CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032100	Arcobacter suis CECT 7833 chromosome, complete genome	1 crisprs	csa3,PrimPol,DEDDh,cas3,cas4	0	2	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032100_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032100_3

1102933-1103024

Orphan

Consensus_repeat	Method
AATAAAAAATGAATAATCATTCAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032100_3

>merge|CP032100|3|1102933-1103024|CRISPRCasFinder
AATAAAAAATGAATAATCATTCATTTAATCAAGAAATATTAACCTTAAAAACTATAGAATGGCACGAAATAAAAATATGAATAATCATTCAT

>CP032100|3|3|1102933-1103024|CRISPRCasFinder
AATAAAAAATGAATAATCATTCAT	TTAATCAAGAAATATTAACCTTAAAAACTATAGAATGGCACGAA
ATAAAAATATGAATAATCATTCAT

Protein	Signature genes	Signature genes Name	Protein_function
CP032100.1\|AXX89559.1\|1101917_1102799_+\|ferritin-like-protein-(CCC1-domains)	unknown	unknown	gnl\|CDD\|153122
CP032100.1\|AXX89567.1\|1111835_1112288_-\|heme-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|379587
CP032100.1\|AXX89554.1\|1095991_1097227_+\|[Ni-Fe]-hydrogenase,-small-subunit	unknown	unknown	gnl\|CDD\|224654
CP032100.1\|AXX89566.1\|1111347_1111764_+\|hypothetical-protein	unknown	unknown	unknown
CP032100.1\|AXX89562.1\|1105946_1106615_+\|[Ni-Fe]-hydrogenase,-cytochrome-b-subunit	unknown	unknown	gnl\|CDD\|273985
CP032100.1\|AXX89550.1\|1091411_1092848_+\|Cache-sensor-containing-diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
CP032100.1\|AXX89561.1\|1104202_1105936_+\|[Ni-Fe]-hydrogenase,-large-subunit	unknown	unknown	gnl\|CDD\|366057
CP032100.1\|AXX89556.1\|1098988_1099663_+\|[Ni-Fe]-hydrogenase,-cytochrome-b-subunit	unknown	unknown	gnl\|CDD\|273985
CP032100.1\|AXX89555.1\|1097226_1098969_+\|[Ni-Fe]-hydrogenase,-large-subunit	unknown	unknown	gnl\|CDD\|366057
CP032100.1\|AXX89564.1\|1107158_1108784_+\|hypothetical-protein	unknown	unknown	unknown
CP032100.1\|AXX89560.1\|1103039_1104200_+\|[Ni-Fe]-hydrogenase,-small-subunit	unknown	unknown	gnl\|CDD\|224654
CP032100.1\|AXX89557.1\|1099708_1100302_+\|[Ni-Fe]-hydrogenase-maturation-protease	unknown	unknown	gnl\|CDD\|99873
CP032100.1\|AXX89558.1\|1100285_1101818_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223146
CP032100.1\|AXX89563.1\|1106611_1107175_+\|[Ni-Fe]-hydrogenase-maturation-protease	unknown	unknown	gnl\|CDD\|99873
CP032100.1\|AXX89565.1\|1108817_1111061_+\|[Ni-Fe]-hydrogenase-maturation-protein-HypF	unknown	unknown	gnl\|CDD\|223146
CP032100.1\|AXX89568.1\|1112456_1112810_+\|Cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380351
CP032100.1\|AXX89569.1\|1112845_1114933_+\|formate-dehydrogenase-H,-cysteine-containing	unknown	unknown	gnl\|CDD\|239154
CP032100.1\|AXX89553.1\|1094386_1095742_+\|[Ni-Fe]-hydrogenase,-large-subunit	unknown	unknown	gnl\|CDD\|223451
CP032100.1\|AXX89551.1\|1093021_1093501_+\|transcriptional-regulator,-TetR/AcrR-family	unknown	unknown	gnl\|CDD\|224228
CP032100.1\|AXX89552.1\|1093490_1094384_+\|[Ni-Fe]-hydrogenase,-small-subunit	unknown	unknown	gnl\|CDD\|224654

Protein	Function_ID	Function_description	E-value
CP032100.1\|AXX89559.1\|1101917_1102799_+\|ferritin-like-protein-(CCC1-domains)	gnl\|CDD\|153122	cd02431, Ferritin_CCC1_C, CCC1-related domain of ferritin. Ferritin_CCC1_like_C: The proteins of this family contain two domains. This is the C-terminal domain that is closely related to the CCC1, a vacuole transmembrane protein functioning as an iron and manganese transporter. The N-terminal domain is similar to ferritin-like diiron-carboxylate proteins, which are involved in a variety of iron ion related functions, such as iron storage and regulation, mono-oxygenation, and reactive radical production. This family may be unique to certain bacteria and archaea. .	2.92057e-45
CP032100.1\|AXX89567.1\|1111835_1112288_-\|heme-binding-domain-containing-protein	gnl\|CDD\|379587	pfam14376, Haem_bd, Haem-binding domain. This domain contains a potential haem-binding motif, CXXCH. This family is found in association with pfam00034 and pfam03150.	2.5072e-50
CP032100.1\|AXX89554.1\|1095991_1097227_+\|[Ni-Fe]-hydrogenase,-small-subunit	gnl\|CDD\|224654	COG1740, HyaA, Ni,Fe-hydrogenase I small subunit [Energy production and conversion].	1.1073e-162
CP032100.1\|AXX89562.1\|1105946_1106615_+\|[Ni-Fe]-hydrogenase,-cytochrome-b-subunit	gnl\|CDD\|273985	TIGR02125, CytB-hydogenase, Ni/Fe-hydrogenase, b-type cytochrome subunit. This model describes a family of cytochrome b proteins which appear to be specific for nickel-iron hydrogenase complexes. Every genome which contains a member of this family posesses a Ni/Fe hydrogenase according to Genome Properties (GenProp0177), and most are gene clustered with other hydrogenase components. Some Ni/Fe hydrogenase-containing species lack a member of this family but contain other CytB homologs (pfam01292) which may substitute for it.	1.13926e-74
CP032100.1\|AXX89550.1\|1091411_1092848_+\|Cache-sensor-containing-diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	8.15437e-53
CP032100.1\|AXX89561.1\|1104202_1105936_+\|[Ni-Fe]-hydrogenase,-large-subunit	gnl\|CDD\|366057	pfam00374, NiFeSe_Hases, Nickel-dependent hydrogenase.	0
CP032100.1\|AXX89556.1\|1098988_1099663_+\|[Ni-Fe]-hydrogenase,-cytochrome-b-subunit	gnl\|CDD\|273985	TIGR02125, CytB-hydogenase, Ni/Fe-hydrogenase, b-type cytochrome subunit. This model describes a family of cytochrome b proteins which appear to be specific for nickel-iron hydrogenase complexes. Every genome which contains a member of this family posesses a Ni/Fe hydrogenase according to Genome Properties (GenProp0177), and most are gene clustered with other hydrogenase components. Some Ni/Fe hydrogenase-containing species lack a member of this family but contain other CytB homologs (pfam01292) which may substitute for it.	3.60814e-21
CP032100.1\|AXX89555.1\|1097226_1098969_+\|[Ni-Fe]-hydrogenase,-large-subunit	gnl\|CDD\|366057	pfam00374, NiFeSe_Hases, Nickel-dependent hydrogenase.	0
CP032100.1\|AXX89560.1\|1103039_1104200_+\|[Ni-Fe]-hydrogenase,-small-subunit	gnl\|CDD\|224654	COG1740, HyaA, Ni,Fe-hydrogenase I small subunit [Energy production and conversion].	0
CP032100.1\|AXX89557.1\|1099708_1100302_+\|[Ni-Fe]-hydrogenase-maturation-protease	gnl\|CDD\|99873	cd06062, H2MP_MemB-H2up, Endopeptidases belonging to membrane-bound hydrogenases group. These hydrogenases transfer electrons from H2 to a cytochrome that is bound to a membrane-located complex coupling electron transfer to transmembrane proton translocation. Endopeptidase HybD from E. coli is well studied in this group. Maturation of [NiFe] hydrogenases include proteolytic processing of large subunit, assembly with other subunits, and formation of the nickel metallocenter. Hydrogenase maturation endopeptidase (HybD) cleaves a short C-terminal peptide after a His or an Arg residue in the large subunit (pre-HybC) of hydrogenase 2 (hyb operon) in E. coli. This cleavage is nickel dependent. A variety of endopeptidases belong to this group that are similar in function and sequence homology. They include such proteins as HynC, HoxM, and HupD.	2.28941e-47
CP032100.1\|AXX89558.1\|1100285_1101818_+\|hypothetical-protein	gnl\|CDD\|223146	COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones].	0.000360055
CP032100.1\|AXX89563.1\|1106611_1107175_+\|[Ni-Fe]-hydrogenase-maturation-protease	gnl\|CDD\|99873	cd06062, H2MP_MemB-H2up, Endopeptidases belonging to membrane-bound hydrogenases group. These hydrogenases transfer electrons from H2 to a cytochrome that is bound to a membrane-located complex coupling electron transfer to transmembrane proton translocation. Endopeptidase HybD from E. coli is well studied in this group. Maturation of [NiFe] hydrogenases include proteolytic processing of large subunit, assembly with other subunits, and formation of the nickel metallocenter. Hydrogenase maturation endopeptidase (HybD) cleaves a short C-terminal peptide after a His or an Arg residue in the large subunit (pre-HybC) of hydrogenase 2 (hyb operon) in E. coli. This cleavage is nickel dependent. A variety of endopeptidases belong to this group that are similar in function and sequence homology. They include such proteins as HynC, HoxM, and HupD.	1.97638e-52
CP032100.1\|AXX89565.1\|1108817_1111061_+\|[Ni-Fe]-hydrogenase-maturation-protein-HypF	gnl\|CDD\|223146	COG0068, HypF, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones].	0
CP032100.1\|AXX89568.1\|1112456_1112810_+\|Cupin-domain-containing-protein	gnl\|CDD\|380351	cd02222, cupin_TM1459-like, Thermotoga maritima TM1459 and related proteins, cupin domain. This family includes bacterial and archaeal proteins homologous to Thermotoga maritima TM1459, a manganese-containing cupin that has been shown to cleave C=C bonds in the presence of alkylperoxide as oxidant in vitro. Its biological function is still unknown. This family also includes Halorhodospira halophila Hhal_0468. Structures of these proteins show a cupin fold with a conserved "jelly roll-like" beta-barrel fold that form a homodimer.	5.43241e-26
CP032100.1\|AXX89569.1\|1112845_1114933_+\|formate-dehydrogenase-H,-cysteine-containing	gnl\|CDD\|239154	cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons. It is a component of the anaerobic formate hydrogen lyase complex. The E. coli formate dehydrogenase H (Fdh-H) is a monomer composed of a single polypeptide chain with a Mo active site region and a [4Fe-4S] center. Members of the MopB_Formate-Dh-H CD belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
CP032100.1\|AXX89553.1\|1094386_1095742_+\|[Ni-Fe]-hydrogenase,-large-subunit	gnl\|CDD\|223451	COG0374, HyaB, Ni,Fe-hydrogenase I large subunit [Energy production and conversion].	6.28181e-71
CP032100.1\|AXX89551.1\|1093021_1093501_+\|transcriptional-regulator,-TetR/AcrR-family	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	0.00173635
CP032100.1\|AXX89552.1\|1093490_1094384_+\|[Ni-Fe]-hydrogenase,-small-subunit	gnl\|CDD\|224654	COG1740, HyaA, Ni,Fe-hydrogenase I small subunit [Energy production and conversion].	8.4113e-81

>CP032100.1|AXX89559.1|1101917_1102799_+|ferritin-like-protein-(CCC1-domains)
MNTPFDKENLKKALKQQQNEINDYTIYKALSLSQTDENNKKIFEKISKEEKYHYDFWVKITNTQIEPQKLVVWWFVLLVKIFGTSFALKSLEKREAGAEEFYKELFEIYPESKKIYEQETQHELELIDMLNDKKLLYAGAIVLGMNDALVELTGTLSGLAFAFDKSLTVGLTGLIMGIAASLSMAGSAYFEAKENPSEEINPLVYSLYTGVSYILTTAILVVPFFIFDLIIESLIMMFICAFLAIISYNFYISVAKDLSFSKRVIQMSAITFGVALISFAIGYVVKFYFGIEI
>CP032100.1|AXX89558.1|1100285_1101818_+|hypothetical-protein
MQLIYKIEFNTTNLYFKHIIENLIQEAKINGICKQYNGFILILLEAKGNEIEDFFALLEKKLPLSIFIGKSYVVETYDETLKEIEDFDIKQNLTLLTNDAIKKIIEENNIDFLNDIVKITKGGISRFETHNGLKDYFLPNKRIREDFENKGFEVKLLITDITKVEDIFDINMKDYQLLCSIERPLVKLKFKILKNANKEFSSSNFIYAKIPDDKEVILFAKALKENGINHVLYVNDEVYQDGLKITYFKEQSLIIHGDKGLFPKYDFTANKKFNSSKDYFDENGGVYKAILAQNAKRLVPSIGVYFSQNSHKSSISVNVPTKGIKDIIFIPNIHNSIKNCFEEISDIDEHCARLIINYSKKFPNVLEGEVPLNTNGFESIINMCAKVLGINSAKDFEDIALNTNLSSGIQIDMKLVSLDGINYLDYRRTVQSIMAYKMADVDNITLIYSFYESLSEFICNYVNEIAKDVETKDVVLCGNMFSNSILLSKTNKTLSKSYNIILPKEYPLDY
>CP032100.1|AXX89557.1|1099708_1100302_+|[Ni-Fe]-hydrogenase-maturation-protease
MKKKNIVIGVGNMLFKDEGIGIYASEYIKQNYEFDDKELEIIDGGTLGFKLMAYFQEYDNVIILDTVSIEDIVGGIYRLPSDVLLGLGTYRKTAHEVEIVEMLEIVSVLDSHANVTIIGIIPKDIESVQIGLTIEMEDKFEEFILNGIKEIESLGIKATKVNDVKVSDVVKSMIGSYNGEHLTRIPNEEDFTHAINL
>CP032100.1|AXX89556.1|1098988_1099663_+|[Ni-Fe]-hydrogenase,-cytochrome-b-subunit
MTGTMRIIHWLNAICMVVAVITGLYIGHPYYQSFIADPAVDKYVMAWNRWGHFIVAIIFDVTAVLIGYLYFFSRFEKPYKKLIPTVKNIVEFCEVFLNLITFNRRKKFDSSHSDSYNIVFFTIFHILLVFMLFSGLQLYVHGLASGESSIGAWWPWMLHFTTDWTLSVFGGNMGVRIAHHTSMYLILVWVMCHIYYQIWRTIFWKEGDIAIVIGGSKFVREEEK
>CP032100.1|AXX89555.1|1097226_1098969_+|[Ni-Fe]-hydrogenase,-large-subunit
MAKKHLVIDPITRIEGHLRIEAIIDENNVVVDAYSSSTMFRGIEEILKGRDPRDCGLLAMRICGVCTGTHYQRSIEAVEHAFKITIPKNARLVRNLIQGALYLHDHIVHFYHLHALDWVDITEALKADPKKTVAEAQKWAKVSGQRPWNASEDVYSAVQERVTRYVKQGRLGIFGNAYWGSKGFKLTPEQNLIGLSHYLDALELQRDLAKMMAIFGGKNPHPQSFVVGGVTCVQDIKNPARIAEFKQILKRGQKFTKEAYLPDVYMAGTMYAGEALEGIGGGLGNYMCYGDFRLDDTPFYEAAKLFPSGIVKNKDLTKVFEIDQTKITEDVTHAWYEGTTNLHPFEGVTKPNYTGFGKKEDNIAYLDTTKKYSWIKSPLYDDERMEVGPLARMIIGVAKGDARITKYVTTFLKNGNLPTTVLFSTVGRTAARAIETELMADVMLEWVDELALNVAHGDLSTWTEFNFDNVSKDAQGYGMAEAPRGGLGHWIKIKDGKVANYQAVVPSTWNAAPRDYKGRMGAYESALIGTKVANVDQPLEILRTIHSFDPCIACAVHIVDTKGKELGVYKVDPIGGTSRA
>CP032100.1|AXX89554.1|1095991_1097227_+|[Ni-Fe]-hydrogenase,-small-subunit
MIDSQDMVKKVFTQKSGRVETNKGEEYYNSLFEKVKNRLSVLKAQPALKDIDMMDVIESEGVNRRDFMKWVSATTATLMLPPMFAPLVAEATELMNRVPVIWIELQDCAGNSEALLRSSAPTVDDLLFDVLSLEYHETLQACAGHDADKQLEEAVEHFKGKYLLFVEGAIPMAMNGQYGTVGASGETFHDHLVRMAKDSAAVVAVGTCATFGGIPAAAPNPTGAVGVMDIVKGKPIINIPACPANPANMVGVVLHYVLTGQVPELDSLLRPKFAFGYRIHDNCERRAHFDAGEFVEEWGDEGAKNNFCLYKVGCKGPMTFNNCSIIRYNEGTNWPIGVGRGCIGCSEPDFWDKYAYERPMADAKIKAPTGGVEKTVDEFGLGLLTATAIGIGVHAVASVVAGKKSNEGEEK
>CP032100.1|AXX89553.1|1094386_1095742_+|[Ni-Fe]-hydrogenase,-large-subunit
MKTIDLVERIEGEAKLHCTWVDEKVKDARIDFLNFRGFEYILEGKTPLDALIYTPRICGICGQAHLKATVEALENVYENINEKLQITPKAKLLREIGLNIEIIDSHLKWFYMFIMPDIIKLDTNDLGIYAPLKGSRWLEAQKSASETIKALAIIGGQWPHTSYMLPGGVMSDPTKLDLVMMQNYLQNTISFFEKSISGTALENYLAFDGIDNLENLGADLKYFKDLSFKYSLENYGKSYNRFITLGESSLFKSGKIKQRLVYKLDFSKIVEDTSYSFSINKEENNSLKHTWSKSVAYDENFFETGPLSRAIISNRKFIKEIHKTFEDSVFTRVMARMDELAFLLFETNNLISQVDISQLSYIKPKISLKDIDEAKGIAVIEACRGSLFHNISIEKGLIKSYDVITPTVWNLGPKSKTQKGIAQKAIIGSPSIEIAKIVLRSFDVCSVCTTH
>CP032100.1|AXX89552.1|1093490_1094384_+|[Ni-Fe]-hydrogenase,-small-subunit
MTTKKKPTIVWFCAITCNGNTHSLLSANSSRFELLLNSFDFIYHPSLTIDKSLEDILNQEEKIDFLLVEGSISSNKDFFTINEDSTFNHLNKLASKANYIISVGSCASFGGVHAKFIQNDDICSINKAINKDIIKNLKHNIINLTGCPVHPEWILQTLFTLKTYGKIAIDEIGRPKELYGTLAHHGCTRNEYFEWKVEGNFGQKEGCLFYSQGCRGPMTHSSCNKILWNEVSSKTRIGMPCIGCTEADFPRNDMLETKKNIGIPHEVPLGISKRAYLSMSGVAKTFKIDRLHKKLME
>CP032100.1|AXX89551.1|1093021_1093501_+|transcriptional-regulator,-TetR/AcrR-family
MSVGNMYNYFSSKEELAKFAIKYSTNILADELKQINNMDITSKEKIYLFVLKYLENVQKSPEVIEYFLRVYLSNREVFKQGCEGFLCVGEFVTEVMILLEEGASKKEFREQEFFPAFSMIMGCLGGFAFLSGENVLDKELLSYSDAVAENIYRALKYDN
>CP032100.1|AXX89550.1|1091411_1092848_+|Cache-sensor-containing-diguanylate-cyclase
MNSKYKIVILISLLLITLSISITFINYFVSLNSTEKHLKTQSLPLSLDNIYTEIQKHIIEPYLVSSMMANDTFVQDWILNDEVNNHKIKEYLDAVKNKYAMFATFLVSEKSGNYYTQDGLLEKIEKENPNNSWYFKFKHIQESHEINLDFNKNLSNSLIMFINYKIFDKKYSYIGATGVALKISYINDMLKTFRQKYHFRVYFLDEKGDIVLSERDIIHEKNIDELPNLRKYKNEIISKEPLNLEYENNNKKILLNTKYIPELNLYLLVEANLDDFITDVKDIFYINLFVSLFFTFFVTVIIIYVIRKYNKKLEHLADNDLLTNVNNRRVFNSKLEHSILIHQRHNQSMNLLFLDIDNFKDINDKFGHATGDKALIRIASILKNNIRKSDLLARWGGEEFVIAYVNSSFEDSLIATEKLKNLIENDYILKELNQSIITASFGLTALKNDDNMDDLINRADMAMYESKNNGKNKISIIN
>CP032100.1|AXX89560.1|1103039_1104200_+|[Ni-Fe]-hydrogenase,-small-subunit
MQSQKLYEKLSNRLIDLEKLPKLKQNKSISSHLEEKGISRRDFMKWAGTITAMLALPASFTPLVAKAAKLSDRLPIIWLHMAECTGCSEALLRTDSPTIDSLIFDYISLEYHETLMAAAGWQAEHNLEHAIQTYKGQYILMVEGGIPKGENASYLTVGGHGKTGEQIALEASNNAMAIFAIGTCSSYGGVQAAIPNPTGAVALSKITDKPVINVPGCPPSEKNIVGTLLHYILYGTLPALDAYNRPKWAYGQRIHDLCERRGHFDAGEFVEEFGDEGAKKGYCLYKVGCKGPYTFNNCSKNKFNSHTSWPIQAGHGCIGCSEPDFWDTMGPFEEPVANRLYNTVFKGLGADATADKIGVGLLTVTGIGIAVHAAISKFKNPKDTQE
>CP032100.1|AXX89561.1|1104202_1105936_+|[Ni-Fe]-hydrogenase,-large-subunit
MSNQRVIVDPITRIEGHLRIEVEIDENNVIQKAYSSSTLWRGLETIVKNRDPRDAGFLMQRICGVCTFSHYRAGIEAVENALGIVPPLNAKLTRSLMNISLFMHDHVVHFYHLHGLDWVDVVSALDADEAKASKEAFKYSEFPIATGENDLKKVKTRVKEFVDRGQLGPFANAYWGHKTYRLSPEQNLILLSHYLKALEVQRDLAKLMAMFGGKQPHPQSLTVGGVTCVMDLMDPSRMGEYLTLFEKGAEFIEQAYQADVIMVAATYKDEPSVMAPAGVMNFMAHQEMQLNRSEFLFDTGIIMNQDLSKVYEINEDLITEEATHSWYENNEPLHPYEGKTNPKYTGFKDMETIGANKEKVHSKVIDEKGKYSWIKSPRYDGKAMEVGPLACILISYAKGNKKIVPLVDDFLTKTKLDKSALFTTLGRTAARMIQARAIAKHGLEAFYALIENLKVDQDTYTSYKIDKNKEYKGRFIGDVPRGMLSHWIRIKNGVVENYQAVVPSTWNAGPIDAKGQVGPYEASLIGLKVADISQPLEIIRVIHSFDPCIACAVHVMDKKGNDLGTYKVDPIYGLSCR
>CP032100.1|AXX89562.1|1105946_1106615_+|[Ni-Fe]-hydrogenase,-cytochrome-b-subunit
MIKKQYEFSLWLRLTHWVRVIAIIILTFTGFYIAFPFISPALNQAEPNNYLYALMRSWHIIFGFVLICVTIGKFYLFIFDKQSKVERDSFWDFISVKMWFKQIKYYMLIGSHGHLKGAYNPLQFMAYTGVYGALIFICITGLILHIHVYHEGLGGVLYDILRPLEIMMGGLAFVRELHHICMWIFIIFLPIHIYLAIFNSVYGKSGAMDSIISGYKWEDDKK
>CP032100.1|AXX89563.1|1106611_1107175_+|[Ni-Fe]-hydrogenase-maturation-protease
MNILILGIGNILFQDEGIGAHFIHYLDEKYDFISQKNSVSLVDGGTLAQRLIPEIVKYDEVVVVDCIDANNSKAGDVYFFDYKKTPSHINWQGSAHEVEMLQTLNMIDMNKDLPNTNVLGVIPKRIGDDTTFELSNEIITAVKTMEEVIIKYLLNLDIKMEIKNEDATIENISLISFKRDIINGPKI
>CP032100.1|AXX89564.1|1107158_1108784_+|hypothetical-protein
MVLKFRFTYKSNDKTLAKFLDYASKQFECSYKILQENDFVDLYINSSEEVLNQFSQALSLYIPMSIYYYDVQIEVVNELPLANTISLTQDKLISFCPSCLAKVENKEDEDYYNGFKSCDICNNWEEAVFIFENEELKSNVELFEKLAFLINDNKKIKIKTLSGTFVFSKFENIENSFRLLVTNLKNISSLVVENKTEIVALASIEKPSIDFKINEVYKQKYGLKKEKINIRFANDLTLLLLSNQLQKYEIDFLNIEENVPFDYFLDVKSKNDIFLDIPKIKCFENKKLILESTSYPKKLDSIMTKFKELDKGQFMTVLWENNLFKESILNFYLSSKNDDGISYYSEKIDGLVNLIEPLHMPFSSKEVFDEIQKDNKGKQLILNYKGKFAQDYKKALNSQIFSFETKSFCSYWEIVKVILNFENSVLENANNCFLEKGPRIDYKLFDSKKIFHRKFDYIGMIKTAISFKLAGVDEQTISLGLVESLANFIGNEIDNINSSYEVTGVSLCGDLFANERFNLLVEKNILKNFKIYYNKEFVIQK
>CP032100.1|AXX89565.1|1108817_1111061_+|[Ni-Fe]-hydrogenase-maturation-protein-HypF
MINKKIKITGIVQGVGFRPFVYNLALKYDIKGWVNNDEKGVNILLSSSEENIQNFINELKSNPPILARIDSINIEEITEIKEYKTFEIIQSESSKNKSTIISPDIAICDDCIEDINDMSNFRYNYSLTNCTNCGPRYSIIKTVPYDRINTSMFSFELCEKCKNEYENPINRRYHAQPIACENCGPNVVLYNNKNEVLSSDINAIKEIAQKINKGSIVAIKGMGGFHLICDANNDKVVEKLRIRKSRLNKPFAIMFKDINSIKNYTDLTQKEEELLNSKEKPIVLVKKKKKFNLSQLLAPNINHLGCFIAYTALHHLLFRYLDNPIVATSANLKGEPIITSKDEIIEKLSNVVDFVLDFNRDILNASDDSVIQIVDNNITKIRNARGYAPTAFSFENKSKKKILSLGANQKSTISLYFENNLILSPYIGDLNSLKSMEYFERTIKTFKRFYDFEPEVIVCDKHPNYESTKFALKLKQTNPNLELVQIQHHYAHVLSVMAEYKLNKDVLAFIFDGTGYGDDGNIWGGEVFVASKTEYKRVNHFKYFKLLGGEKAVLEPKRLALSLLFDSFSLEEVLNLEIPCVKVFKESEIKMFHTMWQKGLNSPLTSSVGRLFDAVASFANILHIQSYEGETGLQIEQYYDKTITQSYAYEIIEDKIELSFMIKQMILEKDKKQICSKFINTIGQIILDISNLHKDLPIVLGGGVFQNRTLLELLINMFKDQNREFYYNKNIPLNDGGISVGQIYHII
>CP032100.1|AXX89566.1|1111347_1111764_+|hypothetical-protein
MIRTTALISDEDGYKKYNLFEIHENLEPIIADDYLDFSSKNFKKAAYCELMYKKNFYDKYDETTYKEVYERYINNEKFKEKAKFIYSVIDYDKYVKFVEENQIIENPNELIISYSVVDSEGVKVQIYNIGISDISFVF
>CP032100.1|AXX89567.1|1111835_1112288_-|heme-binding-domain-containing-protein
MVGKLIIGGIITAVVIQFIPYGKTYSNPPIVSEPTWDSPQTKELFNNACANCHSNQTIYPWYSKIAPISWLVAFDVEEGREHFNVSTWGVQKKNKGDESAKELKNGDMPPWFYLPTHPEAKLSEIQTQELIIGLEKTFGKEESGKIENKK
>CP032100.1|AXX89568.1|1112456_1112810_+|Cupin-domain-containing-protein
MDKYCNNSVAFESTCIPKTVNASISVLTPKEDKDFIVRKVTLAKDGSMPNHINEIQHQQYVLKGEAKVMVGDEEYHAKAGDFIYIPAGVAHKYEACYNSGYEFLCMITTKEDKITML
>CP032100.1|AXX89569.1|1112845_1114933_+|formate-dehydrogenase-H,-cysteine-containing
MQESNINSVCTYCGTGCDITAQVENNKIVKIYAQNDGYVSQGKLCIKGAQGYGFVDSNERIRNSRVKKSFIEKNIEELPQELKARAKTLKEFNELYFEAPYEFATSLAAWKLMDIKEKYGRHAFCGMGGARTSCESSYMFQKFVREAMDSPHVDNCARVCHSPSLKGMRTTIGEGAATNPFDDIFKTENIVVMGSNTTEAHPIVANRMIKAARDKTATLSVIDVRQTQLSKFGEQLIIPYEANLLVLNMMAYVILSEKLYNTEFIDSRCTGFEAYKESILNDPYANPEFMAQVKGYEYLVEQIPQVARLYATKKSMFFWGLGITEHLDGSYAVMAITHLAMMTGNIGKTGTGLMPLRGQNNVQGACDTGCLPYYGPDYTVPEEIGLMTPQLIDEMIAGRIKAMYVMGEDIAHIHPNQNKVHKGLANLELIISNELFMNEITKMADIIFGVKSAYEKTGVYVNAMRRLHLSQPLVKTDLPDDWEVLRDIENKINGEFEFKNSEDVWNEAKEAVGSRFSGATYHKLSNNRNRGMLWPIKKEDTPILHVEDFRTEDGKGTFAYHQYQLREQVKKLVNKEEFAKNEFYLTTGRTIVQYNNAAQTQRSEALNSKYDKDVVLASIEDKDRIGSDNIIMRTQYGETAVLPVKFVKTIKQGTLFTTFHHAASKVNYIFGDEADELIMTAKFKSIRVEVESIKD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP032100_4	4.2\|2403632\|24\|CP032100\|CRT	2403632-2403655	24	MN855910	Bacteriophage sp. isolate 423, complete genome	3764-3787	4	0.833
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	985206-985232	4	0.852
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NZ_CP031172	Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence	18032-18058	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MT311645	Salmonella phage vB_Sen-E22, complete genome	7941-7967	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK972716	Salmonella phage SE8, complete genome	106875-106901	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MF774688	Salmonella phage SP1a clone contig.00002 genomic sequence	15426-15452	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MH370378	Salmonella phage S131, complete genome	68171-68197	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MH370377	Salmonella phage S130, partial genome	68171-68197	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	KY775452	Salmonella phage Stp1 contig.00002 genomic sequence	14655-14681	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_048865	Salmonella phage oldekolle, complete genome	81518-81544	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_048857	Phage NBSal005, complete genome	82019-82045	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK867835	Salmonella phage vB_SenS_SB9, complete genome	70915-70941	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MG969412	UNVERIFIED: Salmonella phage GE_vB_N5, complete genome	79014-79040	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_047881	Shigella phage SSP1, complete genome	102628-102654	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MN994502	Phage NBSal003, complete genome	81396-81422	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_047822	Escherichia phage phiLLS, complete genome	45787-45813	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK972715	Salmonella phage SE11, complete genome	30988-31014	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	LN887948	Escherichia phage slur09 genome assembly slu09, chromosome : 1	94793-94819	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	LR597655	Escherichia phage T5_ev219 genome assembly, chromosome: 1	39134-39160	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MF431732	Bacteriophage T5-like pork29, complete genome	39417-39443	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	LR597659	Escherichia phage T5_ev212 genome assembly, chromosome: 1	38741-38767	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MT653146	Salmonella phage 8sent1748, complete genome	38994-39020	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MF431731	Bacteriophage T5-like pork27, complete genome	39416-39442	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	AY543070	Bacteriophage T5, complete genome	39171-39197	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MT233524	Salmonella phage vB_Sen_I1, complete genome	100867-100893	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_047835	Escherichia phage OSYSP, complete genome	11975-12001	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	AY587007	Bacteriophage T5 strain ATCC 11303-B5, complete genome	39092-39118	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK373799	Escherichia phage vB_EcoS_EASG3, complete genome	38980-39006	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_048853	Phage NBEco001, complete genome	36058-36084	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK373797	Escherichia phage vB_EcoS_HASG4, complete genome	39019-39045	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK373796	Escherichia phage vB_EcoS_HdH2, complete genome	37538-37564	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MF431733	Bacteriophage T5-like saus47N, complete genome	39417-39443	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_005859	Enterobacteria phage T5, complete genome	39171-39197	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	AY734508	Bacteriophage T5 hypothetical protein (T5p066) gene, partial cds; RNA3 (rna3) and tRNA-Asn (tRNAN) genes, complete sequence; hypothetical protein (T5p067) gene, complete cds; tRNA-Cys (tRNAC) gene, complete sequence; hypothetical protein (T5p068) and hypothetical protein (T5p069) genes, complete cds; tRNA-Phe (tRNAF), tRNA-Trp (tRNAW), tRNA-Glu (tRNAE), and tRNA-Tyr (tRNAY) genes, complete sequence; hypothetical protein (T5p070), hypothetical protein (T5p071), hypothetical protein (T5p072), and HNH endonuclease (T5p073) genes, complete cds; tRNA-Ile (tRNAI2) and tRNA-Ser (tRNAS3) genes, complete sequence; DNA primase-like protein (T5p074), hypothetical protein (T5p075), hypothetical protein (T5p076), hypothetical protein (T5p077), and putative membrane protease (T5p078) genes, complete cds; tRNA-Arg (tRNAR) and RNAX (rnaX) genes, complete sequence; and hypothetical protein (T5p079) gene, partial cds	5491-5517	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MF431735	Bacteriophage T5-like poul124, complete genome	39426-39452	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	AP019559	Escherichia phage SP15 DNA, complete genome	37839-37865	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MN956514	Salmonella phage L6jm, complete genome	38308-38334	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MK373792	Escherichia phage vB_EcoS_VAH1, complete genome	31502-31528	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MN316588	Escherichia virus VEc33, complete genome	39120-39146	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MT653143	Salmonella phage 3sent1, complete genome	36707-36733	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	AJ604530	Enterobacteria phage BF23 tRNA gene region	11973-11999	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	AJ604531	Bacteriophage 5 tRNA gene region	11225-11251	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MF431734	Bacteriophage T5-like saus111K, complete genome	39417-39443	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MN026741	Salmonella phage Th1, complete genome	38539-38565	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_015269	Enterobacteria phage SPC35, complete genome	37330-37356	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_048000	Salmonella phage LVR16A, partial genome	51425-51451	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_024139	Escherichia phage vB_EcoS_FFH1, complete genome	37634-37660	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_047885	Bacteriophage T5-like chee24, complete genome	39417-39443	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MN022787	Salmonella virus VSe12, complete genome	38536-38562	5	0.815
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1332811-1332837	6	0.778
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MH102285	Salmonella phage vB_SenS_PHB06, partial genome	64549-64575	6	0.778
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	309840-309866	6	0.778
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	NC_031042	Salmonella phage NR01, complete genome	4742-4768	6	0.778
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	MG387042	Salmonella phage SP3, partial genome	33986-34012	6	0.778
CP032100_4	4.3\|2403674\|27\|CP032100\|CRT	2403674-2403700	27	KU645528	Acidianus tailed spindle virus isolate 1, complete genome	31282-31308	7	0.741

1. spacer 4.2|2403632|24|CP032100|CRT matches to MN855910 (Bacteriophage sp. isolate 423, complete genome) position: , mismatch: 4, identity: 0.833

ctgtagcagtaacaggagttgttt	CRISPR spacer
ttgtagcagtaacagtagttgtac	Protospacer
.************** ****** .

2. spacer 4.3|2403674|27|CP032100|CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

gagttgctggagttgttggtgcaactt	CRISPR spacer
gagttgctggagttgttgttgcagccc	Protospacer
****************** ****.*..

3. spacer 4.3|2403674|27|CP032100|CRT matches to NZ_CP031172 (Lactobacillus brevis strain UCCLBBS124 plasmid pUCCLBBS124_C, complete sequence) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
tcgttgcttgagttgttggtgctacat	Protospacer
  ****** ************* ** *

4. spacer 4.3|2403674|27|CP032100|CRT matches to MT311645 (Salmonella phage vB_Sen-E22, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

5. spacer 4.3|2403674|27|CP032100|CRT matches to MK972716 (Salmonella phage SE8, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

6. spacer 4.3|2403674|27|CP032100|CRT matches to MF774688 (Salmonella phage SP1a clone contig.00002 genomic sequence) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

7. spacer 4.3|2403674|27|CP032100|CRT matches to MH370378 (Salmonella phage S131, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

8. spacer 4.3|2403674|27|CP032100|CRT matches to MH370377 (Salmonella phage S130, partial genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

9. spacer 4.3|2403674|27|CP032100|CRT matches to KY775452 (Salmonella phage Stp1 contig.00002 genomic sequence) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

10. spacer 4.3|2403674|27|CP032100|CRT matches to NC_048865 (Salmonella phage oldekolle, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

11. spacer 4.3|2403674|27|CP032100|CRT matches to NC_048857 (Phage NBSal005, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

12. spacer 4.3|2403674|27|CP032100|CRT matches to MK867835 (Salmonella phage vB_SenS_SB9, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

13. spacer 4.3|2403674|27|CP032100|CRT matches to MG969412 (UNVERIFIED: Salmonella phage GE_vB_N5, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

14. spacer 4.3|2403674|27|CP032100|CRT matches to NC_047881 (Shigella phage SSP1, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

15. spacer 4.3|2403674|27|CP032100|CRT matches to MN994502 (Phage NBSal003, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

16. spacer 4.3|2403674|27|CP032100|CRT matches to NC_047822 (Escherichia phage phiLLS, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

17. spacer 4.3|2403674|27|CP032100|CRT matches to MK972715 (Salmonella phage SE11, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

18. spacer 4.3|2403674|27|CP032100|CRT matches to LN887948 (Escherichia phage slur09 genome assembly slu09, chromosome : 1) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

19. spacer 4.3|2403674|27|CP032100|CRT matches to LR597655 (Escherichia phage T5_ev219 genome assembly, chromosome: 1) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

20. spacer 4.3|2403674|27|CP032100|CRT matches to MF431732 (Bacteriophage T5-like pork29, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

21. spacer 4.3|2403674|27|CP032100|CRT matches to LR597659 (Escherichia phage T5_ev212 genome assembly, chromosome: 1) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

22. spacer 4.3|2403674|27|CP032100|CRT matches to MT653146 (Salmonella phage 8sent1748, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

23. spacer 4.3|2403674|27|CP032100|CRT matches to MF431731 (Bacteriophage T5-like pork27, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

24. spacer 4.3|2403674|27|CP032100|CRT matches to AY543070 (Bacteriophage T5, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

25. spacer 4.3|2403674|27|CP032100|CRT matches to MT233524 (Salmonella phage vB_Sen_I1, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

26. spacer 4.3|2403674|27|CP032100|CRT matches to NC_047835 (Escherichia phage OSYSP, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

27. spacer 4.3|2403674|27|CP032100|CRT matches to AY587007 (Bacteriophage T5 strain ATCC 11303-B5, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

28. spacer 4.3|2403674|27|CP032100|CRT matches to MK373799 (Escherichia phage vB_EcoS_EASG3, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
ggtttgctggagttgttgctgcatctg	Protospacer
*. *************** **** **

29. spacer 4.3|2403674|27|CP032100|CRT matches to NC_048853 (Phage NBEco001, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgttgcatctg	Protospacer
*  *************** **** **

30. spacer 4.3|2403674|27|CP032100|CRT matches to MK373797 (Escherichia phage vB_EcoS_HASG4, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
ggtttgctggagttgttgctgcatctg	Protospacer
*. *************** **** **

31. spacer 4.3|2403674|27|CP032100|CRT matches to MK373796 (Escherichia phage vB_EcoS_HdH2, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

32. spacer 4.3|2403674|27|CP032100|CRT matches to MF431733 (Bacteriophage T5-like saus47N, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

33. spacer 4.3|2403674|27|CP032100|CRT matches to NC_005859 (Enterobacteria phage T5, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

34. spacer 4.3|2403674|27|CP032100|CRT matches to AY734508 (Bacteriophage T5 hypothetical protein (T5p066) gene, partial cds; RNA3 (rna3) and tRNA-Asn (tRNAN) genes, complete sequence; hypothetical protein (T5p067) gene, complete cds; tRNA-Cys (tRNAC) gene, complete sequence; hypothetical protein (T5p068) and hypothetical protein (T5p069) genes, complete cds; tRNA-Phe (tRNAF), tRNA-Trp (tRNAW), tRNA-Glu (tRNAE), and tRNA-Tyr (tRNAY) genes, complete sequence; hypothetical protein (T5p070), hypothetical protein (T5p071), hypothetical protein (T5p072), and HNH endonuclease (T5p073) genes, complete cds; tRNA-Ile (tRNAI2) and tRNA-Ser (tRNAS3) genes, complete sequence; DNA primase-like protein (T5p074), hypothetical protein (T5p075), hypothetical protein (T5p076), hypothetical protein (T5p077), and putative membrane protease (T5p078) genes, complete cds; tRNA-Arg (tRNAR) and RNAX (rnaX) genes, complete sequence; and hypothetical protein (T5p079) gene, partial cds) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

35. spacer 4.3|2403674|27|CP032100|CRT matches to MF431735 (Bacteriophage T5-like poul124, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

36. spacer 4.3|2403674|27|CP032100|CRT matches to AP019559 (Escherichia phage SP15 DNA, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgttgcatctg	Protospacer
*  *************** **** **

37. spacer 4.3|2403674|27|CP032100|CRT matches to MN956514 (Salmonella phage L6jm, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

38. spacer 4.3|2403674|27|CP032100|CRT matches to MK373792 (Escherichia phage vB_EcoS_VAH1, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

39. spacer 4.3|2403674|27|CP032100|CRT matches to MN316588 (Escherichia virus VEc33, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

40. spacer 4.3|2403674|27|CP032100|CRT matches to MT653143 (Salmonella phage 3sent1, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

41. spacer 4.3|2403674|27|CP032100|CRT matches to AJ604530 (Enterobacteria phage BF23 tRNA gene region) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

42. spacer 4.3|2403674|27|CP032100|CRT matches to AJ604531 (Bacteriophage 5 tRNA gene region) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

43. spacer 4.3|2403674|27|CP032100|CRT matches to MF431734 (Bacteriophage T5-like saus111K, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

44. spacer 4.3|2403674|27|CP032100|CRT matches to MN026741 (Salmonella phage Th1, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

45. spacer 4.3|2403674|27|CP032100|CRT matches to NC_015269 (Enterobacteria phage SPC35, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

46. spacer 4.3|2403674|27|CP032100|CRT matches to NC_048000 (Salmonella phage LVR16A, partial genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

47. spacer 4.3|2403674|27|CP032100|CRT matches to NC_024139 (Escherichia phage vB_EcoS_FFH1, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

48. spacer 4.3|2403674|27|CP032100|CRT matches to NC_047885 (Bacteriophage T5-like chee24, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

49. spacer 4.3|2403674|27|CP032100|CRT matches to MN022787 (Salmonella virus VSe12, complete genome) position: , mismatch: 5, identity: 0.815

gagttgctggagttgttggtgcaactt	CRISPR spacer
gttttgctggagttgttgctgcatctg	Protospacer
*  *************** **** **

50. spacer 4.3|2403674|27|CP032100|CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 6, identity: 0.778

gagttgctggagttgttggtgcaactt	CRISPR spacer
atgttgctgcagttgttggtgaaaccg	Protospacer
. ******* *********** ***.

51. spacer 4.3|2403674|27|CP032100|CRT matches to MH102285 (Salmonella phage vB_SenS_PHB06, partial genome) position: , mismatch: 6, identity: 0.778

gagttgctggagttgttggtgcaactt	CRISPR spacer
attttgctggagttgttgctgcatctg	Protospacer
.  *************** **** **

52. spacer 4.3|2403674|27|CP032100|CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 6, identity: 0.778

gagttgctggagttgttggtgcaactt	CRISPR spacer
atgttgctgcagttgttggtgaaaccg	Protospacer
. ******* *********** ***.

53. spacer 4.3|2403674|27|CP032100|CRT matches to NC_031042 (Salmonella phage NR01, complete genome) position: , mismatch: 6, identity: 0.778

gagttgctggagttgttggtgcaactt	CRISPR spacer
attttgctggagttgttgctgcatctg	Protospacer
.  *************** **** **

54. spacer 4.3|2403674|27|CP032100|CRT matches to MG387042 (Salmonella phage SP3, partial genome) position: , mismatch: 6, identity: 0.778

gagttgctggagttgttggtgcaactt	CRISPR spacer
attttgctggagttgttgctgcatctg	Protospacer
.  *************** **** **

55. spacer 4.3|2403674|27|CP032100|CRT matches to KU645528 (Acidianus tailed spindle virus isolate 1, complete genome) position: , mismatch: 7, identity: 0.741

gagttgctggagttgttggtgcaactt	CRISPR spacer
cagttgctgtagttgttggtgctttag	Protospacer
 ******** ************  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

848450 : 932530

100

Vibrio_phage(12.5%)

tail,tRNA,protease,transposase,terminase,capsid,head,portal,integrase

attL 845250:845268|attR 906713:906731

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
845250:845268	attL	NA	NA	NA	NA
AXX89289.1\|848450_849596_+\|integrase	site-specific tyrosine recombinase, phage integrase family (INT_Rci_Hp1_C domain)	A0A067ZJC0	Vibrio_phage	1.5e-29	29.7
AXX89290.1\|849768_850122_+	hypothetical protein	NA	NA	NA	NA
AXX89291.1\|850294_851659_-	toxin-antitoxin system, toxin component, HipA family	NA	NA	NA	NA
AXX89292.1\|851792_852635_+	hypothetical protein	NA	NA	NA	NA
AXX89293.1\|852880_853927_-	hypothetical protein	NA	NA	NA	NA
AXX89294.1\|854098_855643_-	hypothetical protein	NA	NA	NA	NA
AXX89295.1\|856027_856585_+	hypothetical protein	NA	NA	NA	NA
AXX89296.1\|857025_858162_+	Fic family protein (DUF4172 domain)	A0A1V0E025	Clostridioides_phage	6.6e-06	27.7
AXX89297.1\|858200_858764_-	resolvase	M9Q1K0	Clostridium_phage	1.0e-28	40.1
AXX89298.1\|859154_859847_-	two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	4.4e-05	26.2
AXX89299.1\|859849_862528_-	two-component system sensor histidine kinase	W8CYF6	Bacillus_phage	2.3e-09	24.2
AXX89300.1\|862508_863099_-	potassium-transporting ATPase, subunit C	NA	NA	NA	NA
AXX89301.1\|863109_865131_-	potassium-transporting ATPase, subunit B	M1HRW9	Paramecium_bursaria_Chlorella_virus	1.2e-26	27.0
AXX89302.1\|865140_866838_-	potassium-transporting ATPase, subunit A	NA	NA	NA	NA
AXX89303.1\|870023_870260_-	hypothetical protein	NA	NA	NA	NA
AXX89304.1\|870269_870491_-	DNA-binding protein (HTH domain)	NA	NA	NA	NA
AXX89305.1\|870795_871512_+	hypothetical protein	NA	NA	NA	NA
AXX89306.1\|871818_872949_+\|integrase	site-specific tyrosine recombinase, phage integrase family (INT_Rci_Hp1_C domain)	A0A067ZJC0	Vibrio_phage	2.5e-34	31.5
AXX89307.1\|872941_873187_-	hypothetical protein	NA	NA	NA	NA
AXX89308.1\|873179_873392_-	hypothetical protein	NA	NA	NA	NA
AXX89309.1\|873385_873787_-	hypothetical protein	NA	NA	NA	NA
AXX89310.1\|873914_874181_-	hypothetical protein	NA	NA	NA	NA
AXX89311.1\|874222_875920_-	hypothetical protein	I3NLC2	Bifidobacterium_phage	1.3e-13	30.9
AXX89312.1\|875922_876210_-	hypothetical protein	NA	NA	NA	NA
AXX89313.1\|876190_876478_-	hypothetical protein	NA	NA	NA	NA
AXX89314.1\|876461_877073_-	ParA-like protein	J9Q7R7	Salmonella_phage	1.7e-13	26.7
AXX89315.1\|877087_877465_-	hypothetical protein	NA	NA	NA	NA
AXX89316.1\|877467_877674_-	hypothetical protein	NA	NA	NA	NA
AXX89317.1\|877687_878011_-	hypothetical protein	NA	NA	NA	NA
AXX89318.1\|878396_878585_-	hypothetical protein	NA	NA	NA	NA
AXX89319.1\|879140_879737_-	hypothetical protein	NA	NA	NA	NA
AXX89320.1\|879723_880788_-	type IIG restriction/modification system	A0A1S5SAB0	Streptococcus_phage	7.6e-65	39.4
AXX89321.1\|880824_881460_-	peptidase S24 LexA-like protein	NA	NA	NA	NA
AXX89322.1\|881560_881788_+	putative transcriptional regulator, XRE family	NA	NA	NA	NA
AXX89323.1\|881787_882288_+	hypothetical protein	NA	NA	NA	NA
AXX89324.1\|882291_882462_+	hypothetical protein	NA	NA	NA	NA
AXX89325.1\|882454_882673_+	hypothetical protein	NA	NA	NA	NA
AXX89326.1\|882665_884036_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	1.0e-29	27.7
AXX89327.1\|884035_884224_+	hypothetical protein	NA	NA	NA	NA
AXX89328.1\|884216_885071_+	hypothetical protein	NA	NA	NA	NA
AXX89329.1\|885067_885439_+	hypothetical protein	NA	NA	NA	NA
AXX89330.1\|885435_885777_+	HNH endonuclease domain-containing protein	X2KQ74	Campylobacter_phage	2.6e-19	48.4
AXX89331.1\|885873_886443_+\|terminase	phage terminase, small subunit	NA	NA	NA	NA
AXX89332.1\|886432_888082_+\|terminase	phage terminase, large subunit	A0A1W6JP18	Morganella_phage	5.1e-68	32.1
AXX89333.1\|888183_888417_-	hypothetical protein	NA	NA	NA	NA
AXX89334.1\|888728_889958_+\|portal	phage portal protein	Q6DMU2	Streptococcus_phage	4.2e-51	33.4
AXX89335.1\|889957_890689_+\|protease	ClpP-like protease	A0A2I7SCY8	Paenibacillus_phage	1.4e-22	38.7
AXX89336.1\|890691_891813_+\|capsid	phage major capsid protein	Q6DMU0	Streptococcus_phage	6.4e-62	36.7
AXX89337.1\|891824_892226_+	hypothetical protein	NA	NA	NA	NA
AXX89338.1\|892222_892789_+	hypothetical protein	NA	NA	NA	NA
AXX89339.1\|892788_893118_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AXX89340.1\|893110_893518_+	phage protein, HK97 gp10 family	NA	NA	NA	NA
AXX89341.1\|893510_893858_+	hypothetical protein	NA	NA	NA	NA
AXX89342.1\|893861_894302_+	hypothetical protein	NA	NA	NA	NA
AXX89343.1\|894301_894652_+	hypothetical protein	NA	NA	NA	NA
AXX89344.1\|894720_894960_+	hypothetical protein	NA	NA	NA	NA
AXX89345.1\|894962_897104_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	1.2e-08	23.3
AXX89346.1\|897103_897439_+	hypothetical protein	NA	NA	NA	NA
AXX89347.1\|897441_898065_+	phage-related protein	NA	NA	NA	NA
AXX89348.1\|898061_898451_+	hypothetical protein	A0A173H0M4	Pseudoalteromonas_phage	3.2e-05	52.6
AXX89349.1\|898438_902380_+\|tail	putative phage tail protein	NA	NA	NA	NA
AXX89350.1\|902381_903395_+	hypothetical protein	A0A1D8KSC4	Synechococcus_phage	2.6e-06	52.4
AXX89351.1\|903406_903877_+	hypothetical protein	NA	NA	NA	NA
AXX89352.1\|903873_904119_+	hypothetical protein	NA	NA	NA	NA
AXX89353.1\|904120_904570_+	putative membrane protein	NA	NA	NA	NA
AXX89354.1\|904566_904920_+	hypothetical protein	NA	NA	NA	NA
AXX89355.1\|904900_905170_+	hypothetical protein	NA	NA	NA	NA
AXX89356.1\|905166_905751_+	transglycosylase	K7RVN3	Vibrio_phage	6.1e-24	38.7
AXX89357.1\|905847_906234_-	superoxide reductase-like protein	NA	NA	NA	NA
AXX89358.1\|906377_907199_+	thiamine monophosphate kinase	NA	NA	NA	NA
906713:906731	attR	NA	NA	NA	NA
AXX89359.1\|907225_908290_+\|tRNA	tRNA pseudouridine 13 synthase	NA	NA	NA	NA
AXX89360.1\|908368_908722_+	hypothetical protein	NA	NA	NA	NA
AXX89361.1\|908762_910940_-	MCP-domain signal transduction protein (DUF3365 domain)	NA	NA	NA	NA
AXX89362.1\|911047_911611_+	RuvABC resolvasome, subunit RuvA	NA	NA	NA	NA
AXX89363.1\|911636_912677_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
AXX89364.1\|912680_913400_+	alpha/beta hydrolase family protein	NA	NA	NA	NA
AXX89365.1\|913386_914823_+	D-alanyl-D-alanine-adding enzyme	NA	NA	NA	NA
AXX89366.1\|914837_915326_+	histidine triad nucleotide-binding protein, Fhit branch	NA	NA	NA	NA
AXX89367.1\|915397_916627_+	putative membrane protein	NA	NA	NA	NA
AXX89368.1\|916661_917912_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AXX89369.1\|918445_919420_-	hypothetical protein	NA	NA	NA	NA
AXX89370.1\|919445_920096_-	peptidase S24 LexA-like protein	A0A0M3LPF9	Mannheimia_phage	1.1e-13	31.5
AXX89371.1\|920512_920695_+	hypothetical protein	NA	NA	NA	NA
AXX89372.1\|920704_920938_+	hypothetical protein	NA	NA	NA	NA
AXX89373.1\|920939_923045_+	prophage Mu, DNA transposition protein A	NA	NA	NA	NA
AXX89374.1\|923053_923758_+	putative prophage Mu, DNA transposition protein B	NA	NA	NA	NA
AXX89375.1\|923747_924581_+	hypothetical protein	NA	NA	NA	NA
AXX89376.1\|924568_924796_+	hypothetical protein	NA	NA	NA	NA
AXX89377.1\|924911_925193_+	hypothetical protein	NA	NA	NA	NA
AXX89378.1\|925249_925915_+	DUF3164 domain-containing protein	Q5ZR10	Pseudomonas_phage	5.7e-18	33.3
AXX89379.1\|925911_926448_+	hypothetical protein	A0A142EZL8	Stenotrophomonas_phage	2.6e-13	47.3
AXX89380.1\|926449_926677_+	hypothetical protein	NA	NA	NA	NA
AXX89381.1\|926780_927005_+	hypothetical protein	NA	NA	NA	NA
AXX89382.1\|927286_927598_+	hypothetical protein	NA	NA	NA	NA
AXX89383.1\|927584_928499_+	hypothetical protein	NA	NA	NA	NA
AXX89384.1\|928793_929228_+	DUF1018 domain-containing protein	NA	NA	NA	NA
AXX89385.1\|929175_930336_-	putAbiC domain-containing protein	NA	NA	NA	NA
AXX89386.1\|930563_931409_-	putAbiC domain-containing protein	NA	NA	NA	NA
AXX89387.1\|931503_931956_-\|transposase	IS3 family transposase orfB	U5P429	Shigella_phage	5.7e-38	53.6
AXX89388.1\|931987_932530_-\|transposase	IS3 family transposase orfA	NA	NA	NA	NA

DBSCAN-SWA_2

2071374 : 2081273

Prochlorococcus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX90510.1\|2071374_2072382_+	ADP-L-glycero-D-mannoheptose-6-epimerase	Q58M42	Prochlorococcus_phage	7.8e-27	36.4
AXX90511.1\|2072382_2073819_+	D,D-heptose 1-phosphate adenosyltransferase / D,D-heptose 7-phosphate kinase	A0A0K0KVL9	Prochlorococcus_phage	1.6e-25	48.0
AXX90512.1\|2073802_2074369_+	sedoheptulose 7-phosphate isomerase	A0A067XQR2	Caulobacter_phage	1.1e-17	36.5
AXX90513.1\|2074386_2074956_-	acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.3e-31	47.4
AXX90514.1\|2074952_2075918_-	glycosyltransferase, family 1	NA	NA	NA	NA
AXX90515.1\|2075914_2076760_-	glycosyltransferase, family 2	A0A1V0SAH6	Catovirus	1.2e-12	25.3
AXX90516.1\|2076756_2077866_-	dTDP-4-amino-4,6-dideoxygalactose transaminase	A0A2P1ELT3	Moumouvirus	8.0e-33	33.9
AXX90517.1\|2077879_2078467_-	sugar O-acyltransferase	NA	NA	NA	NA
AXX90518.1\|2078453_2078930_-	WxcM-like sugar acyltransferase	NA	NA	NA	NA
AXX90519.1\|2078965_2079361_-	WxcM-like domain-containing protein	NA	NA	NA	NA
AXX90520.1\|2080394_2081273_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	6.1e-36	37.4

DBSCAN-SWA_3

2309125 : 2316099

Campylobacter_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX90724.1\|2309125_2309809_+	7-cyano-7-deazaguanine synthase	R4TAI3	Halovirus	9.6e-29	34.4
AXX90725.1\|2309808_2310342_+	6-carboxy-5,6,7,8-tetrahydropterin synthase	H6SU72	Campylobacter_virus	2.0e-45	51.1
AXX90726.1\|2310334_2311099_+	7-carboxy-7-deazaguanine synthase	D5GV09	Campylobacter_virus	1.3e-50	43.7
AXX90727.1\|2311170_2311914_+	3-oxoacyl-[acp] reductase	Q06VL0	Trichoplusia_ni_ascovirus	5.0e-15	29.4
AXX90728.1\|2312006_2312237_+	acyl carrier protein	M4QDG5	Prochlorococcus_phage	1.2e-07	64.2
AXX90729.1\|2312350_2313607_+	beta-ketoacyl-[acp] synthase II (KASII)	NA	NA	NA	NA
AXX90730.1\|2313676_2314615_+	acetyl-CoA carboxylase, carboxyltransferase, alpha subunit	NA	NA	NA	NA
AXX90731.1\|2314634_2314976_-	histidine triad nucleotide-binding protein, Hint/PKCI branch	NA	NA	NA	NA
AXX90732.1\|2315106_2316099_+\|tRNA	phenylalanyl-tRNA synthetase, alpha subunit	A0A2I2L4E3	Orpheovirus	2.1e-32	34.9

DBSCAN-SWA_4

2349728 : 2360138

Staphylococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX90767.1\|2349728_2351783_-	UvrD/REP family helicase	A7KV33	Bacillus_phage	2.9e-105	37.0
AXX90768.1\|2351899_2352796_+	transcriptional regulator, LysR family	NA	NA	NA	NA
AXX90769.1\|2352820_2353783_-	radical SAM protein, TIGR01212 family	A0A2H4PQV5	Staphylococcus_phage	1.6e-13	31.7
AXX90770.1\|2353784_2355131_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	7.7e-54	34.1
AXX90771.1\|2355143_2355917_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
AXX90772.1\|2355933_2356863_-	thioredoxin reductase	G3MA85	Bacillus_virus	7.9e-58	41.6
AXX90773.1\|2357079_2357397_-	thioredoxin	A0A1X9I9P5	Staphylococcus_phage	1.1e-19	43.3
AXX90774.1\|2357582_2360138_+\|tRNA	alanyl-tRNA synthetase	A0A1V0SK38	Klosneuvirus	7.9e-76	35.9

DBSCAN-SWA_5

2594932 : 2604962

Staphylococcus_phage(12.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXX91000.1\|2594932_2596159_-	flavoprotein, HI0933 family	A0A2H4PQX1	Staphylococcus_phage	3.1e-09	36.3
AXX91001.1\|2596267_2597269_+	ATP-binding protein (AAA domain)	H6WG28	Cyanophage	1.4e-60	42.7
AXX91002.1\|2597271_2598414_+	putative metallopeptidase (DUF2201 domain)	A0A2I7SAP6	Vibrio_phage	2.2e-25	25.7
AXX91003.1\|2598415_2598730_-	Cupin domain-containing protein	NA	NA	NA	NA
AXX91004.1\|2598942_2600211_+	O-acetylhomoserine sulfhydrylase	A0A0B5JD48	Pandoravirus	3.9e-15	27.1
AXX91005.1\|2600223_2600637_+	transcriptional regulator, IscR/Rrf2 family	NA	NA	NA	NA
AXX91006.1\|2600657_2601590_+	cysteine synthase	A0A1X9I5K7	Streptococcus_phage	7.8e-82	53.7
AXX91007.1\|2601632_2601863_+	DUF2061 domain-containing protein	A0A1B0XTK5	Freshwater_phage	2.0e-07	38.7
AXX91008.1\|2601871_2602576_+	phosphoadenosine phosphosulfate reductase	A0A0K2CZZ1	Bacillus_phage	1.9e-08	23.8
AXX91009.1\|2602588_2603503_+	sulfate adenylyltransferase, subunit CysD	NA	NA	NA	NA
AXX91010.1\|2603504_2604962_+	sulfate adenylyltransferase, GTPase subunit CysN	A0A1V0SGC3	Hokovirus	1.7e-30	30.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage