CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP023023	Acinetobacter baumannii strain 10324 plasmid pAba10324a, complete sequence	0 crisprs	NA	0	0
CP023025	Acinetobacter baumannii strain 10324 plasmid pAba10324c, complete sequence	0 crisprs	DEDDh	0	2
CP023022	Acinetobacter baumannii strain 10324 chromosome, complete genome	4 crisprs	csa3,cas3,WYL,DEDDh	1	5
CP023024	Acinetobacter baumannii strain 10324 plasmid pAba10324b, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14491 : 35995

Pseudomonas_phage(50.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX47024.1\|14491_15757_+	hypothetical protein	J9Q7Z2	Salmonella_phage	1.1e-113	51.2
AXX46924.1\|15805_15997_+	hypothetical protein	NA	NA	NA	NA
AXX46925.1\|15986_17252_+	hypothetical protein	A0A2H4P750	Pseudomonas_phage	1.5e-72	38.4
AXX46926.1\|17341_18430_+	hypothetical protein	A0A2H4P749	Pseudomonas_phage	5.0e-11	35.3
AXX46927.1\|18572_19433_+	hypothetical protein	A0A2H4P7I7	Pseudomonas_phage	1.9e-29	31.5
AXX46928.1\|19495_20533_+	5'-3' exonuclease	J9Q7S6	Salmonella_phage	2.3e-50	36.9
AXX46929.1\|20535_22737_+	recombinase RecA	J9Q736	Salmonella_phage	3.6e-53	50.7
AXX46930.1\|22821_23181_+	hypothetical protein	NA	NA	NA	NA
AXX46931.1\|23177_23639_+	hypothetical protein	NA	NA	NA	NA
AXX46932.1\|23638_24019_+	hypothetical protein	NA	NA	NA	NA
AXX46933.1\|24106_24328_+	hypothetical protein	NA	NA	NA	NA
AXX46934.1\|24361_25477_+	serine/threonine protein phosphatase	A0A2H4P756	Pseudomonas_phage	1.7e-59	38.1
AXX46935.1\|25476_27417_+	recombinase RecF	L7TNH6	Rhizobium_phage	2.9e-118	42.5
AXX46936.1\|27508_28345_+	hypothetical protein	NA	NA	NA	NA
AXX46937.1\|28476_29079_+	hypothetical protein	J9Q7Z7	Salmonella_phage	1.8e-31	42.8
AXX46938.1\|29152_29533_+	hypothetical protein	NA	NA	NA	NA
AXX46939.1\|29554_31927_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	1.5e-206	50.7
AXX46940.1\|32024_33014_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	7.1e-57	39.6
AXX46941.1\|33026_33938_+	hypothetical protein	A0A0K2FHE7	Achromobacter_phage	2.6e-66	44.8
AXX46942.1\|33941_34226_+	hypothetical protein	NA	NA	NA	NA
AXX46943.1\|34225_34453_+	hypothetical protein	NA	NA	NA	NA
AXX46944.1\|34483_34741_+	hypothetical protein	NA	NA	NA	NA
AXX46945.1\|34733_35099_+	nucleotide pyrophosphohydrolase	A0A0S0NAG1	Pseudomonas_phage	1.4e-34	61.9
AXX46946.1\|35290_35995_-\|transposase	IS6 family transposase IS1008	A0A077SL39	Escherichia_phage	5.1e-118	84.5

DBSCAN-SWA_2

65827 : 105304

Salmonella_phage(31.82%)

capsid,terminase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX46980.1\|65827_67537_-	helicase	L7TNS5	Rhizobium_phage	2.9e-130	46.1
AXX46981.1\|67615_68254_+	chromosome partitioning protein ParB	L7TL04	Rhizobium_phage	1.0e-48	46.1
AXX46982.1\|68282_68885_+	hypothetical protein	NA	NA	NA	NA
AXX46983.1\|68881_69532_+	chromosome partitioning protein ParB	L7TMF9	Rhizobium_phage	5.0e-35	41.9
AXX46984.1\|69531_70188_+	ABC transporter	L7TNS9	Rhizobium_phage	5.9e-60	54.8
AXX46985.1\|70184_70607_+	thioredoxin	NA	NA	NA	NA
AXX46986.1\|70645_71599_+	hypothetical protein	A0A2H4P6X5	Pseudomonas_phage	4.6e-61	42.1
AXX46987.1\|71589_71913_+	hypothetical protein	NA	NA	NA	NA
AXX46988.1\|71881_72376_+	hypothetical protein	A0A0D4DBK8	Acinetobacter_phage	7.0e-05	33.0
AXX46989.1\|72487_72889_+	hypothetical protein	NA	NA	NA	NA
AXX46990.1\|73041_73647_+	DNA-binding protein	J9Q6D4	Salmonella_phage	4.0e-18	34.3
AXX46991.1\|73656_74901_+\|terminase	terminase	A0A2H4P6Z9	Pseudomonas_phage	2.8e-151	62.2
AXX46992.1\|74946_76617_+	hypothetical protein	J9Q7R1	Salmonella_phage	3.6e-146	52.3
AXX46993.1\|76637_77516_+	hypothetical protein	A0A2H4P6Z8	Pseudomonas_phage	3.0e-14	41.5
AXX46994.1\|77650_78553_+\|capsid	phage major capsid protein	A0A2H4P701	Pseudomonas_phage	1.5e-90	58.3
AXX46995.1\|78691_79186_+	hypothetical protein	L7TKJ9	Rhizobium_phage	1.4e-08	29.3
AXX46996.1\|79192_79963_+	hypothetical protein	NA	NA	NA	NA
AXX47026.1\|80021_80660_+	hypothetical protein	NA	NA	NA	NA
AXX46997.1\|80646_80997_+	hypothetical protein	J9Q7F6	Salmonella_phage	7.4e-09	33.0
AXX46998.1\|80993_81380_+	hypothetical protein	J9Q6D8	Salmonella_phage	9.3e-13	32.8
AXX46999.1\|81379_81877_+	hypothetical protein	NA	NA	NA	NA
AXX47000.1\|81961_82507_+	hypothetical protein	A0A2H4P707	Pseudomonas_phage	8.2e-39	52.2
AXX47001.1\|82601_82955_+	hypothetical protein	NA	NA	NA	NA
AXX47002.1\|82996_83308_+	hypothetical protein	NA	NA	NA	NA
AXX47003.1\|83310_88899_+\|tail	tail length tape measure protein	NA	NA	NA	NA
AXX47004.1\|88972_89299_+\|tail	phage tail protein	D6PGG4	uncultured_phage	9.0e-09	31.1
AXX47005.1\|89298_89994_+\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	2.8e-60	48.0
AXX47006.1\|89990_90740_+\|tail	phage tail protein	J9Q7R4	Salmonella_phage	1.3e-47	40.5
AXX47007.1\|90733_91312_+\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	1.1e-25	36.1
AXX47008.1\|91335_102564_+\|tail	phage tail protein	A4JX16	Burkholderia_virus	9.9e-155	36.4
AXX47009.1\|102564_102879_+	hypothetical protein	NA	NA	NA	NA
AXX47010.1\|102892_103627_+	hypothetical protein	NA	NA	NA	NA
AXX47011.1\|103636_103888_+	hypothetical protein	NA	NA	NA	NA
AXX47012.1\|103946_104150_-	hypothetical protein	NA	NA	NA	NA
AXX47013.1\|104273_104666_+	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	1.1e-32	55.5
AXX47014.1\|104665_105304_+	lysozyme	A0A075DXC6	Acinetobacter_phage	3.7e-67	63.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP023022

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP023022_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP023022_2

423754-423855

Orphan

Consensus_repeat	Method
GAGGATAAACAAAGCAATGCTTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP023022_2

>merge|CP023022|2|423754-423855|CRISPRCasFinder
GAGGATAAACAAAGCAATGCTTTGTCCTGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGAACTATGTTCGAGTGGAAGAGGATAAACAAAGCAATGGTTTG

>CP023022|2|2|423754-423855|CRISPRCasFinder
GAGGATAAACAAAGCAATGCTTTG	TCCTGAGAAGCGACTAAAGCTTCGCAAGAAGACGAGAACTATGTTCGAGTGGAA
GAGGATAAACAAAGCAATGGTTTG

Protein	Signature genes	Signature genes Name	Protein_function
CP023022.1\|AXX43815.1\|413038_414058_+\|alpha-ketoacid-dehydrogenase-subunit-beta	unknown	unknown	gnl\|CDD\|223101
CP023022.1\|AXX43825.1\|424856_425861_+\|homoserine-dehydrogenase	unknown	unknown	gnl\|CDD\|168683
CP023022.1\|AXX43822.1\|421400_422096_+\|Zn-dependent-hydrolase	unknown	unknown	gnl\|CDD\|293810
CP023022.1\|AXX43820.1\|418956_419868_-\|bestrophin	unknown	unknown	gnl\|CDD\|376448
CP023022.1\|AXX43828.1\|427828_428224_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP023022.1\|AXX43819.1\|417850_418909_+\|butanediol-dehydrogenase	unknown	unknown	gnl\|CDD\|176195
CP023022.1\|AXX43816.1\|414059_415595_+\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	unknown	unknown	gnl\|CDD\|273567
CP023022.1\|AXX43821.1\|419937_421209_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
CP023022.1\|AXX43831.1\|430602_431346_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
CP023022.1\|AXX43829.1\|428319_428928_+\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|234675
CP023022.1\|AXX43832.1\|431374_433108_+\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|181346
CP023022.1\|AXX43818.1\|417035_417821_+\|diacetyl-reductase	unknown	unknown	gnl\|CDD\|187624
CP023022.1\|AXX43827.1\|426977_427832_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
CP023022.1\|AXX43813.1\|410711_411698_-\|lipoyl-synthase	unknown	unknown	gnl\|CDD\|237261
CP023022.1\|AXX43833.1\|433128_433374_+\|ferredoxin-family-protein	unknown	unknown	gnl\|CDD\|224069
CP023022.1\|AXX43824.1\|423955_424747_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP023022.1\|AXX43826.1\|425893_426811_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP023022.1\|AXX43817.1\|415605_417009_+\|dihydrolipoyl-dehydrogenase	unknown	unknown	gnl\|CDD\|235798
CP023022.1\|AXX43814.1\|412062_413025_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238958
CP023022.1\|AXX43830.1\|429011_430361_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|273350

Protein	Function_ID	Function_description	E-value
CP023022.1\|AXX43815.1\|413038_414058_+\|alpha-ketoacid-dehydrogenase-subunit-beta	gnl\|CDD\|223101	COG0022, AcoB, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion].	3.26675e-168
CP023022.1\|AXX43825.1\|424856_425861_+\|homoserine-dehydrogenase	gnl\|CDD\|168683	PRK06813, PRK06813, homoserine dehydrogenase; Validated.	7.04313e-77
CP023022.1\|AXX43822.1\|421400_422096_+\|Zn-dependent-hydrolase	gnl\|CDD\|293810	cd07724, POD-like_MBL-fold, ETHE1 (PDO type I), persulfide dioxygenase A (PDOA, PDO type II) and related proteins; MBL-fold metallo-hydrolase domain. Persulfide dioxygenase (PDO, also known as sulfur dioxygenase, SDO, EC 1.13.11.18) is a non-heme iron-dependent oxygenase which catalyzes the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria. Mutations in ethe1 (the human PDO gene) are responsible for a rare autosomal recessive metabolic disorder called ethylmalonic encephalopathy. Arabidopsis thaliana ETHE1 is essential for embryo and endosperm development. Bacterial ETHE1-type PDOs are also called Type 1 PDOs. Type II PDOs (also called PDOAs), are mainly proteobacterial. These enzymes belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.07982e-87
CP023022.1\|AXX43820.1\|418956_419868_-\|bestrophin	gnl\|CDD\|376448	pfam01062, Bestrophin, Bestrophin, RFP-TM, chloride channel. Bestrophin is a 68-kDa basolateral plasma membrane protein expressed in retinal pigment epithelial cells (RPE). It is encoded by the VMD2 gene, which is mutated in Best macular dystrophy, a disease characterized by a depressed light peak in the electrooculogram. VMD2 encodes a 585-amino acid protein with an approximate mass of 68 kDa which has been designated bestrophin. Bestrophin shares homology with the Caenorhabditis elegans RFP gene family, named for the presence of a conserved arginine (R), phenylalanine (F), proline (P), amino acid sequence motif. Bestrophin is a plasma membrane protein, localized to the basolateral surface of RPE cells consistent with a role for bestrophin in the generation or regulation of the EOG light peak. Bestrophin and other RFP family members represent a new class of chloride channels, indicating a direct role for bestrophin in generating the light peak. The VMD2 gene underlying Best disease was shown to represent the first human member of the RFP-TM protein family. More than 97% of the disease-causing mutations are located in the N-terminal RFP-TM domain implying important functional properties. The bestrophins are four-pass transmembrane chloride-channel proteins, and the RFP-TM or bestrophin domain extends from the N-terminus through approximately 350 amino acids and contains all of the TM domains as well as nearly all reported disease causing mutations. Interestingly, the RFP motif is not conserved evolutionarily back beyond Metazoa, neither is it in plant members.	4.15884e-82
CP023022.1\|AXX43828.1\|427828_428224_-\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	9.44811e-39
CP023022.1\|AXX43819.1\|417850_418909_+\|butanediol-dehydrogenase	gnl\|CDD\|176195	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase. (2R,3R)-2,3-butanediol dehydrogenase, a zinc-dependent medium chain alcohol dehydrogenase, catalyzes the NAD(+)-dependent oxidation of (2R,3R)-2,3-butanediol and meso-butanediol to acetoin. BDH functions as a homodimer. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Sorbitol and aldose reductase are NAD(+) binding proteins of the polyol pathway, which interconverts glucose and fructose. Sorbitol dehydrogenase is tetrameric and has a single catalytic zinc per subunit.	0
CP023022.1\|AXX43816.1\|414059_415595_+\|diaminohydroxyphosphoribosylaminopyrimidine-deaminase	gnl\|CDD\|273567	TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form. This model represents one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex. It includes sequences from mitochondria and from alpha and beta branches of the proteobacteria, as well as from some other bacteria. Sequences from Gram-positive bacteria are not included. The non-enzymatic homolog protein X, which serves as an E3 component binding protein, falls within the clade phylogenetically but is rejected by its low score. [Energy metabolism, Pyruvate dehydrogenase].	3.67023e-121
CP023022.1\|AXX43821.1\|419937_421209_-\|sigma-54-dependent-Fis-family-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	4.82981e-123
CP023022.1\|AXX43831.1\|430602_431346_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.17942e-74
CP023022.1\|AXX43829.1\|428319_428928_+\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|234675	PRK00170, PRK00170, azoreductase; Reviewed.	5.24919e-86
CP023022.1\|AXX43832.1\|431374_433108_+\|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|181346	PRK08275, PRK08275, putative oxidoreductase; Provisional.	0
CP023022.1\|AXX43818.1\|417035_417821_+\|diacetyl-reductase	gnl\|CDD\|187624	cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs. 2,3-butanediol dehydrogenases (BDHs) catalyze the NAD+ dependent conversion of 2,3-butanediol to acetonin; BDHs are classified into types according to their stereospecificity as to substrates and products. Included in this subgroup are Klebsiella pneumonia meso-BDH which catalyzes meso-2,3-butanediol to D(-)-acetonin, and Corynebacterium glutamicum L-BDH which catalyzes lX+)-2,3-butanediol to L(+)-acetonin. This subgroup is comprised of classical SDRs with the characteristic catalytic triad and NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.14898e-114
CP023022.1\|AXX43827.1\|426977_427832_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.38745e-34
CP023022.1\|AXX43813.1\|410711_411698_-\|lipoyl-synthase	gnl\|CDD\|237261	PRK12928, PRK12928, lipoyl synthase; Provisional.	0
CP023022.1\|AXX43833.1\|433128_433374_+\|ferredoxin-family-protein	gnl\|CDD\|224069	COG1146, COG1146, Ferredoxin [Energy production and conversion].	8.24428e-10
CP023022.1\|AXX43824.1\|423955_424747_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	9.27594e-23
CP023022.1\|AXX43826.1\|425893_426811_-\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	4.54094e-15
CP023022.1\|AXX43817.1\|415605_417009_+\|dihydrolipoyl-dehydrogenase	gnl\|CDD\|235798	PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed.	0
CP023022.1\|AXX43814.1\|412062_413025_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238958	cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC). PDC catalyzes the irreversible oxidative decarboxylation of pyruvate to produce acetyl-CoA in the bridging step between glycolysis and the citric acid cycle. ADC participates in the breakdown of acetoin while BCADC participates in the breakdown of branched chain amino acids. BCADC catalyzes the oxidative decarboxylation of 4-methyl-2-oxopentanoate, 3-methyl-2-oxopentanoate and 3-methyl-2-oxobutanoate (branched chain 2-oxo acids derived from the transamination of leucine, valine and isoleucine).	1.46231e-132
CP023022.1\|AXX43830.1\|429011_430361_-\|chromate-transporter	gnl\|CDD\|273350	TIGR00937, Chromate_transport_protein, chromate transporter, chromate ion transporter (CHR) family. Members of this family probably act as chromate transporters, and are found in Pseudomonas aeruginosa, Alcaligenes eutrophus, Vibrio cholerae, Bacillus subtilis, Ochrobactrum tritici, cyanobacteria and archaea. The protein reduces chromate accumulation and is essential for chromate resistance. [Transport and binding proteins, Anions].	2.57835e-60

>CP023022.1|AXX43822.1|421400_422096_+|Zn-dependent-hydrolase
MFFKQFFEKESSTYTYMLGCEETRVAVLIDPVASDIEIYAKELEQHQFTLIYTLDTHVHADHITAADLLRERFHCKSVLHRNSDVSCGDILITDGCMLKVGNLSIEARYTPGHTNACTSYLVGNMIFTGDALLIDGCGRTDFQQGSAGTLYDSIHKQLFSLPDETIVYPGHDYKGRLSSTIGYERLNNSRLGQNRSREDFIELMNNLNLPYPKQIDKALPANQACGSISQL
>CP023022.1|AXX43821.1|419937_421209_-|sigma-54-dependent-Fis-family-transcriptional-regulator
MAKLNFELEQDFYILFEQLKALFPNAILFLVDTSTQAIHYKFNTDDISVESMAALTQDHHNQYLEINTPKMRRRFIYQEHDIYIAEHRIIGKLHILQPVSIENDIVDGVELTEQLQDLAKVFNSCSPEMTRMFSIIQRVAITEFPVLVRGESGSGKELVAKAIHDYSQRKNKIFVAINCAALNSNILESELFGHVKGAFTGAIRDHKGVFERAAGGTLFLDEIAEIPLELQAKLLRVLETGEFTPVGGEKPIQANVRIITATHKALREEAKAGRFRHDLLYRLRVIPIFIPPLRERKVDIPLIVDQILKESSTQLDTMPRHVNQKAMQVLLNYDWPGNVRELKNTLLYALTMANGKDEIEVEDLPNELLNADDYVKLPETNAELSPENVQAALEKYNHNLNMVANIFGISRTTLWRYRQKHKL
>CP023022.1|AXX43820.1|418956_419868_-|bestrophin
MIVRDKSNVFKLLFAWKGTILPKVLPALSFVVLISACVVWLSYYHWIQIPTVPAIGFTIFGVILSICTGFRNNACYDRWWEGRKLWGALIANARHIVRDSHVLSNEQREHLIHQVLIFCNLLRDRLRQQTVEPTKFLEHAYLNNSSLNYLNEHINAPQFVLENIQKDLVKALKDGEISDIIYGTLTRHIVELGNIQAGCDRIAGTPLPYSYSVLLHRAVYCFCFILPFSLEAALGIWTPLIVGLIAYMFLGLDALSAQIEEPFGLQENDLPLDSIVRLIERESLSSLGQPLPPIIEAQNNNLL
>CP023022.1|AXX43819.1|417850_418909_+|butanediol-dehydrogenase
MKAARFYDRGDIRIEDIPEPEVTPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPISGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNFIGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVGGAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNGDGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYVNDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVHP
>CP023022.1|AXX43818.1|417035_417821_+|diacetyl-reductase
MVKGLKNKVALVTGAAQGIGRGIALRLAQEGAHIALVDMKQDRLNDVQQEIQALGVNASTFIADVSDREQVYAAINHAEQTLGGFDVMINNAGIAQVQAIADITPDEFQKIVDINIGGVLWGIQAAAAKFKQREHKGKIINACSIAGHDGFALLGIYSATKFAVRALTQAAAKEYASHGITVNGYCPGIVGTDMWVEIDKRFAEITGAAIGETYKKYVEGIALGRAQTPDDVAALVAFLASEDSDYITGQSILTDGGIVYR
>CP023022.1|AXX43817.1|415605_417009_+|dihydrolipoyl-dehydrogenase
MSAAQFDLIVIGAGPGGYVAAIRAAQLGLKTAIVEEQHLGGICLNWGCIPTKALLAGAELATQFKHAGQFGFQVSQLDFDVQKLVQHSRQVSAQLVQGIDYLLKKNQVTVFNGRAQLTAKEKIEVTDAQGNSQVLSAPHIILATGAKARHVPQLPVDGTYVWSYKEALVPEQLPKSLLVVGSGAIGSEFASLYQDLGCQVTLIDLAKQILPTEDAEVAQFVRKQFEQKGMKVITDAVVQSIQIENEQVHCVVETANDVQTLVFDRVLSAIGVQPNTTGLGLERLGVELNPQGFVAIDDYCKTNVAGLYAIGDVAGAPCLAHKASHEAMICIEKIAGVANVHSLDRSQIPGCIFTHPQVASIGLTENAAKAKNLPIRIGKFSLTANGKALAIGDASGFVKTVVHAETGELLGAHMVGHEVTEHIQGFAIAKYLEATDESLAQVIFPHPTLSEAMHESILASMQRAIHM
>CP023022.1|AXX43816.1|414059_415595_+|diaminohydroxyphosphoribosylaminopyrimidine-deaminase
MSEIKTLEIPKWGLSMEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLIAVCADSEVSDAEIEKFIASLGGSAAQAPEAPSEQSKAETSAPVAEKTAQPQTAAASASAPAKVAKDDYAVPESLQGYQTSNELFATPHALKLAEKHNVNLAKVTGSGREGRISVQDIQKAVQASGGQWPDVRQQTQAKVVKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCKEDVEAVYYRNNPVSVSEQPVQCAAQPQSTVTTVAMNGMRKAIASRLQAAKRNAPHFRLVVDLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQADISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLGMLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKFLASFKQFVENPALILV
>CP023022.1|AXX43815.1|413038_414058_+|alpha-ketoacid-dehydrogenase-subunit-beta
MPNKSFRNAIKEAIESEMRRDPTVFVVGEDVRGGHGGKNTEENQLEGFGGVLGVTKGLWTEFGSERVIDTPITESAIIGMAAGAAATGLRPVADLMFMDFYGVCHDMLYNQAAKFRYMFGGKAKAPMVVRGMIGAGFSAAAQHSQSPYNVFAAVPGLKVVVPSSPYDVKGLLIQAIRDDDPVVFCEHKMLYDIKGEVPDDAYTIPFGVANYTREGTDVTIIALGLMVHRANEVADKLAKDGISVEVVDPRTISPLDEEGILESVASTGRVVIVDESAARCGFGHDVAALIAQKGFHYLKAPVELVTPPHTPVPFSPVLEKEWIPSVERIEQAVRKTLEA
>CP023022.1|AXX43814.1|412062_413025_+|ABC-transporter-substrate-binding-protein
MQLTEEQLLAAYKRMRDIREFEDRLHEENTNGDIPGFIHLYSGEEAVAVGICENLTDKDYITSTHRGHGHCIAKGCDIHAMMLEIFGKDDGLCRGKGGSMHIADLDKGMLGANGIVGGGPPLAIGAALTAKTLKTGGVGLSFTGDGGSNQGLTFEAMNMAVVLKLPVIFVFENNGFGEGTGHDYAVGSKDIAGRAAGFGLPAVKVDGTDFFAVYEAAQTAIERARRGEGPSVIETITNRFYGHFEGDPGLIRSKEEVEFIKENKDPLKIFREKVKGKIDEAKLDEIDAASKANVDDAVAKARAAAYPKPEQLLTDVYVSY
>CP023022.1|AXX43813.1|410711_411698_-|lipoyl-synthase
MDLKRQIETGIKLRGIDKVSRIPIKILPTEELPKKPEWIRAKITDFEEIQRIKNLLRQQKLHSVCEEAACPNLPECFAGGTATFMIMGDICTRRCPFCDVAHGRPMPLDENEPKHLAETVANLNLKYVVITSVDRDDLHDGGAAHFVKCIEEIRNRCPDTLIEILVPDFRGRLETALSTLSLSPPDVFNHNIETVPRLYKAMRPGSDYQHSLNLLKRFKKYCPDIKTKCGLMVGLGEIEAEVIALLNDLKDHDVDLVTIGQYLQPSKSHAPIHRFVNLQEFERYTQHGQRLGFKNIWSAPMVRSSYFADRQYFGESAPKPFSREDVLS
>CP023022.1|AXX43824.1|423955_424747_+|sulfite-exporter-TauE/SafE-family-protein
MLLLVVEGIVIGFLLGLTGAGGGILAVPALMTSQGWSVAQAAPIGLLAVALSTLIGTIEGLFKKIVRYRAAIWIALIGAPMAHIGILIANTISPIWLMLMFSLVMFTVGYRLINNRVSDFHNPPCQVNPSTGRFIWNFKTGGVLASIGIIAGLLTGMLGVGGGFVIVPALRKVTNLDMHSIVATSLMIIFLISGMSIVMHIAEGFQYPVAITSAFALACAFGMLLGRRAIRFIPSAIVQKVFALMVFAVAIYMVIKIVNLTNI
>CP023022.1|AXX43825.1|424856_425861_+|homoserine-dehydrogenase
MKRINVAICGFGRIGQQIAELLLNRSTYYKQKYQIDARLVGVCNSSSGLIDQEGLQASKWLDKTQYQAGLTEQKFLKQVQADVIIETGPSDYVTGGKGLFYLNYALTHSMNAIAVSKGALVVEGKKLINLAHQHNKKLFFSGATAAALPTVDLFEYNLAGCQILEIESVFTGTTNFILNDMLQHECAFTESLEKAQARGIAEPNSSFDVDGWDTAAKITILANTVLGVDVKIQDIPRQGISHVTTEHIRDWKKENIIPRLVGFIHIKNQQIQTGVELRLVPANHPFAHLQGSNKCIRVLTQEMGEFVVSGGASAPLATAAAALKDFELMLKTGC
>CP023022.1|AXX43826.1|425893_426811_-|EamA-family-transporter
MNILLYVAVVLIWGTTWIGIAVQSHYATPVVAILWRFAISALLLWVVLLFSGKLQRIALKDHLFCMLQGLCVFGLNFICFYTAVKYVNSGLESVIFSMAVFFNAINALIFFKQKPSPNFAPAALLGLSGIVLLFWHDLINSQFNAQLLMGIGLCAIGTYGFSLGNMISVRHQKRGLNIFSTNCYAMTYGALVMLILALFTGQDLMPPMNFPFLSSVLYLAVFGTVIGFSAYFSLVGRIGAAKAAYSTLLFPLVALTVSTFFEGYEWTLNAVFGILLILLGNYLMFSKFEIGKKLFSSQKNCEKQA
>CP023022.1|AXX43827.1|426977_427832_+|AraC-family-transcriptional-regulator
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQKTPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIELNEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKGGLAPHKLKYIQEWIEDHLDQALTLSDLANVVNLSEYHFAHMFKQSMNMAPHQYVMQRRLTKAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
>CP023022.1|AXX43828.1|427828_428224_-|transcriptional-regulator
MTVTIPHDIQSSDCQRVSQVLARVGEKWSILIVMTLASHPHRFSEIKRRINGISQRMLTLCLRGLERDGLVKRTVYPVVPSHVEYELTPLGHSLTEPVIALGQWAQQHIADIDAARAAFDAAQEKPITLDT
>CP023022.1|AXX43829.1|428319_428928_+|FMN-dependent-NADH-azoreductase
MKLLQIDTSILGEQSVSRQLTSSVIRQLSTAYPDAEIIHHDFALEPIPHLSDAEFLAWQGVEPNNEIAQQRVARNTQYLDEFLSSDIVVIGAPMYNFSFPSQLKAWLDRLSVAGKTFRYTENGPQGLVEGKRVIIASSRGGVYSEGSPAEALDYQETYIKAFFNFIGVTDITFVRAEGIAFGPEARQTALDNAAAQIAQLAG
>CP023022.1|AXX43830.1|429011_430361_-|chromate-transporter
MQQKQLNTPDDSVEQVTFWQAILFWLKLGFISFGGPAGQIAVMHQELVEQKRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTTGGLVAGILFVLPSLFILIGLSWVYIKFGDVPVISGIFYGIKPAVTAIVFHATYRIGSRSLKNKFLWFVAIAAFFAIFFLKLPFPLIVLSAGIAGYLASKKYPELFSSAAGHKASQKDYGPAIIDDDTPTPEHAKFHWLRLAKLIFVAIALWLLPILALGAYFGWHHSYTQMAWFFTKAALLTFGGAYAVLPYVYQGAVNHFGWLSPTQMIDGLALGETTPGPLIMVVAFVGFLGGVNHSLLGSEHLFFAGALGAVIVTWFTFLFSFVFIFAGAPIIESTHNEIKFTAPLTAITAAVVGVILNLALFFSYHVLWPQGFSGHFDIVAALITVAAFIALFRFNINVLYVIFASALVGLAVTFF
>CP023022.1|AXX43831.1|430602_431346_+|GntR-family-transcriptional-regulator
MSQLPQDPKNHKPLYDQLRELILNKIVNGEYAVLSQIPSENEFAEQFGVSRITVRQALNQLQLEGYIFKVPGKGTFVSKPKTFQNISSLQGFAEAMSSAGHEILNRVISAELKQVPMHVVPKLKLPVKANVYEIQRVRLLNRQPVSYELTYLSEHIGLKLKEKAIDLRTTDIFKALEQECDIPLGHADLSIDATVADEELAALLQVEIGTPVLRVERLTHDANGQPIDYEYLYFSGDTFQYRLRIHR
>CP023022.1|AXX43832.1|431374_433108_+|fumarate-reductase/succinate-dehydrogenase-flavoprotein-subunit
METKYFEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAVIPGYATPEQYTKEITIANDGVVNQTTVYAYAKHSFTTIQQLDQWGIKFEKDETGEFAVKKVHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSGDFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQINPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKVDHLAEETIQTIEEILHTNERPSRGRFHEGRGINYRQDMVEMHISEIGFCSGHSASGVWVNEKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVNAVEDSELNQSEIEAEKARIFAPLDCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNPHELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEHGNMVSFKKPIEPYVVPINQDEAVSYDRLRIQKDVALAD
>CP023022.1|AXX43833.1|433128_433374_+|ferredoxin-family-protein
MAFIFKEVQHRTVAPVIIDEDKCIADKGCTVCVDVCPMDLLAIDPTTQKAYMQFDECWYCMPCEKDCPTDAVKVNIPYLLK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP023022_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP023022_3

676999-677143

Orphan

Consensus_repeat	Method
AAATTAACCATAACTATGTTCATCTCGCGCTTCGCCAAAGCTTTAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP023022_3

>merge|CP023022|3|676999-677143|CRISPRCasFinder
AAATTAACCATAACTATGTTCATCTCGCGCTTCGCCAAAGCTTTAGCCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATACAAATTAACCATAACTATGTTCATCTTGCGCTTCGCCAAAGCTTTAG

>CP023022|3|3|676999-677143|CRISPRCasFinder
AAATTAACCATAACTATGTTCATCTCGCGCTTCGCCAAAGCTTTAG	CCGCTTTGTCTTGCTCAGGTGGCGTTTTTTTATACCTGTAAAAAGTTCAATAC
AAATTAACCATAACTATGTTCATCTTGCGCTTCGCCAAAGCTTTAG

Protein	Signature genes	Signature genes Name	Protein_function
CP023022.1\|AXX44029.1\|672816_673488_-\|DUF2057-domain-containing-protein	unknown	unknown	gnl\|CDD\|378258
CP023022.1\|AXX44034.1\|676714_676948_+\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX44025.1\|670646_671792_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
CP023022.1\|AXX44041.1\|681725_682520_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
CP023022.1\|AXX44033.1\|676139_676499_-\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX44040.1\|680771_681674_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176162
CP023022.1\|AXX44038.1\|679816_680158_+\|monothiol-glutaredoxin,-Grx4-family	unknown	unknown	gnl\|CDD\|188046
CP023022.1\|AXX44035.1\|677332_677758_+\|DUF2750-domain-containing-protein	unknown	unknown	gnl\|CDD\|378546
CP023022.1\|AXX44032.1\|675712_676039_-\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX44043.1\|684365_684785_+\|heme-degrading-domain-containing-protein	unknown	unknown	gnl\|CDD\|225734
CP023022.1\|AXX44036.1\|677898_678330_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|341391
CP023022.1\|AXX44044.1\|685044_685290_+\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX44039.1\|680204_680528_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273177
CP023022.1\|AXX44027.1\|671907_672207_+\|cytochrome-bd-biosynthesis-protein	unknown	unknown	gnl\|CDD\|370577
CP023022.1\|AXX44030.1\|673713_674310_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226090
CP023022.1\|AXX44031.1\|674498_675605_-\|signal-recognition-particle-docking-protein-FtsY	unknown	unknown	gnl\|CDD\|236686
CP023022.1\|AXX44042.1\|682872_684174_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	unknown	unknown	gnl\|CDD\|185331
CP023022.1\|AXX44026.1\|671805_671907_+\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|369733
CP023022.1\|AXX44028.1\|672219_672744_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP023022.1\|AXX44037.1\|678380_679589_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|235056

Protein	Function_ID	Function_description	E-value
CP023022.1\|AXX44029.1\|672816_673488_-\|DUF2057-domain-containing-protein	gnl\|CDD\|378258	pfam09829, DUF2057, Uncharacterized protein conserved in bacteria (DUF2057). This domain, found in various prokaryotic proteins, has no known function.	4.46817e-29
CP023022.1\|AXX44039.1\|680204_680528_-\|hypothetical-protein	gnl\|CDD\|273177	TIGR00617, Replication_protein_A_70_kDa_DNA-binding_subunit, replication factor-a protein 1 (rpa1). All proteins in this family for which functions are known are part of a multiprotein complex made up of homologs of RPA1, RPA2 and RPA3 that bind ssDNA and function in the recognition of DNA damage for nucleotide excision repairThis family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair].	0.00742828
CP023022.1\|AXX44025.1\|670646_671792_+\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	3.94189e-149
CP023022.1\|AXX44040.1\|680771_681674_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176162	cd08473, PBP2_CrgA_like_4, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 4. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.44498e-97
CP023022.1\|AXX44038.1\|679816_680158_+\|monothiol-glutaredoxin,-Grx4-family	gnl\|CDD\|188046	TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family. The gene for the member of this glutaredoxin family in E. coli, originally designated ydhD, is now designated grxD. Its protein, Grx4, is a monothiol glutaredoxin similar to Grx5 of yeast, which is involved in iron-sulfur cluster formation. [Energy metabolism, Electron transport].	2.75898e-66
CP023022.1\|AXX44035.1\|677332_677758_+\|DUF2750-domain-containing-protein	gnl\|CDD\|378546	pfam11042, DUF2750, Protein of unknown function (DUF2750). This family is conserved in Proteobacteria. The function is not known.	2.46415e-20
CP023022.1\|AXX44041.1\|681725_682520_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	4.40373e-150
CP023022.1\|AXX44043.1\|684365_684785_+\|heme-degrading-domain-containing-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	2.71548e-31
CP023022.1\|AXX44036.1\|677898_678330_+\|histidine-kinase	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	1.93176e-56
CP023022.1\|AXX44027.1\|671907_672207_+\|cytochrome-bd-biosynthesis-protein	gnl\|CDD\|370577	pfam09600, Cyd_oper_YbgE, Cyd operon protein YbgE (Cyd_oper_YbgE). This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria.	3.65946e-19
CP023022.1\|AXX44030.1\|673713_674310_-\|oxidoreductase	gnl\|CDD\|226090	COG3560, FMR2, Predicted oxidoreductase related to nitroreductase [General function prediction only].	1.21707e-108
CP023022.1\|AXX44031.1\|674498_675605_-\|signal-recognition-particle-docking-protein-FtsY	gnl\|CDD\|236686	PRK10416, PRK10416, signal recognition particle-docking protein FtsY; Provisional.	8.49853e-180
CP023022.1\|AXX44042.1\|682872_684174_+\|branched-chain-amino-acid-transport-system-II-carrier-protein	gnl\|CDD\|185331	PRK15433, PRK15433, branched-chain amino acid transporter carrier protein BrnQ.	2.27982e-171
CP023022.1\|AXX44026.1\|671805_671907_+\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|369733	pfam08173, YbgT_YccB, Membrane bound YbgT-like protein. This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in E. coli. Members have a consensus motif (MWYFXW) which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to Proteobacteria.	2.3152e-06
CP023022.1\|AXX44028.1\|672219_672744_-\|N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.08011e-05
CP023022.1\|AXX44037.1\|678380_679589_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|235056	PRK02627, PRK02627, acetylornithine aminotransferase; Provisional.	0

>CP023022.1|AXX44034.1|676714_676948_+|hypothetical-protein
MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA
>CP023022.1|AXX44033.1|676139_676499_-|hypothetical-protein
MTNTIDGFVFDNPPKEEQIIELAHYHRKLLDEAIFHQEIHLGDYCLAQRKRVFDYARQLDPNQKAWFYQVYDGELRKIADEDELHPADAEEGLSIFAMLLVLVIIAAILYFSVIRSLMG
>CP023022.1|AXX44032.1|675712_676039_-|hypothetical-protein
MLTFKENFLKLKSELKADQCFNLVVIIIIGCIFMLSYLALLRPVNSEQYQRIVQLSRQATYPRTQDMAELIMAQSEIHRAEYLKLMHAYQFEHNHIKQYPALAQEDTQ
>CP023022.1|AXX44031.1|674498_675605_-|signal-recognition-particle-docking-protein-FtsY
MQQQSNMQNKFLIDAEIGDDDVTLPNLPAIDVPIVESPVKQEVKAEEVVEAAPSTEPEQPKSGFFGRMKEGLSKTRRNFTDGMVNILIGGKEIDDELLEEVEEQLLVADIGVDATKTIITNLTERTARGDLIYSHSLYKALQEELVALLAPRVKPLHIDPNKSPYVILMVGVNGVGKTTTIGKLAKRLQGEGKKVMLAAGDTFRAAATEQLQIWGERNDIAVVAQGHGADSASVIFDAFESARAKGIDVLIADTAGRLHNKSNLMEELKKVKRVMQKIDATAPHEIMLVVDAGTGQNAINQVQEFDQAVGLTGITITKLDGTAKGGVLFNIASRTHVPIRFIGVGEKIDDLRPFSAKSFVAALFETEK
>CP023022.1|AXX44030.1|673713_674310_-|oxidoreductase
MSTFLDKIKNRRTIYAIGKNVALDRTKIEETIREAVKHSPSAFNSQSSRVVTLYGESHAKFWNLVREALRKIVPADAFAGTNAKIDSFVAGVGTVLFYEDQAVVKSLQEQFELYADNFPVWSEHSSAIAQFATWTALSELGLGASLQHYNPIVDADAAEAFDVPATWKLRAQLVFGSVEAPAGEKAFISDEDRFKTFN
>CP023022.1|AXX44029.1|672816_673488_-|DUF2057-domain-containing-protein
MTLRLSVAAMGLLLSGSVFSAVTITAPEEIVILAVNGQEVNSGLFRSSKNNYKVDAGETSLSVRYQEYFEHLSGEHDIVKSGVVTIQTPALKDGQTYKLAMVDAPKQFEQAKKYAEQPTVALYNSNNELIVQQTGANNEARPWFASGLLGKVTDFTTKSSKQQPDAVYAVAKPTTTQANAPVATTMPPTGVAQTNDQRLAEIWKKSSKAERQKFMAWLAEQSN
>CP023022.1|AXX44028.1|672219_672744_-|N-acetyltransferase
MIKLNFRLAEFSDIPTLVELINQSYREQQGRSWTTEVEYVKGQRINKEQLKHQLELPNSVLLIGEIDSSKVVTCIGLTFQSNTVEIGTFCTDPHVQNMKIGRCVLEYAEQFALHKVPELDSAIMYVLNVRSELIAYYERRGYIKTGNHEPYPLDANVGLPLIPIKLIEMKKDLK
>CP023022.1|AXX44027.1|671907_672207_+|cytochrome-bd-biosynthesis-protein
MMATAMTASNQRKAQAFAMAISFLLALPLAVILLVHPSLMLDANGHYNHSQLMLVMVGISGGFIYGVGFVPHFWLWKWLFSPWIAWPLMLLGYYIWFLT
>CP023022.1|AXX44026.1|671805_671907_+|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGILMACFAGVLSALYIEHHQNLDEE
>CP023022.1|AXX44025.1|670646_671792_+|cytochrome-d-ubiquinol-oxidase-subunit-II
MIEYELLKIIWWVLVGVLLIGFALTDGFDMGSMALMPFVGKTDNERRAAINTIAPHWDGNQVWFITAGGALFAAWPMVYSVAFSGMYWALLLVLFALFLRPVGFDYRSKLENTQWRNSWDWGLCIGGAVPALVFGVAFGNLFLGIPFSLDSTLRSEYSGSFFALLNPFALVCGIVSLSMLCAHGGAWLMLRTDGALKQRSAKATQIMAAIFLVCFLVIGAWLYFGQVPGYSYAAAVDPNAALNPLAKEVVTNNNPGWMNNYSSYPITKVAPVLAILGAIIAFFTASKAKAGLSFAGTSLMIVGAILTAGFALFPFLLPSSVNPNSSLTMWDAVSSHRTLGVMTVAACIFVPIILIYTSWSYYKMWGVITNKHIESNSHSLY
>CP023022.1|AXX44035.1|677332_677758_+|DUF2750-domain-containing-protein
MWFSYNKQDKLKTFKFKMNSLSNLQPVSKDLMIKIYILRTMMYCGVLWGLFDEGWAIKSDQEDFIFPFWLNGVQAHRYAKTHWPNYKPRKITPKDFHESLLPTLTRLKVTPALFNSSHRKLKLSTQQMHHFFFNHPKWQVA
>CP023022.1|AXX44036.1|677898_678330_+|histidine-kinase
MTIVAQVIKNKSEQAIFTISPEATVLEAITIMAEKGIGALVVAEGEQVVGILSERDYTRKVTLMERSSYSTTVAEIMTAKVITVGLNNTVEECLQLMTDRHLRHLPVLDNGKLVGFISIGDLVKAAMEDQKVLIEQLKQYISG
>CP023022.1|AXX44037.1|678380_679589_-|aspartate-aminotransferase-family-protein
MTDITLAPVQPDQPTHLMATYGRQAISFVRGRGAYLYAQDGTEYLDALTGIAVCGLGHAHPAIAEAIAEQAATLVHTSNLFEIPWQTAAAQKLAEVSGMEEIFFSNSGAESNEGAIKIARKFGTHQGISLPKIIVAEQSFHGRTLATLSATGNKKVQDGFAPLVEGFIRVPFGDIEAIQEAALQHPDIVAILIEPIQGEGGINTAPQGFSYLEEVRQNCNQHNWLMMLDEIQTGNGRTGKYFAYQHTNIIPDVLTTAKGLGNGFPVGAVMTQGKAVGLLGPGSHGSTYGGTVLGSRVVYTVIDTIQKENAVENAAVVGNYIVDQLRAQLSDKNVQVRGFGMMIGIQLPKDCAELVAIARDEYKLIINVTAGSVVRLLPPINMTQAQADILLERLVALITNYL
>CP023022.1|AXX44038.1|679816_680158_+|monothiol-glutaredoxin,-Grx4-family
MTEQARDTEALIRDQIAKHPVLLYMKGTPQFPQCGFSARAVEALSQIGRPFAYVNILENPDIRATLPKIANWPTFPQLWVNGELIGGSDIMLEMFQNGELKPLIEQYSAAPEA
>CP023022.1|AXX44039.1|680204_680528_-|hypothetical-protein
MSYQLVELENATANIICPICKLAVIDWTQEQYVQPCEHTVFIAMDLGFEFVADRFEQVMNQNVDELHEDPNMNIFDAITTTPYKNLTILKADLGVDGLFRYVGISVC
>CP023022.1|AXX44040.1|680771_681674_+|LysR-family-transcriptional-regulator
MLTDLDDFYCFALVVEHGGFSAAERVTDIPKSKLSRRVYNLEENLGVRLIQRSSRHFAVTDIGMDIYRHAQVMMNAAQAAHDLVDHLSIQPRGVVKVSVPVDIAQNQLPKILPAFLKKYPEIRLQLIVSNRRVDVINEGIDIALRVRSKLDDDPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELSDHRILSLSEEHLDQQFILHGPDNQLKKVKVSPTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVEHLSEHP
>CP023022.1|AXX44041.1|681725_682520_-|type-I-methionyl-aminopeptidase
MRASTVTIKTEQDLEKLRVSGRLAAQVLEMIGEYVKPGVTTEYLDNICNDYIVNTLKVIPANVGYHGFTKTICTSVNEVVCHGIPSQNKILKDGDIINIDVAIIKDGYFGDTSRMYYVGNVNPHAKKLVETTYEAMVAGIHVVKPGATLGDIGYAIQSVAHREGYSIVREYCGHGIGKVYHEQPNILHYGQRGQGLVLKKGMVFTIEPMVNAGKPQVKELNDGWTVITQDHSLSAQWEHMVAVTDTGFELLTPWPEGVGNYPEI
>CP023022.1|AXX44042.1|682872_684174_+|branched-chain-amino-acid-transport-system-II-carrier-protein
MQQLRTGDIIALGFMTFALFIGAGNIIFPPIVAQQAGDHVWLAAIGFLITAVGLPVITIMALSRMQGSIEIISSPLGRIASLILTVVCYLSVGPLFATPRTATVSYEIGFSSYFGTSSSSLLIYSAIYFAFVTVVSLYPNKLLDTVGHVLAPLKIIALAILGIAAVMIPAGYVPTPINHYVNSPVSEGFVNGYLTMDTLGALVFGIVIIQAIYSRGVTDNKLVTKYAIIASLISGVGLTLVYLSLFKLGLGSHEVAPNAANGAVILHAYVQHAFGNMGSLFLTGLIFLACMVTAIGLTCACAEYFAQLTKLPYKLLVFILVGFSFIISNLGLTKLIAVSVPVLSAIYPPAIVVIMLSFFWKFWHKPSFIVGSVTSIALIFGIIDGLKVAGFGDYLPNFLQHLPLNEQNLAWLIPSLVVLVVTTLIDKVKHKSI
>CP023022.1|AXX44043.1|684365_684785_+|heme-degrading-domain-containing-protein
MKSKYYLTLADAEFLMEEAQKYAIEHNFKVSIAIVDETSSLLLMKRLDGASPLTTHLCLEKAKCSSMSGRPSKFYEELLQNGRLGFLSMPSAKGMLEGGKAIIYEGQILGAIGVSGVQSFEDAEIAQHAIDVFLKKQCS
>CP023022.1|AXX44044.1|685044_685290_+|hypothetical-protein
MLSLHFNKQVFINTLNSKDSVVYGVTTLALMLTLLFQGMIKGNLKPEYFMYAMVVSFVFCVWAFVDHKMRKLAKRRLSQQK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP023022_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP023022_5

1630058-1630142

Orphan

Consensus_repeat	Method
GCTTGTCTTGCGCCAAAATTAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP023022_5

>merge|CP023022|5|1630058-1630142|CRISPRCasFinder
GCTTGTCTTGCGCCAAAATTAAAAGATTATCAATCTTCTTTACTCTACGCGCAGTTTCACTGCTTGTCTTGCGCCAAAGTTAAAA

>CP023022|5|5|1630058-1630142|CRISPRCasFinder
GCTTGTCTTGCGCCAAAATTAAAA	GATTATCAATCTTCTTTACTCTACGCGCAGTTTCACT
GCTTGTCTTGCGCCAAAGTTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP023022.1\|AXX44876.1\|1638300_1641399_+\|nodulation-protein-NolG	unknown	unknown	gnl\|CDD\|223911
CP023022.1\|AXX44874.1\|1636507_1637107_+\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX44871.1\|1634819_1635356_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
CP023022.1\|AXX44863.1\|1624225_1624801_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379303
CP023022.1\|AXX44862.1\|1621950_1624125_+\|TIGR01666-family-membrane-protein	unknown	unknown	gnl\|CDD\|130727
CP023022.1\|AXX44858.1\|1617264_1618740_-\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
CP023022.1\|AXX44860.1\|1619876_1620581_+\|nitrobenzoate-reductase	unknown	unknown	gnl\|CDD\|380313
CP023022.1\|AXX44861.1\|1620608_1621823_-\|Bcr/CflA-family-drug-resistance-efflux-transporter	unknown	unknown	gnl\|CDD\|340878
CP023022.1\|AXX44875.1\|1637166_1638285_+\|efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
CP023022.1\|AXX46789.1\|1619162_1619366_-\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX44864.1\|1624958_1627505_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99797
CP023022.1\|AXX44872.1\|1635416_1635779_-\|response-regulator	unknown	unknown	gnl\|CDD\|381093
CP023022.1\|AXX44868.1\|1630620_1631529_+\|DUF1853-domain-containing-protein	unknown	unknown	gnl\|CDD\|378094
CP023022.1\|AXX44865.1\|1627631_1628417_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99750
CP023022.1\|AXX44867.1\|1630147_1630516_-\|DUF454-domain-containing-protein	unknown	unknown	gnl\|CDD\|377291
CP023022.1\|AXX44870.1\|1631896_1633033_+\|succinyl-diaminopimelate-desuccinylase	unknown	unknown	gnl\|CDD\|237265
CP023022.1\|AXX44869.1\|1631627_1631771_+\|entericidin,-EcnA/B-family	unknown	unknown	gnl\|CDD\|227797
CP023022.1\|AXX44873.1\|1635802_1636186_-\|response-regulator	unknown	unknown	gnl\|CDD\|381093
CP023022.1\|AXX44866.1\|1629493_1629997_-\|L,D-transpeptidase	unknown	unknown	gnl\|CDD\|341130
CP023022.1\|AXX44859.1\|1618839_1618980_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP023022.1\|AXX44876.1\|1638300_1641399_+\|nodulation-protein-NolG	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
CP023022.1\|AXX44871.1\|1634819_1635356_-\|chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	2.92747e-31
CP023022.1\|AXX44863.1\|1624225_1624801_+\|hypothetical-protein	gnl\|CDD\|379303	pfam13630, SdpI, SdpI/YfhL protein family. This family of proteins includes the SdpI and YfhL proteins from B. subtilis. The SdpI protein is a multipass integral membrane protein that protects toxin-producing cells from being killed. Killing is mediated by the exported toxic protein SdpC an extracellular protein that induces the synthesis of an immunity protein.	0.00838382
CP023022.1\|AXX44862.1\|1621950_1624125_+\|TIGR01666-family-membrane-protein	gnl\|CDD\|130727	TIGR01666, Uncharacterized_protein_HI_1680, TIGR01666 family membrane protein. This model represents a clade of sequences from gamma and beta proteobacteria. These proteins are >700 amino acids long and many have been annotated as putative membrane proteins. The gene from Salmonella has been annotated as a putative efflux transporter. The gene from E. coli has the name yccS. [Cell envelope, Other].	0
CP023022.1\|AXX44858.1\|1617264_1618740_-\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0
CP023022.1\|AXX44868.1\|1630620_1631529_+\|DUF1853-domain-containing-protein	gnl\|CDD\|378094	pfam08907, DUF1853, Domain of unknown function (DUF1853). This family of proteins are functionally uncharacterized.	5.07662e-40
CP023022.1\|AXX44861.1\|1620608_1621823_-\|Bcr/CflA-family-drug-resistance-efflux-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.41627e-94
CP023022.1\|AXX44875.1\|1637166_1638285_+\|efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	4.72226e-47
CP023022.1\|AXX44860.1\|1619876_1620581_+\|nitrobenzoate-reductase	gnl\|CDD\|380313	cd02136, PnbA_NfnB-like, nitroreductase similar to Mycobacterium smegmatis NfnB. Members of this family utilize FMN as a cofactor and catalyze reduction of a variety of nitroaromatic compounds, including nitrofurans, nitrobenzens, nitrophenol, nitrobenzoate and quinones by using either NADH or NADPH as a source of reducing equivalents in an obligatory two-election transfer mechanism. The enzyme is typically a homodimer. Mycobacterium smegmatis nitroreductase NfnB plays a role in resistance to benzothiazinone.	1.03168e-34
CP023022.1\|AXX44864.1\|1624958_1627505_+\|hypothetical-protein	gnl\|CDD\|99797	cd06200, SiR_like1, Cytochrome p450- like alpha subunits of E. coli sulfite reductase (SiR) multimerize with beta subunits to catalyze the NADPH dependent reduction of sulfite to sulfide. Beta subunits have an Fe4S4 cluster and a siroheme, while the alpha subunits (cysJ gene) are of the cytochrome p450 (CyPor) family having FAD and FMN as prosthetic groups and utilizing NADPH. Cypor (including cyt -450 reductase, nitric oxide synthase, and methionine synthase reductase) are ferredoxin reductase (FNR)-like proteins with an additional N-terminal FMN domain and a connecting sub-domain inserted within the flavin binding portion of the FNR-like domain. The connecting domain orients the N-terminal FMN domain with the C-terminal FNR domain. NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases. CYPOR transfers two electrons from NADPH to the heme of cytochrome p450 via FAD and FMN. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues, and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule, which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	4.52302e-132
CP023022.1\|AXX44872.1\|1635416_1635779_-\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	2.79368e-36
CP023022.1\|AXX44865.1\|1627631_1628417_+\|hypothetical-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.40229e-39
CP023022.1\|AXX44867.1\|1630147_1630516_-\|DUF454-domain-containing-protein	gnl\|CDD\|377291	pfam04304, DUF454, Protein of unknown function (DUF454). Predicted membrane protein.	4.46882e-39
CP023022.1\|AXX44870.1\|1631896_1633033_+\|succinyl-diaminopimelate-desuccinylase	gnl\|CDD\|237265	PRK13009, PRK13009, succinyl-diaminopimelate desuccinylase; Reviewed.	0
CP023022.1\|AXX44873.1\|1635802_1636186_-\|response-regulator	gnl\|CDD\|381093	cd17538, REC_D1_PleD-like, first (D1) phosphoacceptor receiver (REC) domain of response regulator PleD and similar domains. PleD contains a REC domain (D1) with the phosphorylatable aspartate, a REC-like adaptor domain (D2), and the enzymatic diguanylate cyclase (DGC) domain, also called the GGDEF domain according to a conserved sequence motif, as its output domain. The GGDEF-containing PleD response regulators are global regulators of cell metabolism in some important human pathogens. This model describes D1 of PleD and similar domains. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	1.27194e-36
CP023022.1\|AXX44866.1\|1629493_1629997_-\|L,D-transpeptidase	gnl\|CDD\|341130	cd16913, YkuD_like, L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.	8.56335e-26
CP023022.1\|AXX44869.1\|1631627_1631771_+\|entericidin,-EcnA/B-family	gnl\|CDD\|227797	COG5510, COG5510, Predicted small secreted protein [Function unknown].	4.44613e-07

>CP023022.1|AXX44866.1|1629493_1629997_-|L,D-transpeptidase
MSQFKLEDADILIDLANQTLSLPKHNKFYVVSTGKNGIGEQENTGKTPRGWHRVAKKFGMQSPKNAVFIARQPTGEVYSSELAAQFPERDWILSRILWLDGLEEGFNKGEGHDTMQRYIYIHGTPDKEPMGVPMSHGCIRMRNEEIIELFDLVSEDALVYLSEQSLT
>CP023022.1|AXX44865.1|1627631_1628417_+|hypothetical-protein
MQVSKWIRIFLAVIGSILFLDGLFLAFLNKIHVGTLVPLVLGAFFCLYALFYYHLERFFFYHYRLHTLWRFGWLCFWIWLIGLGYFFNFIKENKDASQNLPAVKAIIVLGSGVENGQPSAILAKRLDTAAPVALSQPQAKVILTGGLDFSEKEPEALVMSRYLEQHFHIAKDRMILEDKSTSTELNLKNSKPLLEQAHISINQPIAIVTSDFHTPRAAAIAKKQGYTQVYMVAAETPLITRYNVWLREYFAYASGWLLNEY
>CP023022.1|AXX44864.1|1624958_1627505_+|hypothetical-protein
MFKKFLFQIHWFLGISAGLILSIMGVTGAIYSYDQQILKWVNTDSYVVQAQSSPKLTPAQLYQHFTTIQPEIKINSITIAKDPTASSVVNIEKEGERRGYNMMVNPYTAQVLPEVQGRKLLLLIQQIHRNLTAGEFGKQITGACALMLIYFVLSGLYLRWPKKHSARQWLALKPKLKGRNFIWDLHAVVGTWVIVFYLLFACTGLYWSYDWWRSGMFKVLGVEQPKMQGHSGSGRNKDQLPKIQLDNAQLITALNQTWSGFNNQIGRDYSTLTVNLPKKDDGKIELSFVDATPQHERARNQAVYNYKTANIEKMELYEDKKLNQKIMSSMLPVHRGSFFGPVYQFVAMLASLAMPLFFVTGWMLYLKRRKQKKLTQAARQSLAGHYIDQNAKPWLITYATQTGVAEQLAWSTATSLQEAHQPVQVKSVQQLTEADLQQHEQILFVISTYGTGEAPDLASNFAKKLLKTNLELQHVKYAVLALGSKEYPDTYCSFGYTVDEWLKNNGAKALFDIIEVDNANPADIQNWNQALVKATKLDLHAVNIEKVFDNWTLQQRDLLNPNSLGQPAYNIELTASHEAVWQAGDIAEIQPGNSPERINKFLQHHHILKNAVVDSLQVSIEKALWNKDLTGEIEPFANLDHLLEQLPTLPTREYSIASIPSQQVLRLVVRQQYDESGDLGLGSGWLTQHTEINQNVALRIRTNESFHLIDDNRPIICIGNGTGIAGLMSLLHTRTRHNYTENWLIFGERQRAHDFFYASTIEAWQTMGMLKRLDLAFSRDQEQRVYVQDIIRQNAAELVNWIERGAVLYVCGSIDGMASGVDQALIHILGEEQVDELRQQGRYRRDVY
>CP023022.1|AXX44863.1|1624225_1624801_+|hypothetical-protein
MTAKTLYAYTLQPVPYEVSEAEQRNAQLLIWRSTNKISTKIWAIMGVILALAILGLIFIKNYSTVICWVAIVCVVLYYLGRKYGLEWYVKRKMNEFPVQEIKGIRLGVQPHGIVMRQQMGLQEGVGTIGWKNIYEWYNTPDFILVNFKVKDPKGQEQQGAYILPKRMDSKNFSFNTIRKHLKESVGEPKTL
>CP023022.1|AXX44862.1|1621950_1624125_+|TIGR01666-family-membrane-protein
MKSWFKRLKRATYNTSFMYNVRMLIAFSGTAFVPYFLGHQLATIPLTLGVVAAGLSDIDDRFSVRIMNLIYTYIGFFITAASVQLLFPYPMLFALGLIASCIGWILLGSLGRRYATISYGCLVVSVYTMLGVHLFDQWYIQPALLVAGAAWYGLIATISFLLFPVRQLQDKLAASYASLGDFLFAKSNLFDVDMTPASYQQSMIDLSLENGKLITIFNDLKTALLTRLKGDRGQKGTRRSLHYYFVAQDIHERADSAHIDYQKLAKIFQHSDILFRFQRILAIQGKACQELNECILQRKPYIHNKRFKQSFENLRLSLVKLRDDQQYDLLWVNALFALYRNLKSIDSQLLNLETEQHIQSDKVKQAENQLKDDDLKGWNDIVVRIKQNLTPESVLFRHAIRVSIVLFIGYVFIQMTHIEYGYWIMLTALFVSQPNFNATKRRLRLRIVGTLVGIIVGLSIVFLVPSVEGQLVMLILSGVLFFELRSKQYAQATAFITILALINFNLDGSAVAAAIPRFVDTLIGCALAWFGVTFIWPDWKFRRLPRSIRRSLQAQCNYLAEVVKQYHEGHNHALNYRIVRRAAHNTDAEVASLISTLATEPDFDPTRKSDIFEFLCLNHTFLSYIAALGAHREKIQDQAVLNVLDQALDDIQGALLRDEMPDLTAQNMLQTIRQRLSQNDEDDQKSLIILQQLSLMLSVLNRFSMLKQRLSHDLDNDASELASL
>CP023022.1|AXX44861.1|1620608_1621823_-|Bcr/CflA-family-drug-resistance-efflux-transporter
MSEQTAQRQYSIGWIMLLALLTALGPLSIDMYLPALPQMAHDFGVSTQMVANTLPAYFFGLAIGQLVYGPLSDRIGRKKPLYFGLALYAVASLFCVLATNEWSLIAARILQALGGCVGVVMARAAIRDRLDVQGSAQAFSSMMIVMGLAPILAPMIGAWILIWFPWQAIFIALSIVGAICWLCVHFFFKETLAVDKRLKLSLYQVATLYGAIFKDASFRLPMFAGCLTGAALFCYISSAPAVFMDQYGLNQQEFAYVFGLNAFGIMLMSSLNKHLTTRVEITKRLKAGSMVQVTGASIVLIAGLISAAPLWLVMLGLFLAISGIGLTGPNAMALAMSKQGARAGTASAIMGSMQFACGLLGGVLLNFLIWSASLNMGVMMVLFTLSGFIVVLKAIRQAKSQSLS
>CP023022.1|AXX44860.1|1619876_1620581_+|nitrobenzoate-reductase
MNLEQVRLVDEAITSRHSVRAFLSTPIEPEVIKDILRVASRAPSGTNTQPWKVYVVTGHKRDEMVERVCAAQIEVSKNPELAEQYKETFAYYPEKWVSPFIDRRRENGWGLYGLLDIKKGEKEKMAAQQLRNFKLFDAPVGIFFTVNKAMGIGSKMDIAMMIQNVMVAAKARGLDTCPQAAWNHFHPLVLDILGAADDEELVCAIALGHADPEHIVNTFITPREPVENFAVFLD
>CP023022.1|AXX46789.1|1619162_1619366_-|hypothetical-protein
MSLPLINKQFMKQGLAITIATMKMNVTHATTEPQEIQQLGTDLNALFFNEKEKGTDSRVMTMACYSL
>CP023022.1|AXX44859.1|1618839_1618980_-|hypothetical-protein
MFSGAMNLFYLKGAFSHVTFKGLVLGMMLLKLVTVIAIQVTLKVFP
>CP023022.1|AXX44858.1|1617264_1618740_-|alanine:cation-symporter-family-protein
MNEQLNATLMSWVQFFNEPLWDFLVIFLLAVGIFYTVLTGAVQIRMFLQSIRVMKSSRTEGEDEHGLTPFQAFVTGLASRVGVGNIAGVAIAIAIGGPGAVFWMWVTAVLGMSSAFIESTLAQLFKVRDSNSKQFRGGPAYYITQGLRSKTFGVIFALALIFTYGFVFNSVQINAIANASSHAWGWDKANLIAHLGGVDLEISWVGLALVVMVALAIFGGIKRIAKFAEMFVPLKAGLYLSVALYIALSNYAILPDVLKLIVTEAFHFNAAAGGFFGAAVSMAMMQGIKRGLFSNEAGMGSAPNAAAASDVKHPVNQGLVQMLGVFVDTFIVCTSTAIIILVSGVYQDAGFVGVELTQRALETQVGHWGADFLAVLLFLFCYSAVLGNYAYAESNVQFINNNPKVMFIFRIFVLVMVYFGAIGSVPLVWSMADLFMGIMATINLVAILLLTPMARTLLKDYRAQLKQGIKEPVFKINKYPELKKKVDSDIW
>CP023022.1|AXX44867.1|1630147_1630516_-|DUF454-domain-containing-protein
MRTLFWRTLVVIFITLGIIGAILPGMPTTVFLILAAWAASKGWPQMDAWLLNHPKYGPTLRDWRANGTVPRKAKWIATIMMTASGILMLFTSAPFWVKVFTDTTMLVVAIWLWLRPEPKLKD
>CP023022.1|AXX44868.1|1630620_1631529_+|DUF1853-domain-containing-protein
MNIASIKTSYFEPWLQFSHPMVRQLAFTIASPNLLSQLPCSLTIRHSFQLHTDKNWEQHFQNYLPRLKQLDEAPEPLLQFMSRLKSTRLGLRFENLLWFWLQEDQYHPYQLLGHSIQKIDGAKTLGELDFLVLNQNTQEIEHWEVALKYYLGEGQLNLEQWSGLNRQDTLSKKLYHFTDKQFQFSEALGFKVQQRFAVLKGQLYLPLNLPQEQPIPEWVNLKRRLGTWGTEIPKSDFYRLERHEWLCPHQKASSNTAYWWTDGLYCQNINETRFYMFRHPALLSLKPSLIKNNGVLQETTSL
>CP023022.1|AXX44869.1|1631627_1631771_+|entericidin,-EcnA/B-family
MMKKVLVASVMVAFVLTGCNTFKGFGQDVSKAGDAVTNTAQKTENKM
>CP023022.1|AXX44870.1|1631896_1633033_+|succinyl-diaminopimelate-desuccinylase
MNHSDTLSLSLELLQQPSVTPIDHTCQTIMADRLAKVGFHIEPMRFGDVDNLWARRGTEGPVFCFAGHTDVVPTGRLDAWNSDPFAPEIRDGKLYGRGSADMKTALAAMVVASERFVAKHPNHKGSIAFLITSDEEGPAVNGTVKVIETLEKRNEKITWCLVGEPSSTHKLGDIVKNGRRGSLNAVLKVQGKQGHVAYPHLARNPIHEASPALAELCQTVWDNGNEYFPATSFQISNIHAGTGATNVIPGALEVTFNFRYSTEVTAEQLKQRVHEILDKHGLQYEIVWNLSGLPFLTPVGELVNAAQTAILNVTGTETELSTSGGTSDGRFIAPTGAQVLELGVLNATIHQINEHVDVHDLDPLTDIYEQILENLLAQ
>CP023022.1|AXX44871.1|1634819_1635356_-|chemotaxis-protein-CheW
MAANGFIELLRLSKRGNKNYASVQNEAQRWSGIAFEMRGQYFVAPLGEVSEVIYPPKYTPVPNTQSWVKGLANIRGRLLSVSDLAHFISGQRSSFSSTQKVLCISHHDQYVGLVVDQVLGIQHFNKKSFFSQSSDLEENLKEYCQGYFHQHNQHWHVFLFSRLLQNPHYMNASTKFIN
>CP023022.1|AXX44872.1|1635416_1635779_-|response-regulator
MARILIVDDSPTETFRFKEILTKHGYDVLEASNGADGVTLAKAEQPDLVLMDVVMPGVNGFQATRQITRDEDTKHIPVVIVSTKDQATDRVWGKRQGAIDYLIKPIEEKQLIDVIKQFLN
>CP023022.1|AXX44873.1|1635802_1636186_-|response-regulator
MEDAFQNLKVMVIDDSKTIRRTAETLLQREGCEVITAVDGFEALSKIAEANPDIVFVDIMMPRLDGYQTCALIKNSQNYQNIPVIMLSSKDGLFDQAKGRVVGSDEYLTKPFSKDELLNAIRNHVSS
>CP023022.1|AXX44874.1|1636507_1637107_+|hypothetical-protein
MSVSIGIASCGALFFSSPTLAANAAPKAVWYRYYDQHGIANISTSVTPAHIRYGYEALDQNMQVIKRNHPYNSEADLNQSSQRALSARYREEDNKLKRAYSNSKTATIKRDQALLAIKKQINYQQDQLSQLQQDKILFKRQEMEYFRKGEQVPERHKTLIENNLMNINKVKQTLEILSKTYNRTNKDYENIIERLKKLE
>CP023022.1|AXX44875.1|1637166_1638285_+|efflux-transporter-periplasmic-adaptor-subunit
MRTTHLTPSTFFKLSLISLSLILAACNQQEVPKTTASEPKKIELIPQDLIPVKEGSLAAQTAFTATIRAVQQSSIQAQVSATATAVTANVGQKVQKGQVLVRLNNQDNAARLAQAQANLASAQAQAELARNLMNRKQRLLNQGFIARVEFEQSQVDYKGQLESVRAQQANVDIAKKADRDGIITSPISGVITKRQVEPGQTVSVGQTLFEIVNPDQLEIQAKLPIEQQSALKVGSSIQYQIQGNSKQLHAILTRISPVADQDSRQIEFFASPKEAIDSLSIGAFINGIILHNDSNQGQTIPLDSIQNLQHDPFVWVIRNQTIQKVKIRVVEQRYNENIALVQGLQSTDQVSRIQFEDSDINKKVTLTTEKNK
>CP023022.1|AXX44876.1|1638300_1641399_+|nodulation-protein-NolG
MWFTRISVKYPVFTIMMMLSLMVLGLASWKRMTVEEFPNIDFPFVVVTTQYAGASPEAVESDITKKLEDQINTISGIKQITSRSSEGLSMVIAEFNLDTSSAIAAQDVRDKIAPVIAQFRDEIDTPIVQRYDPSSSPIMSVVFESNSMSLAQLSSYVDKKIVPQLKTVSGVGNVNLLGDAKRQIRIKVHPEQLQSYGIGIDQVINTLKNENIEVPAGTLQQKNSELVVQIQSKVIHPLGFGDLVIANKNGSPIFLKQVATVEDTQAELQSSAFYNGRTAVSVDILKSSDANVIQVVDKTYQTLEKLKAQMPASLNYKVVADSSKGIRASIKDVVRTIIEGAVLAVLIVLLFLGSFRSTVITGLTLPITLLGTLTFIWAFGFSINMMTLLALSLSIGLLIDDAIVVRENIVRHTELGKDHVTAALDGTKEIGLAVLATTLTIVAVFLPVAFMGGLIGRFFYQFGVTVSTAVLISMFISFTLDPMLSAHWKDPIKKKESRLQRFFNYISNLLDGLTHNYEKLLKLALRFRFITVIIAIVSLVVALGLSKMIGTEFVPTPDKGEIRIQFETPVDSSLEYTQAKLHQVDQIIRQFPDVVSTYGVVNSEVDSGKNHAGLGVTLKPKQERSADLTTLNNEFRDRLQSVAGIRVTSVAAAQDSVSGGQKPIMISIKGSDLNELQKISDRFMAEMEKIDGVVDLESSLKEPKPTLGVHINRVLASDLGLSVSQIANAIRPLIAGENVTTWEDRDGETYDVNIRLNENKRVLPQDVQNLYLNSNKTNANGQNILVPLSAVATTQEKLGASQINRRDLEREVLIEANTSGRPSGDIGQDIDKMQKAFKLPAGYTFDTQGTNADMAESAGYALTAITISIVFIYIVLGSQFNSFIHPAAIMASLPLSLIGVFLALFLFRSTLNLFSIIGIIMLMGLVTKNAILLIDFIKKAMEDGISRYDAILQAGKTRLRPILMTTSAMVMGMVPLALGLGEGGEQSAPMAHAVIGGVITSTLLTLVVVPVIFTYLDDLKNFMLRQTRRFMS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP023022_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP023022_6

3020684-3020784

Orphan

Consensus_repeat	Method
AAAACGACAATTGAAACTTCCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP023022_6

>merge|CP023022|6|3020684-3020784|CRISPRCasFinder
AAAACGACAATTGAAACTTCCTTGGTGGTACATATAAATCAATGACTTAGAATTTGGTGCGACAATTGAAATGTGCATAAAACGACAATTGAAACTTCCTT

>CP023022|6|6|3020684-3020784|CRISPRCasFinder
AAAACGACAATTGAAACTTCCTT	GGTGGTACATATAAATCAATGACTTAGAATTTGGTGCGACAATTGAAATGTGCAT
AAAACGACAATTGAAACTTCCTT

Protein	Signature genes	Signature genes Name	Protein_function
CP023022.1\|AXX46088.1\|3020836_3023026_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277367
CP023022.1\|AXX46086.1\|3015381_3015873_+\|flavin-reductase	unknown	unknown	gnl\|CDD\|132654
CP023022.1\|AXX46091.1\|3025853_3026561_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378037
CP023022.1\|AXX46089.1\|3023042_3023990_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377533
CP023022.1\|AXX46097.1\|3030571_3030775_+\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX46081.1\|3008690_3009698_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
CP023022.1\|AXX46087.1\|3016454_3017114_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP023022.1\|AXX46085.1\|3014152_3015196_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-methyltransferase	unknown	unknown	gnl\|CDD\|181659
CP023022.1\|AXX46080.1\|3005847_3007233_+\|long-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224978
CP023022.1\|AXX46082.1\|3011040_3011649_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
CP023022.1\|AXX46096.1\|3029769_3030585_+\|2,4-dihydroxyhept-2-ene-1,7-dioic-acid-aldolase	unknown	unknown	gnl\|CDD\|131364
CP023022.1\|AXX46854.1\|3009913_3010939_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP023022.1\|AXX46083.1\|3011904_3012777_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
CP023022.1\|AXX46092.1\|3026741_3026933_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|274987
CP023022.1\|AXX46090.1\|3023979_3025854_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366234
CP023022.1\|AXX46095.1\|3028170_3029343_-\|hypothetical-protein	unknown	unknown	unknown
CP023022.1\|AXX46094.1\|3027417_3028158_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
CP023022.1\|AXX46093.1\|3027178_3027364_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
CP023022.1\|AXX46079.1\|3004618_3005548_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176124
CP023022.1\|AXX46084.1\|3013144_3014131_+\|DUF1852-domain-containing-protein	unknown	unknown	gnl\|CDD\|370181

Protein	Function_ID	Function_description	E-value
CP023022.1\|AXX46088.1\|3020836_3023026_-\|hypothetical-protein	gnl\|CDD\|277367	cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain. PrpA and PrpB are bacterial type I serine/threonine and tyrosine phosphatases thought to modulate the expression of proteins that protect the cell upon accumulation of misfolded proteins in the periplasm. The PPP (phosphoprotein phosphatase) family, to which PrpA and PrpB belong, is one of two known protein phosphatase families specific for serine and threonine. This family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.12716e-12
CP023022.1\|AXX46086.1\|3015381_3015873_+\|flavin-reductase	gnl\|CDD\|132654	TIGR03615, flavoprotein_oxidoreductase, pyrimidine utilization flavin reductase protein F. This protein is observed in operons extremely similar to that characterized in E. coli K-12 responsible for the import and catabolism of pyrimidines, primarily uracil. This protein is a member of the flavin reductase family defined by pfam01613. Presumably, this protein recycles the flavin of the RutA luciferase-like oxidoreductase.	6.9458e-70
CP023022.1\|AXX46091.1\|3025853_3026561_-\|hypothetical-protein	gnl\|CDD\|378037	pfam08722, Tn7_Tnp_TnsA_N, TnsA endonuclease N terminal. The Tn7 transposase is composed of proteins TnsA and TnsB. DNA breakage at the 5' end of the transposon is carried out by TnsA, and breakage and joining at the 3' end is carried out by TnsB. The N terminal domain of TnsA is catalytic.	0.00126197
CP023022.1\|AXX46089.1\|3023042_3023990_-\|hypothetical-protein	gnl\|CDD\|377533	pfam05621, TniB, Bacterial TniB protein. This family consists of several bacterial TniB NTP-binding proteins. TniB is a probable ATP-binding protein which is involved in Tn5053 mercury resistance transposition.	5.69225e-10
CP023022.1\|AXX46081.1\|3008690_3009698_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	1.37892e-35
CP023022.1\|AXX46087.1\|3016454_3017114_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.8056e-10
CP023022.1\|AXX46085.1\|3014152_3015196_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-methyltransferase	gnl\|CDD\|181659	PRK09121, PRK09121, methionine synthase.	0
CP023022.1\|AXX46080.1\|3005847_3007233_+\|long-chain-fatty-acid-transporter	gnl\|CDD\|224978	COG2067, FadL, Long-chain fatty acid transport protein [Lipid metabolism].	3.06102e-18
CP023022.1\|AXX46082.1\|3011040_3011649_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.52492e-28
CP023022.1\|AXX46096.1\|3029769_3030585_+\|2,4-dihydroxyhept-2-ene-1,7-dioic-acid-aldolase	gnl\|CDD\|131364	TIGR02311, 24-dihydroxyhept-2-ene-17-dioic_acid_aldolase, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase. This model represents the aldolase which performs the final step unique to the 4-hydroxyphenylacetic acid catabolism pathway in which 2,4-dihydroxyhept-2-ene-1,7-dioic acid is split into pyruvate and succinate-semialdehyde. The gene for enzyme is generally found adjacent to other genes for this pathway organized into an operon.	5.21323e-138
CP023022.1\|AXX46854.1\|3009913_3010939_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.59913e-08
CP023022.1\|AXX46083.1\|3011904_3012777_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	2.91381e-42
CP023022.1\|AXX46092.1\|3026741_3026933_-\|DNA-binding-protein	gnl\|CDD\|274987	TIGR04111, conserved_hypothetical_protein, phage-associated protein, BcepMu gp16 family. Members of this protein family occur in Burkholderia phage BcepMu, Pseudomonas phage B3, and Burkholderia phage KS10, and many bacterial putative prophage regions. The member from Burkholderia phage BcepMu is named gp16. Homology suggests DNA-binding activity. [Mobile and extrachromosomal element functions, Prophage functions].	1.72957e-23
CP023022.1\|AXX46090.1\|3023979_3025854_-\|hypothetical-protein	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.49804e-06
CP023022.1\|AXX46094.1\|3027417_3028158_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	3.22601e-75
CP023022.1\|AXX46093.1\|3027178_3027364_-\|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	3.7211e-09
CP023022.1\|AXX46079.1\|3004618_3005548_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176124	cd08433, PBP2_Nac, The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold. The NAC is a LysR-type transcription regulator that activates expression of operons such as hut (histidine utilization) and ure (urea utilization), allowing use of non-preferred (poor) nitrogen sources, and represses expression of operons, such as glutamate dehydrogenase (gdh), allowing assimilation of the preferred nitrogen source. The expression of the nac gene is fully dependent on the nitrogen regulatory system (NTR) and the sigma54-containing RNA polymerase (sigma54-RNAP). In response to nitrogen starvation, NTR system activates the expression of nac, and NAC activates the expression of hut, ure, and put (proline utilization). NAC is not involved in the transcription of Sigma70-RNAP operons such as glnA, which directly respond by the NTR system, but activates the transcription of sigma70-RNAP dependent operons such as hut. Hence, NAC allows the coupling of sigma70-RNAP dependent operons to the sigma54-RNAP dependent NTR system. This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.72883e-43
CP023022.1\|AXX46084.1\|3013144_3014131_+\|DUF1852-domain-containing-protein	gnl\|CDD\|370181	pfam08908, DUF1852, Domain of unknown function (DUF1852). This family of proteins are functionally uncharacterized.	0

>CP023022.1|AXX46087.1|3016454_3017114_+|TetR/AcrR-family-transcriptional-regulator
MPSTVLRLCCAFFSPRKGTGFLSHLETTRIYNGKMMPTLEISSKKLQVVQTAIQLFTTHGFHNAGVDLIIKKSKIQKATFYNYFHSKERLVEMCLIFQKSRLKEEVLAIVYSHRYPAAADKLKEIVRLHVDVNSLYHLLFKAIFELKLLYPRAYRMAVEYRKWLLKEIFDLVFSLETNKLKPDANMVLNLIDGLMLQVLSSNCLDERDVVLERFWGKAI
>CP023022.1|AXX46086.1|3015381_3015873_+|flavin-reductase
MVQATDFRNAMSLLTSAVSVVTTAGMSGRFGFTASAVCSVTDTPPTLLVCMNQSASSHAHFLDNKILTVNVLGAHHEHISKAFSSKLTPEERFKHGAWIELETGSPVLDDALVSFDCEIEQIQQVGTHTIFICPIVAIKQSQHDQSLVYFNRAYHQVGQTEIV
>CP023022.1|AXX46085.1|3014152_3015196_+|5-methyltetrahydropteroyltriglutamate---homocysteine-methyltransferase
MKKLLPTSTAGSLPKPSWLAEPEKLWSPWKLENEGLVEGKKDALRLALHEQQLAGIDIVSDGEQTRQHFVTTFIEHLNGVDFEKRETVRIRDRYDASVPSVVGAVSRQKPVFVEDAKFLRQQTNQPIKWALPGPMTMIDTLYDGHYKSREKLAWEFAKILNQEARELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGIKANTDWKKTLGSEWRQYEEAFPKLQTSNIDIISLECHNSHVPIDLLELIRGKKVMVGAIDVASNQIETPEEVANTLRKALQFVDSDKLYPCTNCGMAPLSREVARGKLNALSAGAEIVRRELTGYDLTA
>CP023022.1|AXX46084.1|3013144_3014131_+|DUF1852-domain-containing-protein
MSKEFTFTIKSICFDENYRPADNTRITTNFANLARGMSREENLRNTLQMIDNRFNALAHWDNPKGDRYGVELEIISVEMNIDAENRTSGLPLIEILKTNIVDKKTNERIEGIVGNNFSSYVRDYDFSVLLLDHNKNKSTFSTPEKFGELHGNLFKSFINSETYKANFKKAPVICLSVSTTKEYHRTENEHPVLGVEYKQEDYSLTDEYFQKMGLKVRYFMPPNSVAPLAFYFTGDLLSDYTNLELISTISTMETFQKIYRPEIYNANSVAGKSYQPSLKHEDYSLTRIVYDREERSRLAIEQGKFVEEQFIKPYQAILEQWSANYAPN
>CP023022.1|AXX46083.1|3011904_3012777_+|LysR-family-transcriptional-regulator
MIERISLNSLKFFYFVAKYGSVTLAAKKLFVTQSAVSKQIYNLEEALNTTLFDRKNKTLVMTEQGEILLSCCHQVFGQLDECLIELSQPKTHNKQLVLSCEPTLSMKWLIPRLSKFKKLGHDFEVVLLTAGGVVDFEKDNIDIAIRRNDFDWGEHIYSEKIADEYIALVQATKPSETNDLLISTSRPNFFKSTSRIAELKQRLKGYTKVELEHFYLCLEGCLAGLGATVISIYMIEKELEWNLLKKISPAVQDNSAYFLLSHGAFEEDSRKTIFLEWLKTEMNESQQTLL
>CP023022.1|AXX46082.1|3011040_3011649_-|LysE-family-translocator
MAEFIAVILITILAVVSPGADFAIVTKNSYLYGRKIGVFTSLGISLGVLVHVTYTLVAVAFVMTYTPQILNIVKYIGALYLIYIGYKTFTQKPVLDTAALTSLGTLQAIKYGFFTNALNPKTTLFVISTYTQIVSLTTPKSILLVYGFFMSFAHFIWFSLVAVLFSSMLLRQKMLAKQVQINRVIGSILCVLGVILLFTKFQ
>CP023022.1|AXX46854.1|3009913_3010939_+|fatty-acid-desaturase
MTDSEKTEHIKKVVTAEGVALRKRHPILNHQNAIGAMILFISLVGMIATAVLYINHQLSAWFAIPIIAFFASLTHELEHDLIHWMYFRKKPWAHHLMMSLVWLARPSTINPWKRRELHFNHHKNSGTEVDLEERALTNGEQWSIRRLIAIGDNGLAVLFRIISASNWTVKKVIFKRAFMVYFPLGIIHWSLWYIFLGFHVVDVVAGWANAPIAWSATTLNIMHVVNILTVVWVAPNVLRTFCLHFVTSNMHYYGDVELGNVIQQTQVLTPWWMMPFQLFCFNFGSTHAIHHFVVKEPFYIRQMTAPVAHKVMRDMGVRFNDVGTFKRANRWNLNDLSESKS
>CP023022.1|AXX46081.1|3008690_3009698_-|AraC-family-transcriptional-regulator
MPQTATALASWVKAIQKALEKAGVDSQPLLEQAGLEIQALSNPDARYSLKQTANLWKLAVQKTQDSCFGLNVASQVNQNTFHVLGHSLITSTTLKEMFLRIIRYFRVVTDIPELEFYGQGNNHYFVIHVPDEVQPESIDAFISVFIRSSRALQGSVFSPLRIELRRSEPDDLETFQSILKAPIVFNAPKDMIVFDTATIEQPLEGANPTLTQEYDEIINRYLARFDKENILARVKVKLIEKLSTGDFQQQDVAKSLGLSIRSLQRKLSAENTSYSELLDQTRHELALSYIKNSSHNITEIAYILGFTDVSSFTRAFRRWTDLSPIHYREKYLACS
>CP023022.1|AXX46080.1|3005847_3007233_+|long-chain-fatty-acid-transporter
MNFVVNKKIFILGIASICTSTLHAAAFDKTGQSVAAFLQPGNYFEASLGITDADLSGVESGTNPSHHSISDIANTDYRPTAALKLQLAPQYSFGLLYDQPFGADTEYSGVNGFVATPKDTVMLPGITTTGLASATLGHAPTGNAKSEFDIQNLSFILGYQPTKNWNLYAGPVYQTFKSQVELRGNVFSLYNGYDFHTKTVSDLGWLAGLAYQIPEKAVKVSLTYRSAITHKVNATENAPLIDMLSTQQGRDLVNQHLDFMISIGQMTPQKKAYLNQIIANLPEQEDTGTTKFKSPDSVNLEFQTGLRQGTSLFGSLRWVNWSDLALQPYRFGEISKVVGVLSTPSRPEGFNLVRYYDDQWSLNLGLGQRFSPKWLGSVSVGWDSGAGDKVSTGGPTKGYYNLGVGAQYSPTSRYFISGGVKYYWLGDAKAQLGAQAGSDYYVGEFKDNHSVSYGLKIGYKF
>CP023022.1|AXX46079.1|3004618_3005548_-|LysR-family-transcriptional-regulator
MEIKQIKYFLTVVESGSIGKAAQKLDVGASAISQQISKLEQELSIRLLQRNAFGVTPTPAGLAFLKHSQLILRQVNFAIDAAHSARLSGHVSLGFPPTITALIGIPLMKLMSERYPDIRLEIVETLSGNLIQSINSRQLDIAIIFTNEIDKQWSIQPLVREQMYLMARKEVLEKYGLSECIKSGIIQSQQIGDIPLVLPRQRHSLRKLLEHKIGQLNVVYEIDGLHLLMDSLIHLDLASVRPGSACLQEYKHKLQLLKVVDPEVERINYLVSLAEEELSPAALAAKSAIKACVKELIQNQIWPCSEIIL
>CP023022.1|AXX46088.1|3020836_3023026_-|hypothetical-protein
MSLIYIPIPNEDESAASLILRATEKNGYRTSTSFIYAYNLKVHTKSLNAFFANREKFRVLLNHLELDPEYEKLAPLSVGPTKRHLKELSNKLFPENFLNADATKLCPICIAEKLYLRKIWLFKHLTVCIKHKTKLISECPNCGTLMTANRRAVHLCYHCEYDFREQKSNELINSAELKANEWFISCLEAKSLVKLNEINRLFNTINLTRILYSNIQIYLPDIVIAYYYFNNRIEYQNSILKIAQDNINITHPRLLLIYFIAFEKKNSESLYKILSGLLNIDCAKDTIEYFFSKRFACIALNISASTLHRNYLPDLSSSSKISSKIIEDILTGKKKKINPIEIEHDKYCDIKQLSKLLAINYDLANKLFYHSNIFQVESIKLGSKTIKAIKLKDFLKFDKNYILASCFAESLGINPAIIYKRLKFLNILPAHGPEENEIPINIYLRKDLENITKEQILDITTYERRTENKSFMKFQLQLEIQYICDRLKINKMQFNKLVKCGLIEKWDYKEHKCFFNRNKVNNIFKITNSNDHLTIDEARDVLQVSKNWFFKYWVLTSFIEVIDLCLWRLVPKQQVEEVLKIKEKYFTGVEASKFLGMQNSHVTNLASQEIITPIYLGKGPKIRLFKELKTFSKKIGFVHADIDCNDWELFKKDVEQGNYQISGLQSCYQKALWGRDRIRNYCEDHETVRNIDEVYLGHTIVKAPIQLDNCFYIDIGSFWSKDLFIKKLT
>CP023022.1|AXX46089.1|3023042_3023990_-|hypothetical-protein
MKSDLYEKLAKLDNCIIQHNQYRNAVAGILDCWQRTIASPYKATSCMLIAEGGLGKTTICKKVLQNFSSSLVEYSDYSIRKNPAFYIQIPSGSTIDSLTTLMLHKLNDINPSSGTRSDRAFRLKTKLSESCTELIIFDEFHHIYSTHSSKMKFSKSNENIANWIKTLSDENKICICLVSLPHYVEIFERDSQQSRRFKNKYFIHPLSIKINSKNVHMKPFLTEVDGFIHKKLRLSSLKLSDDSMVLRIYIATAGYHDYVMSLVKEAIKFALEEGNNTLKIEHFSMAWEMDITAYVRLCERNPFEMQIKELNNFMN
>CP023022.1|AXX46090.1|3023979_3025854_-|hypothetical-protein
MDNLFISPTIGMRFIYKNREYEVTFLLIDKFRVTAAHGGVNSYWSIDKINTLYNKGDIKIIYENNSILTNPKDINTIKRRLSYVHESLKKGSRCQAKENLERTIKIISKKINDPSPPCTRTLSKWIKAYRSDSYDIKCLIDNRKGNSTKRKPIYIIEALYHVLKNENNAALINTAKDLESYIYEQLDEKNIIHHEDDHYSSRSIQRYMKKFSDPFLQKLRKNGNRYAQLYVRASAMSQISDGLLHVVEIDSHKLDIIVLENGSLEVMGRAWITLAIDRFSRVIVGFYISYLPPSAFSSLQRLKDMITRPAKHEMGGIPATIIPDNGSENINNSFFRLCSSLNITILPAQFKTGNNKPFVENFFKNMTNSLIKKISGTTLSDPDEREEYDSKKYASVTLEQLKNYIPNWINIYHRELHRGINRVPKALWNQEAKKYTPKGITHDEADILCRTLYLRDINNGRVLFEYIYYYSHALKTHELKGVKQAQILVDESDLSYVYVLINNNICIKAESTQKEYTDCLSLSEHKAVREIKNKLKLNDLEEYPEKNNIYARIKLRQLIQSDIELNKSSKKKRNLAKLIKESNIQFNHEEKINIKDSSLKNNEVISFGDFERFGYEELELDHEI
>CP023022.1|AXX46091.1|3025853_3026561_-|hypothetical-protein
MGFKPNVRRNIKIEKNLFEQIKCAFHSPPSLSNQLVGIRNIYHGSFGKRTAILPSIKNNGAISLESQLELGHAIELERLSSIYAYRTQAIKIELGNNSHAFPDFLIWNNLKQYELHEIKECLEYLSDEQIEKFNQIKKYLKRLDIEYKLFDHRHIPTQRQRQRLLAMYQSIRTHQLSDERIELAKEIPFPKHMSLEYLYSYFENYNYSYEDLNYLLFYKYIGKNNVKEINILEKF
>CP023022.1|AXX46092.1|3026741_3026933_-|DNA-binding-protein
MKTANQIRKEFESRGKSIAEWSRENNFSEHLVYQVLLSNRIPRRGKSHDIAVKLGLKEGETNE
>CP023022.1|AXX46093.1|3027178_3027364_-|type-II-toxin-antitoxin-system-prevent-host-death-family-antitoxin
MESMNYANAKAQLSRLMDQALYGQPVEITRKNREPVVIISKASYEAYKKADFYNRFPEDSK
>CP023022.1|AXX46094.1|3027417_3028158_-|NAD(P)-dependent-oxidoreductase
MTRFEGKVALVTGGSTGIGKAISKRLSDEGATVFTVQRHEDKLFNSIVADLSNPTIPTKVIREVIYRAGRIDLLVNNAGMMKEFSVENMPLHVWQHHLNLNLTAPFLLIQEALPYLRSSQGNIINIGSIEGLAANPLHAAYCSTKAGLAGLTRAVAVDHGHEKIRCNLIAPGWIDTELNTDFINSQPDPESFRNQVGKIHPLARTGSPDEVASLVAFLASDEASFITGQTYVVDGGRMAKLSLPSN
>CP023022.1|AXX46095.1|3028170_3029343_-|hypothetical-protein
MNKSYLTVGLGFFVAGMAVPTFAGVTFGDPKTELGAVTVSGTLRANYQDKDYGESASDQKIKFDAAILNIVYESPDWFSKVQYRCYQYDKFCDFSTLVQAYAGYRLNTTDNITVGLQPIPFGPGRYWDSSFYAGINNTMGLQDALDLGVNYHFEMPTATKVDLAYFATDGGNYHGTSKDSARYTANVVTSSDPLKTNLNEKNMWMARVDQDLKFLSTDDFKVSVGGSYWYSDIKNKKTSADGNRNTWAVFNRINYKNLNVVLTGGRQSISNKDALSPTSSTFGSFDGEYDIANKGYFYSVDTSYTFKNLRDSLNVTPYVVFSGFNKKEQGFDDSQRNIVGVAWDYKNISLYTEYLMSKNDPFVGGTSSSLAAGDDGKWNKLLNLMLVYNF
>CP023022.1|AXX46096.1|3029769_3030585_+|2,4-dihydroxyhept-2-ene-1,7-dioic-acid-aldolase
MVDTTNYFKRKLKAKEQQLGLWVGLADADGYCAEIAANAGYDWLLIDGEHAPNSVRTILTQLQSVAAYPSQPIVRPVIGDVSLIKQLLDIGAQTLLIPMIETAEQAELMVKATRYPPDGIRGVGAVLARASRWDNVPNYIHTADQEICLLLQIESRKGLENLDAILQVEGVDGIFIGPADLSAELGHRGNPGHEEVQNIIVDMVKKIHASGKAAGIFTANEQLIRKYMSLDVEFIGIGVDTCLLMDSMKQLLAKFKEPQAVVVTSSTGGYK
>CP023022.1|AXX46097.1|3030571_3030775_+|hypothetical-protein
MAISKFIFFNFLIGGVNYCSTNFTLYGHKKALIKFLYWRSRPVFLKAGQIVYLGIDGLGVQKQKIIQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP023022_4	4.1\|1452533\|58\|CP023022\|CRISPRCasFinder	1452533-1452590	58	NZ_CP021429	Acinetobacter pittii strain HUMV-6483 plasmid p11, complete sequence	63466-63523	2	0.966

1. spacer 4.1|1452533|58|CP023022|CRISPRCasFinder matches to NZ_CP021429 (Acinetobacter pittii strain HUMV-6483 plasmid p11, complete sequence) position: , mismatch: 2, identity: 0.966

ttttgagccacctgtcatagacgacatatcgtgatccatacctttcattgaagacatg	CRISPR spacer
ttttgagccacctgtcatagatgacatatcgtgatccatgcctttcattgaagacatg	Protospacer
*********************.*****************.******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

769967 : 816685

Acinetobacter_phage(86.79%)

head,terminase,integrase,capsid,tail

attL 767830:767847|attR 816846:816863

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
767830:767847	attL	NA	NA	NA	NA
AXX44121.1\|769967_770612_+	DUF159 family protein	A0A218MNF5	uncultured_virus	2.3e-56	48.8
AXX44122.1\|770727_771222_+	DNA polymerase V	A0A2H4J538	uncultured_Caudovirales_phage	1.5e-44	58.3
AXX44123.1\|771225_772524_+	DNA polymerase V subunit UmuC	A0A2H4JBL5	uncultured_Caudovirales_phage	3.4e-160	62.1
AXX44124.1\|772601_773549_+	hypothetical protein	Q858R6	Enterobacteria_phage	7.8e-37	33.0
AXX44125.1\|773760_774330_+	hypothetical protein	NA	NA	NA	NA
AXX44126.1\|774479_775025_-	hypothetical protein	A0A0D4DCJ5	Acinetobacter_phage	9.5e-96	94.4
AXX44127.1\|775068_775458_-	hypothetical protein	A0A0P0I8L9	Acinetobacter_phage	3.3e-66	99.2
AXX44128.1\|775572_779019_-	hypothetical protein	J7HXG3	Acinetobacter_phage	0.0e+00	98.6
AXX44129.1\|779011_779374_-	hypothetical protein	A0A0D4DCJ1	Acinetobacter_phage	4.4e-65	98.3
AXX44130.1\|779370_779877_-	DUF1833 domain-containing protein	A0A0D4DCA4	Acinetobacter_phage	2.7e-92	99.4
AXX44131.1\|779876_780275_-	hypothetical protein	A0A0P0IY66	Acinetobacter_phage	1.3e-70	95.5
AXX44132.1\|780339_780732_-	hypothetical protein	NA	NA	NA	NA
AXX44133.1\|780735_781488_-	hypothetical protein	J7HXF9	Acinetobacter_phage	1.3e-34	35.2
AXX44134.1\|781562_785861_-\|tail	phage tail tape measure protein	A0A0D4DC37	Acinetobacter_phage	0.0e+00	76.0
AXX44135.1\|785923_786250_-	hypothetical protein	NA	NA	NA	NA
AXX44136.1\|786321_787005_-	hypothetical protein	NA	NA	NA	NA
AXX44137.1\|787036_787360_-	DUF4236 domain-containing protein	NA	NA	NA	NA
AXX44138.1\|787368_787545_-	hypothetical protein	A0A0R6PI25	Moraxella_phage	6.3e-09	57.7
AXX44139.1\|787644_788049_-	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.9e-70	100.0
AXX44140.1\|788141_788324_-	addiction module toxin, HicA family	A0A0D4DC32	Acinetobacter_phage	7.4e-29	100.0
AXX44141.1\|788386_788722_-	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	6.4e-26	58.0
AXX44142.1\|788649_789165_-	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	1.9e-77	97.3
AXX44143.1\|789234_790152_-	hypothetical protein	A0A0P0IL42	Acinetobacter_phage	1.2e-164	96.4
AXX44144.1\|790204_791509_-\|tail	phage tail protein	A0A0D4DCQ4	Acinetobacter_phage	1.0e-87	47.2
AXX44145.1\|791508_791862_-	hypothetical protein	A0A0P0IY61	Acinetobacter_phage	3.3e-57	93.2
AXX44146.1\|791958_792480_-	SH3 domain-containing protein	NA	NA	NA	NA
AXX44147.1\|792588_792807_-	hypothetical protein	A0A0P0I8C2	Acinetobacter_phage	1.2e-28	94.2
AXX44148.1\|792808_793207_-	hypothetical protein	A0A0D4DBX3	Acinetobacter_phage	1.7e-62	85.6
AXX44149.1\|793208_793577_-	hypothetical protein	A0A0P0IDX0	Acinetobacter_phage	2.3e-53	94.4
AXX44150.1\|793548_793953_-	hypothetical protein	A0A0P0IKR8	Acinetobacter_phage	1.1e-64	90.2
AXX44151.1\|793961_794375_-	glutamate 5-kinase	J7I467	Acinetobacter_phage	1.8e-62	85.4
AXX44152.1\|794331_794721_-	hypothetical protein	A0A0D4DC24	Acinetobacter_phage	6.6e-67	100.0
AXX44153.1\|794725_795391_-	stress-responsive nuclear envelope protein	A0A0D4DBW4	Acinetobacter_phage	2.1e-113	99.1
AXX44154.1\|795458_796415_-\|capsid	phage capsid protein	A0A0D4DBM4	Acinetobacter_phage	2.1e-178	100.0
AXX44155.1\|796442_797210_-	hypothetical protein	J7I0W4	Acinetobacter_phage	1.2e-117	89.4
AXX44156.1\|797323_797515_-	hypothetical protein	A0A0P0IKM2	Acinetobacter_phage	1.7e-28	100.0
AXX44157.1\|797738_797975_-	hypothetical protein	A0A0D4DC19	Acinetobacter_phage	1.1e-35	92.3
AXX44158.1\|798073_798382_-	hypothetical protein	A0A0P0I8B5	Acinetobacter_phage	2.0e-42	97.8
AXX44159.1\|798508_799612_-\|head	phage head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	2.3e-205	99.5
AXX44160.1\|799613_801065_-	DUF4055 domain-containing protein	A0A0D4DCP1	Acinetobacter_phage	6.1e-283	98.6
AXX44161.1\|801061_802489_-\|terminase	terminase	A0A0D4DCE6	Acinetobacter_phage	1.3e-269	95.4
AXX44162.1\|802478_802949_-	DUF2280 domain-containing protein	A0A0D4DC15	Acinetobacter_phage	3.0e-82	100.0
AXX44163.1\|803007_803649_-	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	6.1e-126	99.1
AXX44164.1\|803617_804085_-	hypothetical protein	A0A0P0IRI6	Acinetobacter_phage	8.5e-69	83.9
AXX44165.1\|804142_804745_-	hypothetical protein	NA	NA	NA	NA
AXX44166.1\|805276_805504_-	hypothetical protein	NA	NA	NA	NA
AXX44167.1\|805640_806141_-	hypothetical protein	A0A0P0IY98	Acinetobacter_phage	1.3e-88	95.2
AXX44168.1\|806137_806533_-	DUF559 domain-containing protein	A0A0P0I8E8	Acinetobacter_phage	9.7e-66	95.4
AXX44169.1\|806532_806856_-	hypothetical protein	NA	NA	NA	NA
AXX44170.1\|806845_807052_-	hypothetical protein	NA	NA	NA	NA
AXX44171.1\|807044_807386_-	hypothetical protein	A0A0P0I8A5	Acinetobacter_phage	1.8e-31	56.9
AXX44172.1\|807664_808465_-	hypothetical protein	A0A0P0IDV1	Acinetobacter_phage	2.4e-148	98.1
AXX44173.1\|808467_809349_-	replication protein	A0A0P0IKQ2	Acinetobacter_phage	3.0e-139	95.6
AXX46749.1\|809341_809566_-	hypothetical protein	A0A0P0I444	Acinetobacter_phage	6.5e-35	98.6
AXX44174.1\|809637_809910_-	hypothetical protein	A0A0P0J0B9	Acinetobacter_phage	1.5e-41	97.8
AXX44175.1\|809959_810460_-	hypothetical protein	NA	NA	NA	NA
AXX44176.1\|810514_810763_-	Cro/Cl family transcriptional regulator	A0A0R6PH31	Moraxella_phage	8.0e-18	58.6
AXX44177.1\|810765_811557_+	peptidase S24	A0A0R6PH50	Moraxella_phage	1.4e-10	52.1
AXX44178.1\|811783_812233_+	hypothetical protein	A0A0D4DBH9	Acinetobacter_phage	3.9e-71	92.5
AXX44179.1\|812257_812548_+	hypothetical protein	A0A0D4DCB5	Acinetobacter_phage	1.0e-48	98.9
AXX44180.1\|812559_813681_+	AAA family ATPase	A0A0N7IRE0	Acinetobacter_phage	5.2e-213	100.0
AXX44181.1\|813677_813884_+	hypothetical protein	NA	NA	NA	NA
AXX44182.1\|813888_814851_+	hypothetical protein	A0A0D4DBR8	Acinetobacter_phage	5.0e-132	76.5
AXX44183.1\|814850_815147_+	hypothetical protein	NA	NA	NA	NA
AXX44184.1\|815147_815417_+	DNA-binding protein	A0A0N7IRE8	Acinetobacter_phage	1.1e-41	97.8
AXX44185.1\|815422_816685_-\|integrase	integrase	A0A0P0IKP2	Acinetobacter_phage	7.3e-248	99.5
816846:816863	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1163033 : 1177839

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX44483.1\|1163033_1163618_+	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	5.0e-111	99.5
AXX44484.1\|1163713_1166479_-	aminopeptidase	A0A0P0IY26	Acinetobacter_phage	0.0e+00	98.7
AXX44485.1\|1166492_1169225_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	0.0e+00	98.4
AXX46765.1\|1169580_1170630_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	9.8e-190	100.0
AXX44486.1\|1170639_1171446_+	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	3.9e-146	99.3
AXX44487.1\|1171455_1172151_+	DNA mismatch repair protein MutS	A0A0P0IDT4	Acinetobacter_phage	5.8e-122	100.0
AXX44488.1\|1172161_1173145_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.9e-183	96.3
AXX44489.1\|1173151_1175527_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	0.0e+00	97.7
AXX44490.1\|1175528_1177028_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	2.1e-278	97.0
AXX44491.1\|1177284_1177839_+	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	2.7e-98	100.0

DBSCAN-SWA_3

2895959 : 2992311

102

uncultured_Caudovirales_phage(32.35%)

head,holin,terminase,integrase,capsid,transposase,tail,portal,plate,tRNA

attL 2954827:2954886|attR 2992589:2992699

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX45977.1\|2895959_2896940_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.2e-35	36.8
AXX45978.1\|2896973_2899355_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AXX45979.1\|2899351_2899648_+	integration host factor subunit alpha	Q2A099	Sodalis_phage	3.5e-12	39.3
AXX45980.1\|2899818_2900061_-	hypothetical protein	NA	NA	NA	NA
AXX45981.1\|2900155_2900281_+	hypothetical protein	NA	NA	NA	NA
AXX45982.1\|2900474_2901743_-	transcription termination factor Rho	NA	NA	NA	NA
AXX45983.1\|2902063_2902390_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	5.3e-17	44.2
AXX45984.1\|2902669_2904190_+	exopolyphosphatase	NA	NA	NA	NA
AXX45985.1\|2904208_2905030_+	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
AXX45986.1\|2904966_2906370_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AXX46845.1\|2906341_2907178_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AXX45987.1\|2907199_2907769_+	YggT family protein	NA	NA	NA	NA
AXX45988.1\|2907829_2910601_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	1.8e-65	31.7
AXX45989.1\|2910755_2913563_+	DUF2339 domain-containing protein	NA	NA	NA	NA
AXX45990.1\|2913552_2914470_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AXX45991.1\|2914479_2915301_-	hypothetical protein	NA	NA	NA	NA
AXX45992.1\|2915397_2916888_+	type II secretion system protein GspE	NA	NA	NA	NA
AXX45993.1\|2916942_2917374_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
AXX45994.1\|2917460_2917898_-	MarR family transcriptional regulator	NA	NA	NA	NA
AXX45995.1\|2918058_2918436_-	DUF4951 domain-containing protein	NA	NA	NA	NA
AXX45996.1\|2918450_2919275_-	carbon-nitrogen hydrolase	NA	NA	NA	NA
AXX45997.1\|2919301_2919823_-	anti-sigma factor antagonist	NA	NA	NA	NA
AXX45998.1\|2919925_2920894_-	stage II sporulation protein E	NA	NA	NA	NA
AXX46846.1\|2921010_2921760_-	VacJ family lipoprotein	NA	NA	NA	NA
AXX45999.1\|2928069_2929518_+	RNA polymerase sigma-54 factor	NA	NA	NA	NA
AXX46000.1\|2929686_2930025_+	ribosomal subunit interface protein	NA	NA	NA	NA
AXX46001.1\|2930163_2930415_+	hypothetical protein	NA	NA	NA	NA
AXX46002.1\|2930421_2931678_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
AXX46003.1\|2931677_2932361_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
AXX46847.1\|2932466_2933756_+	histidinol dehydrogenase	NA	NA	NA	NA
AXX46004.1\|2933825_2934911_+	histidinol-phosphate transaminase	NA	NA	NA	NA
AXX46848.1\|2934914_2936270_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	2.3e-26	35.9
AXX46005.1\|2936395_2936731_+	hypothetical protein	NA	NA	NA	NA
AXX46006.1\|2936721_2937930_-\|transposase	IS256 family transposase ISAba26	A0A218MNI5	uncultured_virus	3.1e-46	46.5
AXX46007.1\|2938009_2938405_+	hypothetical protein	NA	NA	NA	NA
AXX46008.1\|2938455_2939004_-	NUDIX hydrolase	NA	NA	NA	NA
AXX46009.1\|2939118_2939745_+	CoA pyrophosphatase	NA	NA	NA	NA
AXX46849.1\|2939767_2940295_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
AXX46010.1\|2940427_2941093_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AXX46011.1\|2941104_2941896_+	methyltransferase	NA	NA	NA	NA
AXX46012.1\|2942032_2943484_+	peptidase C13 family protein	NA	NA	NA	NA
AXX46013.1\|2943452_2944301_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AXX46014.1\|2944301_2944574_-	DUF2218 domain-containing protein	A0A218MNG7	uncultured_virus	8.3e-08	44.2
AXX46015.1\|2944758_2945445_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AXX46016.1\|2945801_2946623_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AXX46017.1\|2946724_2947120_+	hypothetical protein	NA	NA	NA	NA
AXX46018.1\|2947160_2949095_+	copper oxidase	NA	NA	NA	NA
AXX46850.1\|2949108_2949837_+	copper resistance protein CopB	NA	NA	NA	NA
AXX46851.1\|2950070_2950862_+	cation transporter	NA	NA	NA	NA
AXX46019.1\|2951011_2951332_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AXX46020.1\|2951343_2951823_+	glycosyltransferase	M1PFU9	Streptococcus_phage	4.5e-25	43.9
AXX46021.1\|2951959_2953180_+	bifunctional ornithine acetyltransferase/N-acetylglutamate synthase	NA	NA	NA	NA
AXX46022.1\|2953326_2954391_+	quinolinate synthase NadA	NA	NA	NA	NA
2954827:2954886	attL	NA	NA	NA	NA
AXX46023.1\|2955572_2956100_+	hypothetical protein	NA	NA	NA	NA
AXX46024.1\|2956377_2957442_-\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	3.7e-112	59.4
AXX46025.1\|2957438_2959208_-\|terminase	terminase	Q9ZXM5	Pseudomonas_virus	8.7e-215	62.6
AXX46026.1\|2959393_2960236_+\|capsid	capsid protein	Q9ZXM4	Pseudomonas_virus	1.3e-59	61.0
AXX46027.1\|2960264_2961269_+\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	6.4e-106	59.6
AXX46028.1\|2961273_2962035_+\|terminase	terminase	Q9ZXM2	Pseudomonas_virus	3.3e-46	45.9
AXX46029.1\|2962147_2962597_+\|head	head completion protein	A0A0M3LNL8	Mannheimia_phage	1.7e-13	35.3
AXX46030.1\|2962593_2962803_+\|tail	phage tail protein	E5G6M9	Salmonella_phage	4.8e-16	62.5
AXX46031.1\|2962810_2963161_+	hypothetical protein	NA	NA	NA	NA
AXX46032.1\|2963157_2963427_+\|holin	phage holin family protein	NA	NA	NA	NA
AXX46033.1\|2963423_2964278_+	hydrolase	A4JWU0	Burkholderia_virus	5.6e-42	40.2
AXX46034.1\|2964274_2964784_+\|tail	phage tail protein	A0A2H4J906	uncultured_Caudovirales_phage	2.8e-41	52.9
AXX46035.1\|2964786_2965233_+	phage virion morphogenesis protein	A0A2H4J927	uncultured_Caudovirales_phage	2.0e-27	48.6
AXX46036.1\|2965301_2965979_+\|plate	baseplate assembly protein	A4PE41	Ralstonia_virus	6.6e-14	36.2
AXX46037.1\|2965975_2966323_+\|plate	baseplate assembly protein	A0A2H4JE52	uncultured_Caudovirales_phage	9.2e-20	43.5
AXX46038.1\|2966319_2967222_+\|plate	baseplate assembly protein	Q37840	Escherichia_phage	2.4e-72	48.6
AXX46039.1\|2967221_2967827_+\|tail	phage tail protein I	A0A0F7LA36	Escherichia_phage	3.5e-30	39.3
AXX46040.1\|2967838_2970451_+\|tail	phage tail protein	A0A220NQG5	Acinetobacter_phage	3.4e-159	44.8
AXX46041.1\|2970616_2971789_+\|tail	phage tail protein	A0A2H4JCP8	uncultured_Caudovirales_phage	3.6e-156	68.8
AXX46042.1\|2971815_2972331_+\|tail	phage major tail tube protein	A0A2H4J916	uncultured_Caudovirales_phage	4.4e-50	58.2
AXX46043.1\|2972401_2972743_+\|tail	phage tail assembly protein	E5E3U8	Burkholderia_phage	5.0e-10	40.4
AXX46044.1\|2972751_2972871_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
AXX46045.1\|2972867_2975594_+\|tail	phage tail tape measure protein	A4PE52	Ralstonia_virus	5.3e-179	43.9
AXX46046.1\|2975606_2976032_+	oxidoreductase	A0A2H4JG54	uncultured_Caudovirales_phage	2.1e-34	50.7
AXX46047.1\|2976032_2977331_+	DNA primase	A0A2H4JAV0	uncultured_Caudovirales_phage	3.5e-104	49.3
AXX46048.1\|2977287_2977479_-	hypothetical protein	NA	NA	NA	NA
AXX46049.1\|2977506_2978313_-	DNA adenine methylase	A0A2H4J8Q1	uncultured_Caudovirales_phage	1.2e-86	61.2
AXX46050.1\|2978275_2978482_-	Com family DNA-binding transcriptional regulator	NA	NA	NA	NA
AXX46051.1\|2978598_2978886_+	hypothetical protein	NA	NA	NA	NA
AXX46052.1\|2978885_2979128_+	hypothetical protein	A0A2H4J8L3	uncultured_Caudovirales_phage	1.1e-11	50.0
AXX46053.1\|2979576_2979792_+	hypothetical protein	NA	NA	NA	NA
AXX46054.1\|2979813_2980755_-	hypothetical protein	NA	NA	NA	NA
AXX46055.1\|2980819_2981263_-	hypothetical protein	NA	NA	NA	NA
AXX46056.1\|2981419_2982283_-	hypothetical protein	NA	NA	NA	NA
AXX46057.1\|2982325_2982847_-	hypothetical protein	NA	NA	NA	NA
AXX46058.1\|2982843_2983032_-	hypothetical protein	NA	NA	NA	NA
AXX46852.1\|2983535_2984096_+	hypothetical protein	NA	NA	NA	NA
AXX46059.1\|2984156_2985029_-	hypothetical protein	NA	NA	NA	NA
AXX46060.1\|2985067_2985409_-	hypothetical protein	NA	NA	NA	NA
AXX46061.1\|2985491_2985701_+	hypothetical protein	NA	NA	NA	NA
AXX46062.1\|2985697_2985931_+	hypothetical protein	NA	NA	NA	NA
AXX46063.1\|2985935_2986118_+	hypothetical protein	NA	NA	NA	NA
AXX46064.1\|2986133_2988851_+	hypothetical protein	A0A077K8T2	Ralstonia_phage	2.5e-176	38.9
AXX46065.1\|2988877_2989156_+	hypothetical protein	NA	NA	NA	NA
AXX46066.1\|2989221_2989653_+	hypothetical protein	NA	NA	NA	NA
AXX46067.1\|2989655_2989925_+	hypothetical protein	NA	NA	NA	NA
AXX46068.1\|2989917_2990250_+	hypothetical protein	NA	NA	NA	NA
AXX46069.1\|2990322_2991063_+	DNA polymerase III subunit epsilon	A0A0S0NDC6	Pseudomonas_phage	4.8e-26	32.8
AXX46070.1\|2991150_2992311_+\|integrase	site-specific integrase	A0A2H4JGM5	uncultured_Caudovirales_phage	5.7e-74	41.4
2992589:2992699	attR	NA	NA	NA	NA

DBSCAN-SWA_4

3369957 : 3376506

Acinetobacter_phage(83.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX46875.1\|3369957_3370182_+	hypothetical protein	A0A0P0I444	Acinetobacter_phage	6.5e-35	98.6
AXX46385.1\|3371427_3371772_+	hypothetical protein	NA	NA	NA	NA
AXX46386.1\|3371980_3372217_+	hypothetical protein	NA	NA	NA	NA
AXX46387.1\|3372878_3373334_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-83	98.7
AXX46388.1\|3373393_3373828_+	hypothetical protein	A0A0P0IVP9	Acinetobacter_phage	4.2e-78	97.9
AXX46389.1\|3373796_3374438_+	hypothetical protein	A0A0D4DBV4	Acinetobacter_phage	1.1e-122	96.2
AXX46390.1\|3374496_3374937_+	hypothetical protein	A0A1B1P9C2	Acinetobacter_phage	5.4e-41	58.5
AXX46391.1\|3375297_3376506_-\|transposase	IS256 family transposase ISAba26	A0A218MNI5	uncultured_virus	3.1e-46	46.5

DBSCAN-SWA_5

3577973 : 3642543

Acinetobacter_phage(63.64%)

head,holin,coat,terminase,integrase,transposase,tail,tRNA

attL 3591663:3591716|attR 3637380:3637433

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX46554.1\|3577973_3578207_+\|transposase	transposase	NA	NA	NA	NA
AXX46555.1\|3578358_3579030_-	peptidase S24	A0A1B1P9J5	Acinetobacter_phage	1.4e-64	55.6
AXX46556.1\|3579629_3580019_+	hypothetical protein	A0A0P0IYC0	Acinetobacter_phage	4.8e-49	74.4
AXX46557.1\|3580056_3580602_+	hypothetical protein	A0A0N7IRF5	Acinetobacter_phage	6.0e-74	72.9
AXX46558.1\|3580668_3581286_-	LysE family translocator	NA	NA	NA	NA
AXX46559.1\|3581804_3582020_+	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	7.7e-17	65.0
AXX46560.1\|3582222_3582447_+	hypothetical protein	NA	NA	NA	NA
AXX46561.1\|3582726_3583542_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AXX46562.1\|3583697_3583817_-	hypothetical protein	NA	NA	NA	NA
AXX46563.1\|3584303_3584762_+	hypothetical protein	A0A0P0HSF5	Acinetobacter_phage	3.5e-27	45.8
AXX46564.1\|3585054_3585399_+	hypothetical protein	NA	NA	NA	NA
AXX46565.1\|3585496_3586603_+\|head	phage head morphogenesis protein	A0A0D4DBL9	Acinetobacter_phage	1.2e-142	65.7
AXX46566.1\|3586597_3587812_-	MFS transporter	NA	NA	NA	NA
AXX46567.1\|3587923_3588370_+	transcriptional regulator	NA	NA	NA	NA
AXX46883.1\|3588519_3588786_+	hypothetical protein	NA	NA	NA	NA
AXX46568.1\|3588799_3588988_+	peptidoglycan-binding protein	A0A0B5L5G0	Acinetobacter_phage	1.1e-14	92.9
AXX46569.1\|3589527_3590121_+	DUF4142 domain-containing protein	NA	NA	NA	NA
AXX46570.1\|3590504_3591134_+	hypothetical protein	NA	NA	NA	NA
AXX46884.1\|3591404_3591542_-\|integrase	integrase	NA	NA	NA	NA
3591663:3591716	attL	NA	NA	NA	NA
AXX46571.1\|3591867_3592179_+	hypothetical protein	NA	NA	NA	NA
AXX46572.1\|3592188_3592485_-	hypothetical protein	NA	NA	NA	NA
AXX46573.1\|3592731_3593109_-	hypothetical protein	J7HXR6	Acinetobacter_phage	2.2e-43	72.1
AXX46574.1\|3593105_3593717_-	hypothetical protein	NA	NA	NA	NA
AXX46575.1\|3593713_3594646_-	AAA family ATPase	A0A0N7IRE0	Acinetobacter_phage	2.0e-61	40.8
AXX46576.1\|3594833_3595052_-	DUF551 domain-containing protein	B5WZX3	Pseudomonas_phage	1.1e-05	38.9
AXX46577.1\|3595051_3595435_-	hypothetical protein	NA	NA	NA	NA
AXX46578.1\|3595504_3595765_-	hypothetical protein	NA	NA	NA	NA
AXX46579.1\|3595764_3595956_-	hypothetical protein	A0A1B1P9G9	Acinetobacter_phage	1.1e-14	64.7
AXX46580.1\|3596162_3596882_-	transcriptional regulator	A0A2H4J597	uncultured_Caudovirales_phage	1.4e-94	74.7
AXX46581.1\|3596988_3597177_+	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	1.2e-10	53.3
AXX46582.1\|3597185_3597506_+	transcriptional regulator	A0A0P0HSE9	Acinetobacter_phage	2.3e-41	84.9
AXX46583.1\|3597557_3597740_+	hypothetical protein	A0A1B1P9H5	Acinetobacter_phage	2.6e-10	79.5
AXX46584.1\|3597872_3598640_+	hypothetical protein	A0A0P0HSN8	Acinetobacter_phage	2.2e-45	89.5
AXX46585.1\|3598639_3599965_+	DNA helicase	A0A0P0IVX0	Acinetobacter_phage	7.4e-235	93.2
AXX46586.1\|3599961_3600213_+	hypothetical protein	A0A0P0IE39	Acinetobacter_phage	5.8e-40	98.8
AXX46587.1\|3600209_3600698_+	hypothetical protein	A0A2H4J4S1	uncultured_Caudovirales_phage	6.8e-53	61.9
AXX46588.1\|3600694_3600979_+	hypothetical protein	V5YTP3	Pseudomonas_phage	2.3e-16	48.8
AXX46589.1\|3600975_3601290_+	hypothetical protein	A0A1J0MGQ3	Acinetobacter_phage	3.7e-36	75.2
AXX46590.1\|3601279_3601462_+	DUF1653 domain-containing protein	NA	NA	NA	NA
AXX46591.1\|3601848_3602190_+	hypothetical protein	A0A1X9SFG4	Acinetobacter_phage	5.5e-17	59.7
AXX46592.1\|3602186_3602390_+	hypothetical protein	NA	NA	NA	NA
AXX46593.1\|3602386_3602842_+	hypothetical protein	A0A0P0HSP6	Acinetobacter_phage	1.8e-76	97.3
AXX46594.1\|3602838_3603108_+	hypothetical protein	A0A0D4DC03	Acinetobacter_phage	2.1e-43	97.8
AXX46595.1\|3603118_3603580_+	hypothetical protein	A0A2H4J353	uncultured_Caudovirales_phage	2.6e-62	75.8
AXX46596.1\|3604063_3604276_+	hypothetical protein	NA	NA	NA	NA
AXX46597.1\|3604262_3604544_+	hypothetical protein	A0A0D4DC07	Acinetobacter_phage	6.7e-21	57.0
AXX46598.1\|3604533_3604746_+	hypothetical protein	NA	NA	NA	NA
AXX46599.1\|3604790_3605273_+	hypothetical protein	A0A0D4DC11	Acinetobacter_phage	8.5e-64	71.9
AXX46600.1\|3605317_3605560_+	hypothetical protein	NA	NA	NA	NA
AXX46601.1\|3605601_3606063_+	DNA-packaging protein	I6S1J2	Salmonella_phage	7.1e-44	62.9
AXX46602.1\|3606078_3607575_+\|terminase	terminase	A0A1W6JNY3	Morganella_phage	1.2e-196	67.8
AXX46603.1\|3607582_3608986_+	hypothetical protein	A0A0P0IDW1	Acinetobacter_phage	8.4e-128	51.6
AXX46604.1\|3608951_3610037_+\|head	phage head morphogenesis protein	A0A1B1P9B7	Acinetobacter_phage	5.4e-191	93.9
AXX46605.1\|3610033_3610246_+	hypothetical protein	NA	NA	NA	NA
AXX46606.1\|3610355_3611162_+	hypothetical protein	A0A0P0J090	Acinetobacter_phage	2.2e-64	58.1
AXX46607.1\|3611174_3612329_+\|coat	P22 coat - protein 5 family protein	W6EBZ8	Rhizobium_phage	5.7e-98	54.7
AXX46608.1\|3612368_3612782_+	hypothetical protein	NA	NA	NA	NA
AXX46609.1\|3612785_3613178_+	hypothetical protein	NA	NA	NA	NA
AXX46610.1\|3613180_3613561_+	glutamate 5-kinase	A0A1B1P9E3	Acinetobacter_phage	2.9e-51	78.9
AXX46611.1\|3613616_3614288_+	hypothetical protein	NA	NA	NA	NA
AXX46612.1\|3614326_3614782_+	hypothetical protein	A0A1B1P9D5	Acinetobacter_phage	1.2e-51	70.9
AXX46613.1\|3614783_3615179_+	hypothetical protein	A0A1B1P9D6	Acinetobacter_phage	5.1e-67	93.1
AXX46614.1\|3615339_3615867_+	Rha family transcriptional regulator	A0A1B1P9D9	Acinetobacter_phage	2.5e-53	63.2
AXX46615.1\|3615866_3616133_+	hypothetical protein	A0A1B1P9E1	Acinetobacter_phage	2.8e-40	88.6
AXX46616.1\|3616198_3617128_+	hypothetical protein	A0A1B1P9E0	Acinetobacter_phage	4.9e-169	98.4
AXX46617.1\|3617175_3617700_+	hypothetical protein	A0A0N7IRG3	Acinetobacter_phage	9.9e-42	54.4
AXX46885.1\|3617744_3617951_+	hypothetical protein	A0A1B1P9F7	Acinetobacter_phage	2.3e-26	90.5
AXX46618.1\|3618064_3618856_+	hypothetical protein	NA	NA	NA	NA
AXX46619.1\|3618953_3619130_+	hypothetical protein	A0A0R6PI25	Moraxella_phage	4.8e-09	59.6
AXX46620.1\|3619138_3619549_+	DUF4236 domain-containing protein	NA	NA	NA	NA
AXX46621.1\|3619558_3619906_+	hypothetical protein	NA	NA	NA	NA
AXX46622.1\|3619960_3620362_+	hypothetical protein	NA	NA	NA	NA
AXX46623.1\|3620420_3624317_+\|tail	phage tail tape measure protein	A0A0D4DC37	Acinetobacter_phage	1.5e-155	41.1
AXX46624.1\|3624313_3624655_+\|tail	phage tail protein	A0A0R6PHH7	Moraxella_phage	2.2e-13	44.8
AXX46625.1\|3624708_3626010_+\|tail	phage tail protein	U5PW98	Acinetobacter_phage	4.8e-53	53.9
AXX46626.1\|3625996_3626806_+\|tail	phage minor tail protein L	A0A0R6PIJ5	Moraxella_phage	1.6e-91	63.9
AXX46627.1\|3626812_3627568_+\|tail	phage tail protein	A0A0R6PIM4	Moraxella_phage	3.6e-85	55.8
AXX46628.1\|3627551_3628205_+\|tail	tail assembly protein	G3ENB6	Psychrobacter_phage	1.3e-43	49.1
AXX46629.1\|3628261_3634510_+\|tail	phage tail protein	A0A0R6PIC9	Moraxella_phage	0.0e+00	64.5
AXX46630.1\|3634558_3634834_+\|holin	holin	NA	NA	NA	NA
AXX46631.1\|3634817_3635327_+	lysozyme	A0A0B5L5F7	Acinetobacter_phage	4.5e-47	58.6
AXX46632.1\|3635326_3635695_+	hypothetical protein	NA	NA	NA	NA
AXX46633.1\|3635930_3636128_+	hypothetical protein	A0A0D4DBH0	Acinetobacter_phage	1.5e-14	65.6
AXX46634.1\|3636156_3637170_-\|integrase	site-specific integrase	A0A0R6PHH4	Moraxella_phage	3.8e-66	40.3
AXX46635.1\|3637523_3638945_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.9e-55	30.8
3637380:3637433	attR	NA	NA	NA	NA
AXX46636.1\|3639158_3640136_+	D-arabinose 5-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	7.3e-38	31.7
AXX46637.1\|3640139_3640679_+	3-deoxy-D-manno-octulosonate 8-phosphate phosphatase	NA	NA	NA	NA
AXX46638.1\|3640716_3641265_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AXX46639.1\|3641248_3641797_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AXX46640.1\|3641796_3642543_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-20	25.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP023025

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP023022

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection