAKAAMPLDLSEVRRALREQRKVRITLSGVHAAVAEQVIWPIMLGIVDAKRFIAAWCEVDSAFRVIGMDNIASAEVLVDRYTRNRRQLVKEWRSQEMRPCNGRSAVC
>CP022781.1|AXW35637.1|622860_623793_+|alcohol-dehydrogenase
MKRIQYSRYGGPEWMAVDEFELSAPGAGEVAVRVRFAAVNPIDWKLRNGQMKIVTGRVFPRAMGMDFSGTVMSVGPGVIRFRAGDPVFGLARFKESGALGQAVVTKETFLARKPDNVSFEQAACLGTPGVTAWNGLIDKAKLKAGQRVFINGCAGAVGEAAVQIAQLFGAAVWGSCSARDMDRARSLGVQRLYDYRTTNVSEIAERFDVVYDTSATMPVSAGVAMLRRGGVFLDLNPGPAKLMRALVDWRLKPVIGAPRAEILDRLSAAAAEQRFRMPVGETVPLSHAIQLITELEAGRKLGGKGLVAME
>CP022781.1|AXW35636.1|622471_622840_+|antibiotic-biosynthesis-monooxygenase
MPTFEPLDPGFPVARQVDIDAGPIVMINLCTMAPADEDAFLAAWAEDTRFMKLQPGFISTQLHRAIGDNPTYFNYAVFESVVAWRDAFNHPEFRERLKAHPPSVTARPHLFEKVAVPGLCTA
>CP022781.1|AXW35635.1|621319_622324_+|LysR-family-transcriptional-regulator
MKTDMRGRLDGVAVFVEAVEAGGFARAAERLALSRSAVGKAIARLESRLGVRLFHRTTRTQNLTEDGQIYYERCLRAIEELRAAESLLESGKQEVAGRLRITMPVLFGRYCVAPILLDFARQHPKLELELSFGDRPVDMIAEGFDLGIRNGALGEATGLCARPLATQPKVLCASPAYLKARGEPDTIEALAAHDVLIHWRTGHPYPWLLPDADGRLTEVRLASRLRFDDLEVTADAAVAGMGITWLPHWLVCDRIRAGALTVLWEDRPAASMDSHAIWPATDYMPLRVRLAIDTLVEKLPLVRGMEAPIVRPGWQAQRVTAGGASSPRGARRTR
>CP022781.1|AXW35634.1|620782_621082_-|superoxide-dismutase
MKFLCLDIPQPGASLEKYPPHMHEETRHAWKLYTGGVVRDFYFRQDRPGVALIAEADSIEAARAALNEFPLAKAGLIGWDVIPLGPFTGWQLLFAPGNT
>CP022781.1|AXW35633.1|619694_620759_-|hydroxyacid-dehydrogenase
MNASGYAASSATDALAPFAFERRQPRPDDVVIDVLFCGVCHTDLHLARNHGGFTTYPIVPGHEIIGRVRQVGDKVSRFKAGDMVGVGCMVDSCQHCQPCLKGWEQDCSEGPTFTYNGIDRHDGTVTYGGYSDSIVVGDKFVLSIPDRLDPAGAAPLLCAGITTWSPLHRWNVGPGSKVAVIGLGGLGHMALKLAKALGADVSLFTRSPGKEEDAFRLGADHVVLSNDPAQMAAVAGRFDVIIDTVPYDHDINPYMPTLALEGVLVLVGYLGPLGTPVNAGGVVRGRRAISGSFIGGVPETQQMLDFCGQHGIVSDVEVIAIQQINQAYERLLKSDVKYRFVIDMASLKTSGAPA
>CP022781.1|AXW35632.1|619008_619698_-|type-1-glutamine-amidotransferase-domain-containing-protein
MTATIKPVLCVVTSHPIRGDSGEPTGFAMVELTHPLEVFREAGIPVEIASIRGGHPPIDFFDLTDPVNNRFWRDATFREALAHSLVLGDVDPSCYSAVFFAGGHGTMWDFADSAAVQHVIRTIYEAGGIVSAVCHGPAALVNARLSDGSHLVAGKKVAAFTDEEEAEVKYTNVVPYLLATTLKQRGALHQPAPNWTANVVADGRLITGQNPASAHGVGEAVVKQLTTKP
>CP022781.1|AXW35631.1|618026_619007_-|amidohydrolase
MKIVAIEEHVLPDAVKQAWNTIPGADDGTLALNTGVLGERLANLAEQRLALMDETGVDVQVLSLTTPGLNNLGHHGIDLARRVNDLLAETVAANPSRFQALAVLPFADAESAAQELRRCVEQLGFKGAILYGRVGEKHLDHAMFEPTFACAAELGAPLLIHPQIPQASVRDAYYAGFGAPVDLALSTFGLGWHYEAGIQFVRIVLAGVFDRHPNLQVILGHWGELVMFYLERLIMLDRVSKLPRPFVEYVRSHLYLTASGIFSPAYLRQAIEVVGPDRILFSTDYPYQYRLGADARRFVETLELSDDDRRKFAHGNWERLTRGTNL
>CP022781.1|AXW35630.1|617532_617910_-|antibiotic-biosynthesis-monooxygenase
MQTLGLWTSAAGEQQPTAPYVRIAQLDVDPQRLAEFEAVLRESASTSVRVEPGVYTLYAVAFKDNPHRFLVFEMYKDEAAYKAHRETPHFRKFFETTQMMVTSRTFLDVNPVVLGAKAYWERSGQ
>CP022781.1|AXW35629.1|616114_616852_-|oxidoreductase
MKLTANTILVTGGATGIGLALAKRLSESNQVIICGRSEAALQKATDEVPALVTRVCDVADTLSRREMVEWLKAEHPALNMVINNAGIQAQRDFTSNPSMESLDQEVAINFTAPIHLIAELLPTLRRQDQAYIVNVSSGLAFSPMADVPVYCATKAAIHSFTLSLRHQLKAIGIRVIEIAPPIVDTSLGGNTRSAGTANRMMVTAEAFAAEALAQLESGKDEVLVGVSAQTRQLGEAMFERMNNRA
>CP022781.1|AXW35639.1|626375_626864_+|transcriptional-regulator
MGWSEVGETVCPIARTLAVVGDRWTVLILRELFLGVKRFEEFQAQTGMSSHLLSTRLKRLEADGIVVRHLYSDRPPRHEYRLTSKGLDFYPLLLSLKSWGEKWGGFKAKTAPALTITHRQCGHETGLKLVCPACDEPFGPKDATVTLGASFKAERQARRDGA
>CP022781.1|AXW35640.1|626941_627349_+|DUF2000-domain-containing-protein
MFDTKIAIVVRDDLATWQKLNVTAFLMSGITGASPEIMGEAYRDAADNTYHSLCVQPVIVLSGDQETLKAVHRRALERKVPHGLYIEDMFSTGHDAANRAVFAEHGPDSARVVGIALREEKKIVDKITKGARMHP
>CP022781.1|AXW35641.1|627397_628075_+|hypothetical-protein
MNDASLHEAIISCFLEHQRPPTVREIAERFNRDEAQVRQALRALADNHGVVLHPHSDEVWIAHPFSAAPTTCVVKSGNRKWWGNCAWCALGLVHLAGGSATIETRIGAIDDHVIIRIENGRLLDTDYVVHFPIPMKHAWDNVIYTCSVQLLFRDEAQVDEWCASRGIPKGDVRPIEQVWNFAVEWYARHADADWTKWSVREAIELFARHHLSGPVWTIAAEAARF
>CP022781.1|AXW35642.1|628009_628195_-|hypothetical-protein
MTHHIRTPRVQSQPCSRRPGKPVWLKMGAAQPSAASCPVPLEPGRFGRNRPDGATQMMACE
>CP022781.1|AXW35643.1|628275_629373_-|low-specificity-L-threonine-aldolase
MNRDPMPTTRTPALGFTSDNIEGASPEVLDAILAANAGQAAPYGADDCTARVEQTLSELFEREVKVFLVPTGTAANALCLGAMTPPWGNVYCHPSSHINNDECGAPEFYTNGAKLVAVDGPSAKIDVEKLRAATRVKVGDVHSTQPACVSLTQATEVGSLYTLNEIEAIGQLCKDARIKLQMDGSRFANALVSLGCSPAAMTWKAGVDALSFGATKNGVVAAEAIVLFDLSLAAEMGYRRKRAGHLFSKMRFLSAQIEAYLANDLWLRNARQANDMALRLARGLEGMHGASVLGATEANIVFCRLPSTVIENLLQAGFRFYHNRWEPNVVRFVTSFATTADDVDNLLRHMKAAAAGPSADTHATA
>CP022781.1|AXW35644.1|629587_630400_-|AraC-family-transcriptional-regulator
MADSVQYQQVADVPGLVLSAGRFSQFSFERHFHLDFHVGLVTAGVQRQRFKGETVLLGPGCISLMPPGEIHDGVAEGDSAYTLKTFRLSQALLANLAQDISGTDHEPELAATLLEDPALAGHLLRLHDAMQHSGASTLQVQSEWLALLAFLLKQSRALIPEHTKGALSPAQWQRVRDYCFAHAGERITLDDLASLCALGRFQFLKQFKQTVGMTPHAWLVRLRLEQACSLLSSRSKAIAEVAQEVGFYDQSHFNRAFRQAFGVAPSHYQS
>CP022781.1|AXW35645.1|630577_632104_-|RND-transporter
MNALKQQQGGPARPGRWTPLALAAALFLAACSLAPTYEKPDVGTPTAFKEAAQGADAPLAAGEQGKWKTAEPSMPTDGAWWKLFNDATLDSLEAQAGEASPTLAAAAARVSQARAIVQSNRAALFPELDAGFGPTRQRASAASAGLPVGAPVQPQTYWRAQATVSYEADLFGRVRNSVNAADADAERVEALYRAARLSLQADVAQTYFSLRTLDAEEALLARTVVGREEALKLVQRRFSTGDIGELDVARADAELATARSDRLDVARRRALLEHALATLLGKAPSGFTLGADPLQAANVRVPPGLPSALLERRPDVAAAERAMAAANARIGVARAAFFPQLQLTGGFGFESHDIGDLLKWSSRTWLLGPLVGTALSLPIFDGGARSAGVKQARAAYEENVANYREAVLVAFREVEDNLSDLRLLADQSKVQDDAVRASTRAAQLSRTRYNAGSVNYLDVIDAERNMLSTQRVAVQLAGGRVNATVGLVKALGGGWGDPPAPQTTVSQR
>CP022781.1|AXW35646.1|632123_635333_-|multidrug-efflux-RND-transporter-permease-subunit
MNFSKFFVDRPIFAGVLSTLILLIGIISIWRLPISEYPEVVPPSVVVRAQFPGANPKVIAETVASPLEEQINGVENMLYMQSQANSDGNLTVTVTFKLGTDPDKAQQLVQNRVSQAMPRLPDVVQRLGVTTIKSSPDLTMVVHLLSPNDRYDMTYLRNYAVLNVKDRLARINGVGQVQLFGSGDYSMRVWLDPNKVAERGLTANEVVRAIRDQNVQVAAGVIGGSPSLPGTDVQLSVNAQGRLKTEQEFGDIILKSSPNGAVTTLRDVARIELAASEYGLRSLLDNKQAVAIPIFQAPGSNALQISDDVRKTMAELKEDFPEGVDYRIVYDPTQFVRSSIEAVTHTLLEAVALVVLVVILFLQTWRASIIPLLAVPVSIIGTFGLMLMFGFSINALSLFGLVLAIGIVVDDAIVVVENVERNIADGLSPREATYKAMREVSGPIIAIALTLIAVFVPLAFMTGLTGQFYKQFALTISISTVISAFNSLTLSPALAALLLKSHDAPKDLLARVMERGLGWIFRPFNRVFGAASESYGRSTSRVIGRKAVMLGIYLALIGLTALLFNRVPGGFVPMQDKQYLVSFAQLPDGASLDRTEDVIRRMSDIALKHPGVESAVAFPGLSINGFTNSPSAGIVFVTLKPFDQRKTPNLSGGAIAGQLNQQYGAIKDAFIAVFPPPPVQGLGTVGGFKMQLEDRGSVGYEQLFAASQAFMQKARQTPELGPSFSSYQINVPQLNADLDRVKAKQLGVPVTDVFDTMQIYLGSLYVNDFNRFGRTYQVKVQADAPFRAHAEDILQLKTRNTDGDMVPLSSLLRVSQGFGPDMVVRYNGYTAADINGGPAPGYSSGQAQAAAERIAREVLPKGVRFEWTDLTYQQILAGNSAVWIFPLCVLLVFLVLAAQYESLTLPLAVILIVPMSLFAAMLGVWISHGDNNIFTQIGLVVLVGLACKNAILIVEFARELELQGRSIVEAAIEACRLRLRPILMTSIAFIMGVVPLVMSTGAGAEMRHAMGVAVFAGMLGVTLFGLFLTPVFYVVLRTLASRRRQRSEDAPDLDPDAGGTALPLPSGQH
>CP022781.1|AXW35647.1|635369_636686_-|efflux-transporter-periplasmic-adaptor-subunit
MSLSKRTLALSVAAVVGVAAVGIYGLAPTAGASQQPAAPAAMPVDVAPAIARNVTDWDEFSGRLEAVERVEVRPLVGGTITAVHFKDGSIVRKGDPLFTIDPRPYAAEVARTQAALTAAKSRVAYTASELERAQKLVADNAIARREFEEKENAAREAQANLQGAAAALDAAKLNLEYTRIVAPIAGRVSRAEITVGNVVATGGAAPVLTTLVSVSPMYVAFDADEQTYLRFSANTAQGARTPVYIGLANEDGYTREGTIQSVDNRLDVRSGTIRVRATVDNADGRLTPGLYARVKMGSGAPHDAVLISDKAIGTDQDKKFVLVVDAANKTSYRPVTLGASTDGLRVVKAGLKVGERIVVNGIQRVRPGDPVAPNAVTMESLVAKRAARPGTPPQPDAGHTAEAAAPSSAAAPAAKATPQPKPANAKTAAAQRLPADRA
>CP022781.1|AXW35648.1|636990_638064_-|alpha/beta-hydrolase
MGSSPPRLVVSEHAPAAAADTGTRAAPRRPLAGVPDAMPAGALRVAAADQPGPGTGAPATAEANTPPRAVSAADYWTQGYASRIRLRVFRPERRADDGAVPLRQPGVLYLHGGGFVGGCIDDADVSARHLAATLPAVVVTVGYSLAPAAPFPAAPEDVYAALCCMAEHAATWGIDRRRLAVAGHDAGGNLSAALAMIARDRGGPGLRAQVLIAPMLDPTMARVRPDRLADADNSAEACAACYRQYLPRPTERVHPYAAPVESRRLHGLPPALLLTAPQDLLRTEAERYASALIEAGVATQVLRVADACHDSIATDRAALDEITCFLRWHLGLTRPAGPRKRRRRRAATAGTADELPG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1296637-1296667	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1709809-1709839	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1699564-1699594	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	625740-625770	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	756530-756560	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1410460-1410490	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1589274-1589304	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1334277-1334307	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1417918-1417948	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1127597-1127627	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1377032-1377062	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1304303-1304333	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1429382-1429412	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1428631-1428661	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1428631-1428661	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1428631-1428661	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1428631-1428661	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1428631-1428661	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1335532-1335562	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1316193-1316223	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1368160-1368190	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1408313-1408343	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1428634-1428664	0	1.0
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	483451-483481	1	0.968
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	946133-946163	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1939161-1939191	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	727609-727639	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1714322-1714352	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	855964-855994	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1846214-1846244	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1900102-1900132	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1524951-1524981	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1393675-1393705	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1327667-1327697	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1393675-1393705	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1393675-1393705	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1327689-1327719	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1393679-1393709	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1327689-1327719	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1327689-1327719	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1393674-1393704	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1327689-1327719	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1327689-1327719	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	732687-732717	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1725715-1725745	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	39670-39700	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	300352-300382	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1328204-1328234	2	0.935
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1785170-1785200	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1287424-1287454	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016613	Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence	1894969-1894999	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	180304-180334	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	602789-602819	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	882026-882056	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1378361-1378391	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1454273-1454303	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	288372-288402	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	571067-571097	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1651339-1651369	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	1700596-1700626	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	2063755-2063785	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1103922-1103952	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	615642-615672	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	1212768-1212798	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	747318-747348	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	819619-819649	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1420558-1420588	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	931126-931156	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1015598-1015628	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1598487-1598517	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	735945-735975	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	1343490-1343520	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052069	Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence	845744-845774	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	825157-825187	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1248136-1248166	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1428016-1428046	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1675467-1675497	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	935473-935503	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1090161-1090191	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1137695-1137725	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	654918-654948	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	277238-277268	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	652211-652241	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1090330-1090360	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1126665-1126695	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1387456-1387486	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	648502-648532	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	760275-760305	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	763851-763881	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	992613-992643	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1306618-1306648	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1311062-1311092	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	748728-748758	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1313516-1313546	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	825146-825176	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1248125-1248155	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1439480-1439510	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1686947-1686977	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	935462-935492	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1437843-1437873	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1437843-1437873	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1437843-1437873	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1437843-1437873	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1437843-1437873	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	753119-753149	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1298098-1298128	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1345630-1345660	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	782261-782291	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	862852-862882	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	733815-733845	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1278758-1278788	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1326290-1326320	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	762956-762986	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	843542-843572	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	788943-788973	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1379470-1379500	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	50364-50394	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	824332-824362	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1418411-1418441	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	93523-93553	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	936145-936175	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1664517-1664547	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1437846-1437876	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	308577-308607	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	663665-663695	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1214505-1214535	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	474239-474269	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	784442-784472	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1393356-1393386	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1949260-1949290	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	574598-574628	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	195730-195760	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016555	Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence	943662-943692	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1168517-1168547	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1724421-1724451	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1857942-1857972	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1148381-1148411	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1254978-1255008	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	936522-936552	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052071	Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence	1306758-1306788	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	936489-936519	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052075	Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence	1306725-1306755	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	813421-813451	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1403773-1403803	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	936490-936520	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	557619-557649	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052105	Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence	1305530-1305560	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	719245-719275	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	825834-825864	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	813421-813451	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1403773-1403803	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	936503-936533	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052115	Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence	1305567-1305597	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	813421-813451	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1403773-1403803	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	719273-719303	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	825857-825887	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	813425-813455	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1402976-1403006	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	936503-936533	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052107	Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence	1305567-1305597	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	936492-936522	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052117	Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence	1305556-1305586	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	719273-719303	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	825857-825887	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	936492-936522	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052121	Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence	1305556-1305586	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	719273-719303	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	825857-825887	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	813421-813451	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1403772-1403802	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	936486-936516	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	557618-557648	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052073	Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence	1306723-1306753	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	719273-719303	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	825857-825887	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	719273-719303	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	825857-825887	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	936503-936533	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052109	Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence	1305567-1305597	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	936514-936544	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052103	Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence	1305578-1305608	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	936492-936522	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	557621-557651	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052119	Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence	1305556-1305586	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	722588-722618	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1278492-1278522	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	147381-147411	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1651960-1651990	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021763	Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence	1682150-1682180	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1318105-1318135	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1875176-1875206	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	603455-603485	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	603455-603485	3	0.903
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	366595-366625	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1039301-1039331	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1216648-1216678	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052129	Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence	1659038-1659068	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1124715-1124745	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015116	Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence	1315280-1315310	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	857793-857823	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP009763	Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence	1031057-1031087	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	968513-968543	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1145860-1145890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052095	Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence	1661723-1661753	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	968513-968543	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1145860-1145890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052097	Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence	1661723-1661753	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	968513-968543	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1145860-1145890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052093	Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence	1661723-1661753	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	968513-968543	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1145860-1145890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052101	Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence	1661723-1661753	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	968513-968543	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1145860-1145890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052099	Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence	1661723-1661753	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	968515-968545	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1145861-1145891	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052091	Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence	1661726-1661756	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	550893-550923	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	826416-826446	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	947130-947160	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1502517-1502547	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1940004-1940034	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049794	Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence	1675980-1676010	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	728606-728636	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1277678-1277708	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1715165-1715195	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049792	Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence	1451141-1451171	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1562005-1562035	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1848686-1848716	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1902420-1902450	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	95917-95947	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1181911-1181941	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1366933-1366963	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	1530039-1530069	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	2144089-2144119	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP015851	Ralstonia solanacearum strain YC40-M plasmid, complete sequence	1534162-1534192	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	600175-600205	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	927371-927401	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1394518-1394548	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	562858-562888	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052085	Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence	1118237-1118267	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052077	Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence	1336878-1336908	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	600175-600205	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	927371-927401	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1394518-1394548	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	562858-562888	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052087	Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence	1118237-1118267	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	600175-600205	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	927371-927401	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1394518-1394548	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	562858-562888	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052127	Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence	1118237-1118267	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052079	Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence	1336900-1336930	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	600179-600209	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	927375-927405	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	562862-562892	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052089	Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence	1118241-1118271	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052125	Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence	1336900-1336930	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052123	Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence	1336900-1336930	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	600175-600205	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	927371-927401	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1394517-1394547	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	562858-562888	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052131	Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence	1118236-1118266	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052081	Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence	1336900-1336930	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052083	Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence	1336900-1336930	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	995868-995898	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	731844-731874	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1169331-1169361	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049790	Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence	1724718-1724748	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1591356-1591386	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	297880-297910	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1327361-1327391	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP016915	Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence	1764814-1764844	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	917664-917694	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	383860-383890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1210531-1210561	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052111	Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence	1240444-1240474	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	917664-917694	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	383860-383890	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1210531-1210561	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP052113	Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence	1240444-1240474	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	95538-95568	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	749451-749481	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	1344617-1344647	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	95624-95654	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	752879-752909	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	1350776-1350806	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	95629-95659	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	751478-751508	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	1347503-1347533	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	96778-96808	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	642089-642119	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP023015	Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence	1236594-1236624	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1072743-1072773	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	974475-974505	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	974464-974494	4	0.871
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1690351-1690381	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	484389-484419	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1545060-1545090	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	1201194-1201224	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022781	Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence	625666-625696	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022766	Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence	1410534-1410564	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022769	Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence	1417992-1418022	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022773	Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence	1127671-1127701	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022779	Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence	1429456-1429486	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022793	Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence	1335606-1335636	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022785	Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence	1316267-1316297	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022787	Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence	1368234-1368264	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP022756	Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence	1408387-1408417	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1083907-1083937	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP049788	Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence	1812352-1812382	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP025986	Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence	135719-135749	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	1451478-1451508	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	516030-516060	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	516056-516086	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	402871-402901	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	178320-178350	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	515805-515835	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	515801-515831	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	398686-398716	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	147408-147438	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1682171-1682201	5	0.839
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	193580-193610	6	0.806
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	227097-227127	6	0.806
CP022781_1	1.1\|625740\|31\|CP022781\|CRISPRCasFinder	625740-625770	31	CP011998	Ralstonia solanacearum strain YC45 plasmid, complete sequence	240473-240503	6	0.806

1. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

2. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

3. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

4. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

5. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

6. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

7. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

8. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

9. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

10. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

11. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

12. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

13. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

14. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

15. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

16. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

17. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

18. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

19. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

20. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

21. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

22. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

23. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 0, identity: 1.0

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcgatgagcggcttgc	Protospacer
*******************************

24. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.968

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatatcgcaatgagcggcttgc	Protospacer
*****************.*************

25. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

26. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

27. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

28. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

29. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

30. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

31. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

32. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

33. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

34. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

35. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

36. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

37. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

38. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

39. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

40. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

41. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

42. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

43. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

44. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

45. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

46. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

47. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

48. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
tagatgattcatgtcgcaatgagcggcttgc	Protospacer
************.****.*************

49. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

50. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

51. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016613 (Ralstonia solanacearum FJAT-91 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

52. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

53. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

54. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

55. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

56. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

57. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

58. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

59. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

60. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

61. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

62. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

63. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

64. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

65. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

66. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

67. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

68. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

69. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

70. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

71. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

72. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

73. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052069 (Ralstonia solanacearum strain FJAT91.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

74. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

75. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

76. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

77. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

78. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

79. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

80. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

81. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

82. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

83. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

84. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

85. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

86. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

87. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

88. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

89. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

90. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

91. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

92. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

93. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

94. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

95. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

96. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

97. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

98. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

99. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

100. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

101. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

102. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

103. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

104. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

105. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

106. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

107. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

108. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

109. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

110. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

111. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

112. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

113. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

114. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

115. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

116. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

117. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

118. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

119. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

120. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

121. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

122. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

123. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

124. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

125. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

126. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

127. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

128. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

129. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

130. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

131. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

132. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

133. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016555 (Ralstonia solanacearum FJAT-1458 plasmid plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

134. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

135. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

136. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

137. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

138. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

139. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

140. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

141. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052071 (Ralstonia solanacearum strain FJAT454.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

142. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

143. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

144. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052075 (Ralstonia solanacearum strain FJAT448.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

145. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

146. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

147. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

148. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

149. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052105 (Ralstonia solanacearum strain FJAT15252.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

150. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

151. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

152. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

153. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

154. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

155. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

156. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052115 (Ralstonia solanacearum strain FJAT1463.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

157. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

158. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

159. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

160. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

161. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

162. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

163. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

164. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

165. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052107 (Ralstonia solanacearum strain FJAT15249.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

166. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

167. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

168. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052117 (Ralstonia solanacearum strain FJAT1463.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

169. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

170. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

171. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

172. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

173. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052121 (Ralstonia solanacearum strain FJAT1458.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

174. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

175. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

176. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

177. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

178. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

179. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

180. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052073 (Ralstonia solanacearum strain FJAT448.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

181. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

182. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

183. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

184. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

185. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

186. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

187. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052109 (Ralstonia solanacearum strain FJAT15249.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

188. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

189. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

190. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052103 (Ralstonia solanacearum strain FJAT15252.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

191. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

192. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

193. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052119 (Ralstonia solanacearum strain FJAT1458.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

194. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

195. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

196. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

197. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

198. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021763 (Ralstonia pseudosolanacearum strain RS 476 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

199. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

200. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gtcatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

201. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

202. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 3, identity: 0.903

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgc	Protospacer
   ****************************

203. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

204. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

205. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

206. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052129 (Ralstonia solanacearum strain FJAT1303.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

207. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

208. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015116 (Ralstonia solanacearum strain EP1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

209. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

210. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP009763 (Ralstonia solanacearum OE1-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

211. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

212. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

213. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052095 (Ralstonia solanacearum strain FJAT15340.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

214. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

215. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

216. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052097 (Ralstonia solanacearum strain FJAT15304.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

217. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

218. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

219. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052093 (Ralstonia solanacearum strain FJAT15340.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

220. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

221. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

222. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052101 (Ralstonia solanacearum strain FJAT15304.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

223. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

224. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

225. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052099 (Ralstonia solanacearum strain FJAT15304.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

226. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

227. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

228. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052091 (Ralstonia solanacearum strain FJAT15340.F6 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

229. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgt	Protospacer
   ***************************.

230. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

231. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

232. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

233. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

234. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049794 (Ralstonia solanacearum strain 204 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

235. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

236. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

237. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

238. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049792 (Ralstonia solanacearum strain 203 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

239. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

240. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

241. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

242. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

243. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

244. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

245. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

246. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

247. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP015851 (Ralstonia solanacearum strain YC40-M plasmid, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

248. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

249. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

250. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

251. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

252. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052085 (Ralstonia solanacearum strain FJAT15353.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

253. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052077 (Ralstonia solanacearum strain FJAT445.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

254. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

255. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

256. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

257. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

258. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052087 (Ralstonia solanacearum strain FJAT15353.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

259. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

260. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

261. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

262. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

263. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052127 (Ralstonia solanacearum strain FJAT1303.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

264. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052079 (Ralstonia solanacearum strain FJAT445.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

265. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

266. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

267. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

268. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052089 (Ralstonia solanacearum strain FJAT15353.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

269. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052125 (Ralstonia solanacearum strain FJAT1452.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

270. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052123 (Ralstonia solanacearum strain FJAT1452.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

271. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

272. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

273. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

274. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

275. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052131 (Ralstonia solanacearum strain FJAT1303.F8 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

276. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052081 (Ralstonia solanacearum strain FJAT442.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

277. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052083 (Ralstonia solanacearum strain FJAT442.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

278. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

279. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

280. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

281. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049790 (Ralstonia solanacearum strain 202 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

282. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

283. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

284. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

285. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP016915 (Ralstonia solanacearum strain CQPS-1 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

286. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

287. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

288. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

289. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052111 (Ralstonia solanacearum strain FJAT15244.F50 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

290. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

291. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

292. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgc	Protospacer
   ********************.*******

293. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP052113 (Ralstonia solanacearum strain FJAT15244.F1 plasmid Plas1, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

294. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgt	Protospacer
   ***************************.

295. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

296. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

297. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgt	Protospacer
   ***************************.

298. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

299. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

300. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgt	Protospacer
   ***************************.

301. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

302. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

303. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagcggcttgt	Protospacer
   ***************************.

304. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgctgagcggcttgc	Protospacer
   *************** ************

305. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP023015 (Ralstonia solanacearum strain T25 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagcggcttgc	Protospacer
   **************.*************

306. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgccatgagcggcttgc	Protospacer
   ************** *************

307. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgccatgagcggcttgc	Protospacer
   ************** *************

308. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgccatgagcggcttgc	Protospacer
   ************** *************

309. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
ccatggattcatatcgcgatgagcggcttgc	Protospacer
. .  **************************

310. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

311. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

312. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022482 (Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

313. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022781 (Ralstonia solanacearum strain SL3822 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

314. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022766 (Ralstonia solanacearum strain T78 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

315. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022769 (Ralstonia solanacearum strain T60 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

316. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022773 (Ralstonia solanacearum strain T42 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

317. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022779 (Ralstonia solanacearum strain SL3882 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

318. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022793 (Ralstonia solanacearum strain SL2729 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

319. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022785 (Ralstonia solanacearum strain SL3730 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

320. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022787 (Ralstonia solanacearum strain SL3300 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

321. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP022756 (Ralstonia solanacearum strain T117 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

322. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

323. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP049788 (Ralstonia solanacearum strain B2 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

324. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP025986 (Ralstonia solanacearum strain RSCM plasmid p-unname2, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

325. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcttgt	Protospacer
   ********************.******.

326. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

327. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

328. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

329. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

330. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

331. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

332. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

333. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

334. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.839

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcgatgagtggcctgc	Protospacer
   ********************.***.***

335. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.806

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagtggcttgt	Protospacer
   **************.*****.******.

336. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.806

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagtggcttgt	Protospacer
   **************.*****.******.

337. spacer 1.1|625740|31|CP022781|CRISPRCasFinder matches to CP011998 (Ralstonia solanacearum strain YC45 plasmid, complete sequence) position: , mismatch: 6, identity: 0.806

tagatgattcatatcgcgatgagcggcttgc	CRISPR spacer
gccatgattcatatcgcaatgagtggcttgt	Protospacer
   **************.*****.******.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

565547 : 625722

Ralstonia_phage(22.22%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW35589.1\|565547_566513_+\|transposase	IS5/IS1182 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
AXW35590.1\|567443_569330_-	hypothetical protein	NA	NA	NA	NA
AXW35591.1\|569486_572939_-\|holin	choline dehydrogenase	NA	NA	NA	NA
AXW35592.1\|573458_574424_-	hypothetical protein	NA	NA	NA	NA
AXW35593.1\|574420_574879_-	hypothetical protein	NA	NA	NA	NA
AXW35594.1\|575107_575809_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AXW35595.1\|575941_576205_+	hypothetical protein	NA	NA	NA	NA
AXW35596.1\|576258_577797_+	two-component sensor histidine kinase	NA	NA	NA	NA
AXW35597.1\|577780_578440_+	DNA-binding response regulator	NA	NA	NA	NA
AXW35598.1\|578575_579103_+	lipoprotein signal peptidase	NA	NA	NA	NA
AXW36723.1\|579175_579616_-	universal stress protein	NA	NA	NA	NA
AXW35599.1\|579862_580111_-	DUF1272 domain-containing protein	NA	NA	NA	NA
AXW35600.1\|580085_581060_-	AraC family transcriptional regulator	NA	NA	NA	NA
AXW35601.1\|581110_581542_-	hypothetical protein	NA	NA	NA	NA
AXW36724.1\|581538_581844_-	glycoprotein	NA	NA	NA	NA
AXW35602.1\|582541_585289_+	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	8.1e-10	31.0
AXW35603.1\|585977_586787_+	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
AXW35604.1\|586803_587541_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-19	32.8
AXW35605.1\|587537_588224_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AXW35606.1\|588485_589400_-	glutaminase	NA	NA	NA	NA
AXW35607.1\|589610_590651_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AXW35608.1\|590778_591312_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AXW35609.1\|591587_592484_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AXW35610.1\|592967_595250_+	type VI secretion protein	NA	NA	NA	NA
AXW36725.1\|595301_595724_+	DUF1795 domain-containing protein	NA	NA	NA	NA
AXW35611.1\|595737_600303_+	hypothetical protein	NA	NA	NA	NA
AXW35612.1\|600304_600883_+	hypothetical protein	NA	NA	NA	NA
AXW35613.1\|601118_601547_+	tetratricopeptide repeat-containing protein	NA	NA	NA	NA
AXW35614.1\|601676_602078_+	hypothetical protein	NA	NA	NA	NA
AXW35615.1\|602201_602669_+	hypothetical protein	NA	NA	NA	NA
AXW35616.1\|602822_603809_+\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AXW35617.1\|604089_605055_-\|transposase	IS5/IS1182 family transposase	A0A077K814	Ralstonia_phage	5.8e-181	100.0
AXW35618.1\|605256_606681_-	type III effector protein	NA	NA	NA	NA
AXW35619.1\|607003_607327_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AXW35620.1\|607424_607919_+	arsenate reductase ArsC	NA	NA	NA	NA
AXW35621.1\|607924_608590_+	aquaporin family protein	NA	NA	NA	NA
AXW35622.1\|608762_609734_-	LysR family transcriptional regulator	NA	NA	NA	NA
AXW35623.1\|610082_611150_+	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	3.2e-87	47.2
AXW35624.1\|611173_612094_-	oxidoreductase	NA	NA	NA	NA
AXW35625.1\|612175_613264_-	hydrolase	NA	NA	NA	NA
AXW35626.1\|613475_614069_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AXW35627.1\|614415_615566_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.7e-94	61.1
AXW35628.1\|615597_615990_-	hypothetical protein	NA	NA	NA	NA
AXW35629.1\|616114_616852_-	oxidoreductase	NA	NA	NA	NA
AXW35630.1\|617532_617910_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AXW35631.1\|618026_619007_-	amidohydrolase	NA	NA	NA	NA
AXW35632.1\|619008_619698_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
AXW35633.1\|619694_620759_-	hydroxyacid dehydrogenase	A0A2K9L7I1	Tupanvirus	1.2e-78	41.6
AXW35634.1\|620782_621082_-	superoxide dismutase	NA	NA	NA	NA
AXW35635.1\|621319_622324_+	LysR family transcriptional regulator	NA	NA	NA	NA
AXW35636.1\|622471_622840_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AXW35637.1\|622860_623793_+	alcohol dehydrogenase	NA	NA	NA	NA
AXW36726.1\|623795_624500_+	transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	6.1e-10	31.8
AXW35638.1\|624897_625722_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

887807 : 899017

Ralstonia_phage(92.31%)

integrase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW35817.1\|887807_888200_-	helix-turn-helix domain-containing protein	S6B0T3	Ralstonia_phage	2.6e-63	98.5
AXW35818.1\|888315_888522_+	hypothetical protein	S6B968	Ralstonia_phage	3.3e-33	100.0
AXW35819.1\|888521_889649_+	replication initiation protein	A0A0K2QQ01	Ralstonia_phage	9.1e-218	99.2
AXW35820.1\|889653_889965_+	hypothetical protein	A0JC22	Ralstonia_phage	8.2e-52	100.0
AXW35821.1\|889971_890232_+	hypothetical protein	A0JC23	Ralstonia_phage	2.6e-35	98.8
AXW35822.1\|890231_890567_+	hypothetical protein	A0JC24	Ralstonia_phage	1.6e-56	100.0
AXW35823.1\|890646_891927_+	hypothetical protein	A0A0K2QQ05	Ralstonia_phage	1.8e-217	99.1
AXW35824.1\|891923_892199_+	DUF2523 domain-containing protein	A0JC27	Ralstonia_phage	4.3e-36	100.0
AXW35825.1\|892195_893290_+	zonular occludens toxin	A0JC28	Ralstonia_phage	2.5e-204	98.9
AXW36741.1\|893436_894111_+	hypothetical protein	A0A097ZIG8	Ralstonia_phage	7.0e-48	54.1
AXW35826.1\|894154_894586_+	DUF29 domain-containing protein	A0A0K2QQ08	Ralstonia_phage	6.0e-77	98.6
AXW35827.1\|894823_895789_-\|transposase	IS5/IS1182 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1
AXW35828.1\|896507_897983_+\|integrase	integrase	NA	NA	NA	NA
AXW35829.1\|898125_898341_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AXW35830.1\|898237_899017_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.9e-29	33.5

DBSCAN-SWA_3

1100692 : 1154439

uncultured_Caudovirales_phage(33.33%)

plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW35976.1\|1100692_1101494_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXW35977.1\|1101513_1102632_-	hypothetical protein	NA	NA	NA	NA
AXW35978.1\|1103153_1103978_+\|transposase	IS5 family transposase	NA	NA	NA	NA
AXW36755.1\|1106262_1107396_-	DUF4123 domain-containing protein	NA	NA	NA	NA
AXW35979.1\|1107413_1110170_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.1e-37	25.6
AXW35980.1\|1110190_1112908_-	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	4.5e-85	32.0
AXW35981.1\|1112940_1114032_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
AXW35982.1\|1113995_1115846_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
AXW35983.1\|1115908_1116382_-	type VI secretion protein	NA	NA	NA	NA
AXW35984.1\|1116442_1116946_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
AXW35985.1\|1117034_1118525_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
AXW35986.1\|1118517_1119030_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
AXW35987.1\|1119066_1119714_-	hypothetical protein	NA	NA	NA	NA
AXW35988.1\|1119988_1120663_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AXW35989.1\|1120706_1122053_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AXW35990.1\|1122049_1122841_+	type VI secretion system protein ImpK	NA	NA	NA	NA
AXW35991.1\|1122899_1125647_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
AXW35992.1\|1125654_1127139_+	hypothetical protein	NA	NA	NA	NA
AXW35993.1\|1127135_1128080_+	hypothetical protein	NA	NA	NA	NA
AXW35994.1\|1129229_1130147_+	hypothetical protein	NA	NA	NA	NA
AXW35995.1\|1130165_1131053_+	hypothetical protein	NA	NA	NA	NA
AXW35996.1\|1134047_1135721_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
AXW35997.1\|1136308_1137541_+	fatty acid hydroxylase	NA	NA	NA	NA
AXW35998.1\|1137548_1138067_+	hypothetical protein	NA	NA	NA	NA
AXW35999.1\|1138077_1138278_-	hypothetical protein	NA	NA	NA	NA
AXW36756.1\|1138596_1139403_-	L-aspartate dehydrogenase	NA	NA	NA	NA
AXW36000.1\|1140319_1140799_-	hypothetical protein	NA	NA	NA	NA
AXW36001.1\|1140911_1142123_-	lipase	NA	NA	NA	NA
AXW36002.1\|1142026_1142443_-	hypothetical protein	NA	NA	NA	NA
AXW36003.1\|1142478_1143039_-	FMN-binding protein	NA	NA	NA	NA
AXW36004.1\|1143070_1144447_-	porin	NA	NA	NA	NA
AXW36757.1\|1144472_1145717_-	diacylglycerol kinase	NA	NA	NA	NA
AXW36005.1\|1146587_1146788_+	hypothetical protein	NA	NA	NA	NA
AXW36006.1\|1146804_1147332_-	hypothetical protein	NA	NA	NA	NA
AXW36007.1\|1147395_1148268_-	D-amino-acid transaminase	NA	NA	NA	NA
AXW36008.1\|1148430_1148955_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXW36009.1\|1149286_1149889_+	DUF1326 domain-containing protein	NA	NA	NA	NA
AXW36758.1\|1149942_1150755_+	hypothetical protein	NA	NA	NA	NA
AXW36010.1\|1150762_1151674_+	EamA family transporter	NA	NA	NA	NA
AXW36011.1\|1151718_1152915_-	cytochrome P450	NA	NA	NA	NA
AXW36012.1\|1153473_1154439_-\|transposase	IS5/IS1182 family transposase	A0A077K814	Ralstonia_phage	1.6e-178	98.1

DBSCAN-SWA_4

1468722 : 1478799

Acidithiobacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW36210.1\|1468722_1469217_+	hypothetical protein	A0A2H4JE21	uncultured_Caudovirales_phage	1.8e-21	57.3
AXW36211.1\|1469338_1469527_+	hypothetical protein	K4HZY7	Acidithiobacillus_phage	4.5e-13	64.2
AXW36212.1\|1469751_1470117_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	2.9e-32	58.8
AXW36213.1\|1470158_1471379_-	DNA methylase N-4	A0A2H4JGF1	uncultured_Caudovirales_phage	6.0e-191	80.5
AXW36214.1\|1471375_1472776_-	DNA modification methylase	K4I3Y2	Acidithiobacillus_phage	1.0e-165	62.1
AXW36215.1\|1473273_1473681_-	hypothetical protein	NA	NA	NA	NA
AXW36216.1\|1473670_1473883_-	hypothetical protein	NA	NA	NA	NA
AXW36217.1\|1474114_1476412_-	hypothetical protein	K4HZY1	Acidithiobacillus_phage	2.5e-294	65.2
AXW36218.1\|1476395_1476794_-	hypothetical protein	NA	NA	NA	NA
AXW36219.1\|1476799_1477204_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	4.8e-28	49.6
AXW36220.1\|1477276_1477909_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	3.6e-62	67.5
AXW36221.1\|1477926_1478799_-	hypothetical protein	K4HZX9	Acidithiobacillus_phage	7.1e-101	66.1

DBSCAN-SWA_5

1521894 : 1531502

Burkholderia_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXW36245.1\|1521894_1523220_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.1e-102	49.8
AXW36246.1\|1523449_1524436_-\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AXW36247.1\|1524596_1525508_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.4e-75	47.6
AXW36248.1\|1525613_1526600_+\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AXW36249.1\|1526872_1527652_-	phosphohydrolase	NA	NA	NA	NA
AXW36250.1\|1528153_1528594_+	hypothetical protein	A4PE55	Ralstonia_virus	4.1e-33	54.5
AXW36251.1\|1529255_1531502_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.4e-52	27.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP022780

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP022781

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection