CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP023041	Komagataeibacter saccharivorans strain CV1 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
CP023039	Komagataeibacter saccharivorans strain CV1 plasmid unnamed3, complete sequence	0 crisprs	c2c9_V-U4	0	1
CP023042	Komagataeibacter saccharivorans strain CV1 plasmid unnamed6	0 crisprs	NA	0	0
CP023037	Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence	1 crisprs	NA	2	0
CP023040	Komagataeibacter saccharivorans strain CV1 plasmid unnamed4, complete sequence	0 crisprs	NA	0	1
CP023038	Komagataeibacter saccharivorans strain CV1 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0
CP023036	Komagataeibacter saccharivorans strain CV1 chromosome, complete genome	0 crisprs	DinG,DEDDh,csa3	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP023037_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP023037_1

86766-86901

Orphan

Consensus_repeat	Method
CATGGAAATTTCCCCGGGGAAACT	PILER-CR

2 spacers

The CRISPR arrays of CP023037_1

>merge|CP023037|1|86766-86901|PILER-CR
CATGGAAGTTTCCCCGGGGAAATTATCAGGAAGGGCCGACAGGAAGTCTAATGAAGTGGCGCAATTGAATTTCCCCGGGGAAACTTTGGCCCGATAGGGGGGATAGGGCTGGCATGGAAATTTCCCCGGGGAAACC

>CP023037|1|1|86766-86901|PILER-CR
CATGGAAGTTTCCCCGGGGAAATT	ATCAGGAAGGGCCGACAGGAAGTCTAATGAAGTGGCGCAATTG
AATTTCCCCGGGGAAACTTTGGCC	CGATAGGGGGGATAGGGCTGGCATGGA
AATTTCCCCGGGGAAACC

Protein	Signature genes	Signature genes Name	Protein_function
CP023037.1\|AXY23813.1\|92199_93822_-\|putative-ABC-transporter-ATP-binding-protein-YheS	unknown	unknown	gnl\|CDD\|223562
CP023037.1\|AXY23812.1\|90355_91372_+\|Nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
CP023037.1\|AXY23805.1\|80717_81251_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378232
CP023037.1\|AXY23816.1\|95025_96681_-\|Oxygen-dependent-choline-dehydrogenase	unknown	unknown	gnl\|CDD\|235000
CP023037.1\|AXY23814.1\|94130_94913_+\|3-oxoacyl-[acyl-carrier-protein]-reductase-FabG	unknown	unknown	gnl\|CDD\|235546
CP023037.1\|AXY23803.1\|77291_78377_-\|Cyclic-pyranopterin-monophosphate-synthase	unknown	unknown	gnl\|CDD\|234672
CP023037.1\|AXY23811.1\|87987_89184_-\|Plasmid-partition-protein-A	unknown	unknown	gnl\|CDD\|274585
CP023037.1\|AXY23800.1\|75650_76454_-\|formate-dehydrogenase-accessory-protein	unknown	unknown	gnl\|CDD\|376873
CP023037.1\|AXY23799.1\|74856_75309_-\|Transcriptional-regulatory-protein-ros	unknown	unknown	gnl\|CDD\|368446
CP023037.1\|AXY23817.1\|96698_98798_-\|NAD/NADP-dependent-betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|183918
CP023037.1\|AXY23806.1\|81306_81456_-\|hypothetical-protein	unknown	unknown	unknown
CP023037.1\|AXY23818.1\|99474_101835_+\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
CP023037.1\|AXY23815.1\|94930_95062_+\|hypothetical-protein	unknown	unknown	unknown
CP023037.1\|AXY23802.1\|76913_77156_-\|Molybdopterin-synthase-sulfur-carrier-subunit	unknown	unknown	gnl\|CDD\|340452
CP023037.1\|AXY23807.1\|81442_82462_-\|Cytochrome-bd-II-ubiquinol-oxidase-subunit-2	unknown	unknown	gnl\|CDD\|376764
CP023037.1\|AXY23804.1\|78391_80695_-\|Formate-dehydrogenase-H	unknown	unknown	gnl\|CDD\|273765
CP023037.1\|AXY23810.1\|86910_87936_-\|Chromosome-partitioning-protein-Spo0J	unknown	unknown	gnl\|CDD\|272946
CP023037.1\|AXY23819.1\|102299_102830_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379112
CP023037.1\|AXY23808.1\|82465_83899_-\|Cytochrome-bd-II-ubiquinol-oxidase-subunit-1	unknown	unknown	gnl\|CDD\|376587
CP023037.1\|AXY23801.1\|76494_76902_-\|Molybdopterin-synthase-catalytic-subunit-1	unknown	unknown	gnl\|CDD\|238385

Protein	Function_ID	Function_description	E-value
CP023037.1\|AXY23813.1\|92199_93822_-\|putative-ABC-transporter-ATP-binding-protein-YheS	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
CP023037.1\|AXY23812.1\|90355_91372_+\|Nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	1.11583e-70
CP023037.1\|AXY23805.1\|80717_81251_-\|hypothetical-protein	gnl\|CDD\|378232	pfam09655, Nitr_red_assoc, Conserved nitrate reductase-associated protein (Nitr_red_assoc). Proteins in this entry are found in the Cyanobacteria, and are mostly encoded near nitrate reductase and molybdopterin biosynthesis genes. Molybdopterin guanine dinucleotide is a cofactor for nitrate reductase. These proteins are sometimes annotated as nitrate reductase-associated proteins, though their function is unknown.	1.00475e-67
CP023037.1\|AXY23816.1\|95025_96681_-\|Oxygen-dependent-choline-dehydrogenase	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	0
CP023037.1\|AXY23814.1\|94130_94913_+\|3-oxoacyl-[acyl-carrier-protein]-reductase-FabG	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	3.20417e-82
CP023037.1\|AXY23803.1\|77291_78377_-\|Cyclic-pyranopterin-monophosphate-synthase	gnl\|CDD\|234672	PRK00164, moaA, GTP 3',8-cyclase MoaA.	2.25888e-151
CP023037.1\|AXY23811.1\|87987_89184_-\|Plasmid-partition-protein-A	gnl\|CDD\|274585	TIGR03453, partition_RepA, plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error. [Mobile and extrachromosomal element functions, Plasmid functions].	2.30681e-97
CP023037.1\|AXY23800.1\|75650_76454_-\|formate-dehydrogenase-accessory-protein	gnl\|CDD\|376873	pfam02634, FdhD-NarQ, FdhD/NarQ family. A pan-bacterial lineage of proteins. Nitrate assimilation protein, NarQ, and FdhD are required for formate dehydrogenase activity. Structurally, they possess a deaminase fold with a characteristic binding pocket, suggesting that they might bind a nucleotide or related molecule allosterically to regulate the formate dehydrogenase catalytic subunit.	2.61927e-71
CP023037.1\|AXY23799.1\|74856_75309_-\|Transcriptional-regulatory-protein-ros	gnl\|CDD\|368446	pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan.	4.01919e-52
CP023037.1\|AXY23817.1\|96698_98798_-\|NAD/NADP-dependent-betaine-aldehyde-dehydrogenase	gnl\|CDD\|183918	PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional.	0
CP023037.1\|AXY23818.1\|99474_101835_+\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	7.13406e-34
CP023037.1\|AXY23802.1\|76913_77156_-\|Molybdopterin-synthase-sulfur-carrier-subunit	gnl\|CDD\|340452	cd00754, Ubl_MoaD, ubiquitin-like (Ubl) domain found in molybdenum cofactor biosynthesis protein D (MoaD) and similar proteins. MoaD, also termed molybdopterin synthase sulfur carrier subunit, or MPT synthase subunit 1, or MPT synthase small subunit, or molybdopterin-converting factor small subunit, or molybdopterin-converting factor subunit 1, is a conserved small sulfur carrier protein that has beta-grasp ubiquitin-like (Ubl) fold involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. MoaD is activated in an ATP-dependent manner by sulfurtransferases similar to the activation mechanism of ubiquitin-activating enzyme E1.	7.81287e-18
CP023037.1\|AXY23807.1\|81442_82462_-\|Cytochrome-bd-II-ubiquinol-oxidase-subunit-2	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	1.9868e-91
CP023037.1\|AXY23804.1\|78391_80695_-\|Formate-dehydrogenase-H	gnl\|CDD\|273765	TIGR01701, Hypothetical_protein_Rv2900c/MT2968/Mb2924c., oxidoreductase alpha (molybdopterin) subunit. This model represents a well-defined clade of oxidoreductase alpha subunits most closely related to a group of formate dehydrogenases including the E. coli FdhH protein (TIGR01591). These alpha subunits contain a molybdopterin cofactor and generally associate with two other subunits which contain iron-sulfur clusters and cytochromes. The particular subunits with which this enzyme interacts and the substrate which is reduced is unknown at this time. In Ralstonia, the gene is associated with the cbb operon, but is not essential for CO2 fixation.	0
CP023037.1\|AXY23810.1\|86910_87936_-\|Chromosome-partitioning-protein-Spo0J	gnl\|CDD\|272946	TIGR00180, Probable_chromosome-partitioning_protein_ParB, ParB/RepB/Spo0J family partition protein. This model represents the most well-conserved core of a set of chromosomal and plasmid partition proteins related to ParB, including Spo0J, RepB, and SopB. Spo0J has been shown to bind a specific DNA sequence that, when introduced into a plasmid, can serve as partition site. Study of RepB, which has nicking-closing activity, suggests that it forms a transient protein-DNA covalent intermediate during the strand transfer reaction.	2.41763e-22
CP023037.1\|AXY23819.1\|102299_102830_+\|hypothetical-protein	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.89673e-29
CP023037.1\|AXY23808.1\|82465_83899_-\|Cytochrome-bd-II-ubiquinol-oxidase-subunit-1	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
CP023037.1\|AXY23801.1\|76494_76902_-\|Molybdopterin-synthase-catalytic-subunit-1	gnl\|CDD\|238385	cd00756, MoaE, MoaE family. Members of this family are involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor for a diverse group of redox enzymes. Moco biosynthesis is an evolutionarily conserved pathway present in eubacteria, archaea and eukaryotes. Moco contains a tricyclic pyranopterin, termed molybdopterin (MPT), which carries the cis-dithiolene group responsible for molybdenum ligation. This dithiolene group is generated by MPT synthase in the second major step in Moco biosynthesis. MPT synthase is a heterotetramer consisting of two large (MoaE) and two small (MoaD) subunits.	5.26199e-46

>CP023037.1|AXY23808.1|82465_83899_-|Cytochrome-bd-II-ubiquinol-oxidase-subunit-1
MQYAHDPALLLARFQFAFTVGVHIIFPAFSIGLAAYLAVLEGLWLRTGRPVFLDLYRYWIKVFSIVFGMGVVSGLVMSYEFGTNWSIFSKKAGPITGVLLSYEVMTAFFLEAGFLGVMLFGMNKVGRKLHFAATCCVSVGTLISMTWILSSNSWMQTPRGYTIDPATGRFMPADWLAIIFNPSFPFRLVHMGLAAFLSVAFIVGATGAWHMLRARKAGKISSEPVRVMFSMAMWMAAIVAPLQILAGDAHGLNTLKYQPVKIAAMEGDWDTEGRAPELLFGIPNMKTEHTDYAVRLPLAGSLILTHSLNGKVPGMKDFPRDQRPPSPIIFFSFRIMVALGMLMMLVGLWSLWLRRNSTLFTSPVFHRVALCMAPAGFLALLCGWVTTEVGRQPWTVYGLLRTSDSVSPVALSSMAFSMTAFVVVYVLVFGSGMGILVRMLGRAPQEGEHDASPAHAPEILAARMHPGVIDPSTGKGA
>CP023037.1|AXY23807.1|81442_82462_-|Cytochrome-bd-II-ubiquinol-oxidase-subunit-2
MMDFAYWLPIVWAVILVAAISIYVVLDGFDLGIGMLFALERHPGRRDVMVNTIAPVWDGNETWMVLGGAVLYGVFPGAYATLLPAFYLPIVLMLLALIFRGVAFEFRVMTRGTGREGVWNVGFMAGSAIAAFCQGAILGGVVQGIRVVDGAFAGGPLDWLTPFSILCGLAVMCGYALLGATWLIWRTTGVLEASCRRWAARLAVGLFLGIVAVSLWTPLLHAPYLRRWTDWPNILFVAPVPVLVAVLAVLFAIGLRRGHSRGPFLCALGWFFLCLSGLGITLWPYAVPPGLTLWDVSSPPSSQFFQLIGTAILLPIILTYTIYSYHVFRGKVTETDGYH
>CP023037.1|AXY23806.1|81306_81456_-|hypothetical-protein
MGITEIVHGNGDDAPPRTGTRIAWFVAIWSLSTTVFFGVASLLHLIVPR
>CP023037.1|AXY23805.1|80717_81251_-|hypothetical-protein
MLFDFERDFAGSLRCIPMIARQKLDIVGIKLSLRQWSRFTRDERGQLADLPCETAPEQATYRELVAHLIATRSDEPLRPLASRGLEAWRDADRMPDTVKTQAQADGVAPPTAAQWATLQPLQRFALVKLARSKHENENFVPAMLEFGLLQPHAGLLHDAGASPNPTAVSRGHTRMPN
>CP023037.1|AXY23804.1|78391_80695_-|Formate-dehydrogenase-H
MSNEKTPEYRPYHHPAGGWGAAGATAKVLMEQSVLVKGSRGLLSMNQPGGFKCPSCAFPDPDHRKTLEFCENGAKALAHEATKGRVTREFFEKYTVTELMQKSDYWLEMQGRLTEPMRYDAQSDRYVPVAWDDAFALIGQHLRALDSPHQAEFYTSGRTANETAFLYAIFVREFGTNNFPDCSNMCHEPTSRGLPPAIGIGKGTIVMDDFEHAEAIFVIGQNTGTNSPRMMTNLVEARKRGVPIVLINPMPERALIRFTEPQDVLQMGTFGSTPISSEFVHVRIGGDLAIFKGMMKALFEAEARGEKVLDLDFIREHTAGLEALRDDVMGCSWADITRISGIAEDQIRRIADIYMKSNATIICYGMGLTQHQEGSRLLQQVANLLLLRGNFGKPGAGIAPIRGHSNVQGDRTVGIDEKPTDAYLDRVRDAFGFEPPREHGHHVLEAIEAMEAGTARVFFGMGGNFIRAVPDTDRSYAAMRNLNLTVGVATKLNRGHLVHGKDALILPVVARSEIIRTEAGEQFVTIEDAMANVTASRGVFEPVTEHVRPETEIVCRMAMATLPASRTPWADYMVNYTLIRDKIAEVYPEIYADFSERIKNPHGLHLDIPPRRRVWQTPNGKANFLVLPGLEVNVPVRDTAMLRLATIRSHDQYNTTIYSNSDRYRGVYNTRLVIFMNRDDMAERGLANGDVIGLETYSDDGVRRYVDGLNVLDYPMPRGAIAGYYPELNPLLPLDYFDGISGTPAAKSIPVKVVESIASAPAIRIAG
>CP023037.1|AXY23803.1|77291_78377_-|Cyclic-pyranopterin-monophosphate-synthase
MNDENSSRSVSPVPPVDRHGRPLRDLRISVMDRCNFRCPYCMPEATYHEAFRFLGPRERLDFDEIERVARIAAELGVTKIRLTGGEPLLRPGLPDLVSRLRALPGIEDVALTTNGILLPRFAPALHQAGLRRVTVSLDSLDPAVFAHMSGGRGELSAVLKGVDAARAAGFEGGVKINTVVQRGVNDAGVPDILARFRHTGVAVRLIEYMDVGNRNGWDRVDVVPSDELHARIAALWPLEPLPPRYRGEVARRYRYVDGAGEIGFVSSVSAPFCGACSRARLSSDGKLYTCLFATTGTDLRALLRDSAGDAEGDQKLRATLSRIWRQRTDRYSEERARHRISPHGEEKPSRQEKIEMHYIGG
>CP023037.1|AXY23802.1|76913_77156_-|Molybdopterin-synthase-sulfur-carrier-subunit
MLNIDLQYFAQLQDAAGRAHEIRTTSAPTAADLYDELRDVYSFALEPACMRVAINAAFSPWEQPLRDGDHVVFIPPVTGG
>CP023037.1|AXY23801.1|76494_76902_-|Molybdopterin-synthase-catalytic-subunit-1
MADAPVDITTLRREILVPEAGGFCAFEGGVRQTNDGRAVTGIDYSAFVPLARTEGQAIVQEAKQRFAICHATAMHRTGYLSVGETAVWIGVAAAHRDAAFSACRYIIDEIKQRVPIWKKEHYATGVTEWVPCHTR
>CP023037.1|AXY23800.1|75650_76454_-|formate-dehydrogenase-accessory-protein
MSALFYPLDVASLSCPDEKFSLNVAEEVPVSLMFNGMFPYGTMMMTPADLKDFAYGYCITEQIVSSPAEIRSVDVVPAEDGLTLDIFIKGRALTRLMRRNVRMQTGHSSCGICGSETVPACDAVAGAPFGDGPRLSVTAIRNALHELRKWQTLNAATRMVHAAAWANNSGNIHMIREDVGRHNALDKLIGVRVCHPEVFNDGFCLLTSRYSFEMALKTVRAGIAVVVAISAPTHRAFRTAEKMNQTLIAIARHDEQTLFCGGKRLVM
>CP023037.1|AXY23799.1|74856_75309_-|Transcriptional-regulatory-protein-ros
MPESCPAFPDGHHDLLKRTVKIVVSYISNNKIPVQDMGKLIKSVYDALNGAHSVEHEKEPQKKPAVPVNRSVFPEYIICLEDGVRRKMLKRYLRTFHGMTVDEYRKRWGLPQHYPMVAPNYAIRRSSIARQAGLGQTVMHDSPDRTGPDN
>CP023037.1|AXY23810.1|86910_87936_-|Chromosome-partitioning-protein-Spo0J
MARKQSDYLKELLSSEPDGPATPPAAERVRPTTLLSRESALARVQSGQTRQVTQHLLDPARVRVWPGNARIYAQLNEQNCRELIDSIIAEGGQKVPAVVRRVTDDPAYDYEVVAGTRRHWSVQWLRNHSYPDLRFLAQVANLDDEAAFRLADLENRARQDVSDIERARNYASALTLHYDGKQKRMAERLRVSPGWLSKMLQVANIPDNILAAFSSWHDVQLKPAYNLARALGNTDAAERIAVAATRLAQEQAEARKQGHEGPSASEVMRRLLHAAQNDAASMNEAPIEIRSALGRVAMSVQSVNRQGITIRLHTGAGADTDEYLSGLKDILERLRASGKIF
>CP023037.1|AXY23811.1|87987_89184_-|Plasmid-partition-protein-A
MSEFISHIGGLAEAGERMIERLRKKAFLPESRKGLSVRIGIAEVASLLGCSTNRIRMAEEDGRLPSPTPTTNGRRPGYSIEQILHMRKVLGASPARSPMDEPAIIAVQNFKGGVGKSTVTTHLAHYLAVQGYRVLVVDCDSQASTTTLFGFNPHFNITRDETLYPYLSIDPTQEDLRYAVKRTPWPNVDLIPSNLELFDVEYELAAAGADGQSVLTARFRKLKQGLNELARDYDVVLLDPPPALGTISLAVMQAANALLVPLAATTPDFCSTVQFLSMMDQVLQQLLAAGIAIDYSFVRLICSKFDSNDPSHALVRAFMEQTFGPALLPVPILESAEISHAAIRMMSVYELAKPIGTSKTHKRCRANLDEALGQVEQLIRQSWGRVAPASEAEAIYAV
>CP023037.1|AXY23812.1|90355_91372_+|Nitronate-monooxygenase
MAGVSTPALAAAVSQAGGLGSIGVGAAGATVAHEMICQVRQQTGAPFNVNLFVHKTPEVDPVCDKAWLAWLKPLFTEFNAVPPARLHPIYRSFNDDPEMLDMLVHVKPPVVSFHFGLPVAEKISVLKATGAILLATVTSLEEACVAEAAGMDAIVAQGIEAGGHRGIFDPAGRDDALGTFALTRILVRKCRIPVIAAGGIMDAAGIAAALALGAVAAQMGTAFILCPETDADESYRKVLKGPAAFHTRMTDLVSGRPARCLANRFTGLGDSAGIPPLPDYPIAYDAGKALNKAARNCGESGFGAYWAGQGAPLARAMPVDQLMGKLKDELQEARSFGM
>CP023037.1|AXY23813.1|92199_93822_-|putative-ABC-transporter-ATP-binding-protein-YheS
MIRLDNISKHNGHRVIFIEASAALQKGEKIGLVGPNGAGKTTLFRLITGQEEPDEGHVLTDRGVTIGFFNQDVGEMAGRSAVAEVMDGAGPVAEIGTELAGLEAAMCDPERFDELETILERFGEVQARFEELGGYALEGRAREVLHGLGFSQEMMDGDVGRLSGGWKMRVALARILLMKPDVMLLDEPSNHLDLESLIWLEQFLATYDGALLMTSHDRAFMNRIINKVIEIDGGVLTSFSGDYEFYEQQRALNEKQQQAQFDRQQAMLAKEVAFIERFKARASHAAQVQSRVKKLDKIDRVEPPKRRQALSFTFPQAPRSGDAVVNLRNVDKRYGSRVIYQGLDLLIRRQERCCVLGVNGAGKSTLLKLVTGTTEPDAGTVTLGGSVKMGYFAQHAMDLLDGERTVFETLNDAFPLAGQGSLRALAGGFGFSGDDVEKSCRVLSGGEKARLVMALMLYDPPNFLVLDEPTNHLDIATKEMLIAALSDYDGTMLFVSHDRHFLAALSNRVLELGPDGLHRYDGGYTEYVARTGREAPGLHQ
>CP023037.1|AXY23814.1|94130_94913_+|3-oxoacyl-[acyl-carrier-protein]-reductase-FabG
MSEHSRPNTVSTGGRIQDKVAVITGAASGMGRATAERFATEGAKLVLADLDQEKLDAVAGELTARGCDVLAVAGDIASEADVQRLMNEAVRHFGRIDILIANAGVIPEADLASATADLWDHTMAVDGRGMFLSCKYAAAEMVKAGKGAIVCLSSISAFAGQKGQAVYGPAKFVASGLTKHLAIDLADKGVRVNAVAPGTIDTPAVAKMGKEGIEKVVSMHPLGRMGRPEEVASAILFLASDEASFITGAVLPVDGGYLAQ
>CP023037.1|AXY23815.1|94930_95062_+|hypothetical-protein
MDKSFWVPLFFKRRHPRLLYFSNGIQGGPYPPYRCRVCQSGAS
>CP023037.1|AXY23816.1|95025_96681_-|Oxygen-dependent-choline-dehydrogenase
MSEFDYIIVGAGSAGCVLANRLTETGKDKVLLLEFGGSDRSIIVQMPSALAMPMHDRRFNWFYESEPEPHLGGRRMNTPRGKGLGGSSSINGMVYVRGNPLDYQEWEDSGAQGWGYRHVLPYFRRAEGCDDGDEVYRGRSGPLHTQYGTLDNPLHEAWMKAGEQAGYVRTADYNGFRQEGFDKMAMTVKNGRRWNTANAYLRPALSRPALKVETHARVTRILFEGRRAVGLVYRQGGKETTVRARREIILSGGPVNTPQLLKLSGIGPAAELREHGISVLADRPGVGENLQDHLEFYFQVACRKPITLYSAMSKLARARIGLRWLLRKDGLGATNHFESCGFIRSRPGIRYPDIQFHFLPLAVTYDGKSLATGHGYQAHVGPMRSKSRGWVRLRSADPEDKPRIFFNYMSHPEDWEDMRNCIRLTREIFAQPAFDPYRGQEIQPGAQCQTDEQMNDFIRDKVESALHPSCTCKMGRSDDPMAVVDAETRVIGVDGLRIVDSSIMPRITNGNLNAPTVMIAEKAADHIRGIPLLAASNAPFYEAPDWQTRQR
>CP023037.1|AXY23817.1|96698_98798_-|NAD/NADP-dependent-betaine-aldehyde-dehydrogenase
MIAEETIVATEQRDDSRRTHFINMTLAVLADCGNSGTTLARIANRANVSPALLVHYFGDKDSLLGAAFQHLVNQFQHDTTQALKSAPTWRARIAAIVGCCLDSSQFRKDVGSVWLAFWGQAIHVPAIMEVQRIYQEQLLSNLSNALRPVLSEDQILPVATTIGALIDGIWLRAALQGVDEADTQAVVEQIGNFVDSCIAGRQAQKLSLPAIQQAIPDTCKSWIDGRPFASTGARFTTLNPATGEILAHVESATAHELDAAIESAGRGQKIWAAMSGTERGRILRRAADLLRENSRLLAHLETLDTGKPIAETQAVDIHSGADALEYYGSLAATINGEAMDLGSDAFGYTRREPLGITAGIGAWNYPLQIACWKSAPALACGNAMIFKPSELTPLTALRLAEIYRQAGLPDGVFNVLAGGRETGELLATAPAIRKVSLTGSVGTGRQVMASAAQSLKYVTLELGGKSPLIIFDDADIGNAVSAALLANFYSGGEICSNGTRVFVHQNIHEQFIAALKARVEKMRIGQPLDPKTQVGSLVSHDHMEKVLGYIELGKREGATLLTGGHRVTDGALAAGAFVAPTVFTNCTDDMRIMREEIFGPVMSVTTFTDEDEVVARANNTEFGLAAGIFTQNLARGHRVISRLEAGTCWINNYNITPIEMPFGGVKQSGLGRENSRLALEHYTQVKSVYVALGNVDSPY
>CP023037.1|AXY23818.1|99474_101835_+|TonB-dependent-receptor
MNGSGFLSVLMATSAISISLLPAHGLAAGVASRHAPASGSTRARATSARPAASPSGRNANTHETISVSAARSVSHGAVRSMSRAAMDQFVQGSSPMMMLSRTPGINFVSDDPLGVDTWGSSLYMRGFVQNQLGVTLDGVPLGAQDYYTYNGETINFAILSDNIERMDVSEGGGDVSVPSTTNLGGSINIYSSDPKDKYGGKVAQMFGSHNAFRTYVRADSGKLNASGTKFMISYARSDGNKWKGPGEQFDQQVNTKLVQPIGQDSNLKIFFNWNDATQFNYADQSLSMIRTLGYRNDYSYPNYAKAYAAAEGQFSGSLANFPDALDVSYYDGVTHASDYLGGLNMHLVLTRHLDWDSVVYGQAENHWGTWTTPYTASPNGSPLSEQIDFAGNQKYGFTTAFKYRIQKHTIEAGVWYENNHYYFNQDMFQEPVLGQGTPINAASGNFGTPFQRNWGMAYNTNTFQFHLEDRFRVLSNLTLRAGFRSLLVTTTGGATANDAAYNGQTDLPTGSLTSAKAFLPHINAEWHFLPGHELYVDITRNMKAYGYGGYQLGSPWGVSNQETFDQLKKTIRPETAWVYDVGYRYNSSLITGSLNAYHADFSNRLQSLTGGTIIQPISTVVNVGSVSMYGVDALLTVRPIRHLAFTNSISYNHSTYGNNIVSQGVTYALQGKKVVAFPQFMYKANLTYSFHNAEVHVDANYMSKRYFSYMNDESVPGYWMTSLGARYSFGSYGPLHNLTINFNIYNLANVRYISQIGENGLPLTGDYQSALVGAPRQYFGTVSASF
>CP023037.1|AXY23819.1|102299_102830_+|hypothetical-protein
MIGTARLTLSYHTKADFDDVHAMWSDPAVVRFINGRPLSEQESWFRLLRYRGLWDLLGYGYWCVRTKADGRYVGDVGFGNFHRPIKPALGDTPEAGWVLASWAHGQGFATEALSGMLDWMDNVRGIDRTVCLVAPENVPSVRVAEKGGYRLLREVLFDDEPTLLLERVKPEKRPVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP023037_1	1.1\|86790\|43\|CP023037\|PILER-CR	86790-86832	43	NZ_CP023037	Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence	86790-86832	0	1.0
CP023037_1	1.2\|86857\|27\|CP023037\|PILER-CR	86857-86883	27	NZ_CP023037	Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence	86851-86877	0	1.0
CP023037_1	1.1\|86790\|43\|CP023037\|PILER-CR	86790-86832	43	NZ_CP036405	Komagataeibacter saccharivorans strain JH1 plasmid p221732, complete sequence	125636-125678	1	0.977
CP023037_1	1.2\|86857\|27\|CP023037\|PILER-CR	86857-86883	27	NZ_CP036405	Komagataeibacter saccharivorans strain JH1 plasmid p221732, complete sequence	125591-125617	2	0.926

1. spacer 1.1|86790|43|CP023037|PILER-CR matches to NZ_CP023037 (Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atcaggaagggccgacaggaagtctaatgaagtggcgcaattg	CRISPR spacer
atcaggaagggccgacaggaagtctaatgaagtggcgcaattg	Protospacer
*******************************************

2. spacer 1.2|86857|27|CP023037|PILER-CR matches to NZ_CP023037 (Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttggcccgataggggggatagggctgg	CRISPR spacer
ttggcccgataggggggatagggctgg	Protospacer
***************************

3. spacer 1.1|86790|43|CP023037|PILER-CR matches to NZ_CP036405 (Komagataeibacter saccharivorans strain JH1 plasmid p221732, complete sequence) position: , mismatch: 1, identity: 0.977

atcaggaagggccgacaggaagtctaatgaagtggcgcaattg	CRISPR spacer
atcaggaagggccgacaggaagtttaatgaagtggcgcaattg	Protospacer
***********************.*******************

4. spacer 1.2|86857|27|CP023037|PILER-CR matches to NZ_CP036405 (Komagataeibacter saccharivorans strain JH1 plasmid p221732, complete sequence) position: , mismatch: 2, identity: 0.926

ttggcccgataggggggatagggctgg	CRISPR spacer
ttggcccgataggggggatagggcccg	Protospacer
************************. *

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

22737 : 32815

Ochrobactrum_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY24270.1\|22737_24261_+	Integrase core domain protein	U5N3F9	Enterobacteria_phage	8.4e-33	29.6
AXY24271.1\|24304_25030_+\|transposase	transposase/IS protein	A0A2L1IVB6	Escherichia_phage	6.4e-31	36.8
AXY24272.1\|25093_25204_-	hypothetical protein	NA	NA	NA	NA
AXY24273.1\|25200_25575_-	hypothetical protein	NA	NA	NA	NA
AXY24274.1\|26023_27247_+	Sporulation initiation inhibitor protein Soj	A0A240F4U1	Ochrobactrum_phage	8.5e-153	68.1
AXY24275.1\|27248_28328_+	Chromosome-partitioning protein Spo0J	A0A240F4U0	Ochrobactrum_phage	1.4e-50	38.5
AXY24276.1\|28819_29740_-	Plasmid encoded RepA protein	NA	NA	NA	NA
AXY24277.1\|30185_30596_+	Transposase	NA	NA	NA	NA
AXY24278.1\|30660_31134_+	hypothetical protein	A0A2P0VP61	Tetraselmis_virus	4.2e-07	28.1
AXY24279.1\|31246_32815_-	Transposase IS66 family protein	A0A0P0ZBS5	Stx2-converting_phage	8.8e-102	44.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP023036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1380 : 56502

Leptospira_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY20842.1\|1380_2106_+\|transposase	transposase/IS protein	U5N3V8	Enterobacteria_phage	2.4e-33	38.6
AXY20843.1\|2233_2653_+	hypothetical protein	NA	NA	NA	NA
AXY20844.1\|3146_3404_+	hypothetical protein	NA	NA	NA	NA
AXY20845.1\|3492_4218_-	hypothetical protein	NA	NA	NA	NA
AXY20846.1\|4946_5114_+	Transposase	NA	NA	NA	NA
AXY20847.1\|5065_5212_+	hypothetical protein	NA	NA	NA	NA
AXY20848.1\|5205_6096_+\|transposase	IS2 transposase TnpB	S5WIU1	Leptospira_phage	5.4e-56	45.2
AXY20849.1\|6049_6868_-	6-hydroxynicotinate 3-monooxygenase precursor	NA	NA	NA	NA
AXY20850.1\|6886_7492_+	Bacterial regulatory protein, tetR family	NA	NA	NA	NA
AXY20851.1\|8641_9292_+	antiporter inner membrane protein	A0A0A8IL09	Aurantimonas_phage	1.3e-46	46.7
AXY20852.1\|9312_9591_+	hypothetical protein	NA	NA	NA	NA
AXY20853.1\|9764_10559_-	NADPH-dependent ferric-chelate reductase	NA	NA	NA	NA
AXY20854.1\|10794_13203_-	Adenosylcobalamin-dependent ribonucleoside-triphosphate reductase	V9QLC3	Rhizobium_phage	1.3e-80	43.8
AXY20855.1\|13418_13952_-	Streptothricin hydrolase	NA	NA	NA	NA
AXY20856.1\|14146_14977_+	MOSC domain protein	NA	NA	NA	NA
AXY20857.1\|15361_17659_+	Acyl-homoserine lactone acylase PvdQ precursor	NA	NA	NA	NA
AXY20858.1\|18559_20245_+	ABC transporter ATP-binding protein YojI	A0A2H4PQG7	Staphylococcus_phage	1.3e-10	28.3
AXY20859.1\|20345_20801_-	Cyanate hydratase	NA	NA	NA	NA
AXY20860.1\|22128_22476_+	IS66 Orf2 like protein	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
AXY20861.1\|22541_24110_+	Transposase IS66 family protein	A0A0P0ZBS5	Stx2-converting_phage	3.2e-104	45.3
AXY20862.1\|24892_25423_-	hypothetical protein	NA	NA	NA	NA
AXY20863.1\|25551_26481_-	hypothetical protein	NA	NA	NA	NA
AXY20864.1\|27099_27264_-	hypothetical protein	NA	NA	NA	NA
AXY20865.1\|27947_28103_+	hypothetical protein	NA	NA	NA	NA
AXY20866.1\|28225_29416_+	Methionine gamma-lyase	A0A0B5JD48	Pandoravirus	6.6e-17	31.0
AXY20867.1\|29506_30874_-	Transposase DDE domain protein	NA	NA	NA	NA
AXY20868.1\|31537_33451_+	Ferrichrome-iron receptor precursor	NA	NA	NA	NA
AXY20869.1\|33587_33911_-	hypothetical protein	NA	NA	NA	NA
AXY20870.1\|33981_34545_-\|transposase	IS2 transposase TnpB	S5WIU1	Leptospira_phage	5.1e-44	50.9
AXY20871.1\|34751_35084_+	Transposase	B6ETC4	Enterobacteria_phage	3.0e-20	50.9
AXY20872.1\|35080_35407_+	hypothetical protein	Q6H9S3	Enterobacteria_phage	3.0e-20	50.5
AXY20873.1\|35513_37037_+	Integrase core domain protein	NA	NA	NA	NA
AXY20874.1\|37080_37806_+\|transposase	transposase/IS protein	U5N3V8	Enterobacteria_phage	2.4e-33	38.6
AXY20875.1\|37869_42855_-	hypothetical protein	NA	NA	NA	NA
AXY20876.1\|43515_43920_-	hypothetical protein	NA	NA	NA	NA
AXY20877.1\|44102_44699_-	hypothetical protein	NA	NA	NA	NA
AXY20878.1\|45784_46465_+	hypothetical protein	NA	NA	NA	NA
AXY20879.1\|46714_46861_+	hypothetical protein	NA	NA	NA	NA
AXY20880.1\|46854_47745_+\|transposase	IS2 transposase TnpB	S5WIU1	Leptospira_phage	3.7e-57	46.0
AXY20881.1\|47871_48717_-	hypothetical protein	NA	NA	NA	NA
AXY20882.1\|48845_49463_-	Integrase core domain protein	S5WIU1	Leptospira_phage	3.3e-28	50.5
AXY20883.1\|49456_49603_-	hypothetical protein	NA	NA	NA	NA
AXY20884.1\|49554_49722_-	Transposase	NA	NA	NA	NA
AXY20885.1\|49762_50371_-	hypothetical protein	NA	NA	NA	NA
AXY20886.1\|50367_52506_-	Type IV secretion system protein virB4	NA	NA	NA	NA
AXY20887.1\|52468_53311_-	Conjugal transfer protein TraG	NA	NA	NA	NA
AXY20888.1\|53484_53754_+	Post-segregation antitoxin CcdA	NA	NA	NA	NA
AXY20889.1\|53758_54070_+	CcdB protein	NA	NA	NA	NA
AXY20890.1\|54355_55171_+	Toxin Doc	NA	NA	NA	NA
AXY20891.1\|55352_55520_+	Transposase	NA	NA	NA	NA
AXY20892.1\|55471_55618_+	hypothetical protein	NA	NA	NA	NA
AXY20893.1\|55611_56502_+\|transposase	IS2 transposase TnpB	S5WIU1	Leptospira_phage	8.3e-57	46.0

DBSCAN-SWA_2

2176847 : 2199417

Pseudomonas_phage(33.33%)

head,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY22808.1\|2176847_2177192_-	HTH-type transcriptional regulator ImmR	F8J1E0	Lactobacillus_phage	1.7e-05	32.1
AXY22809.1\|2177284_2177512_+	hypothetical protein	NA	NA	NA	NA
AXY22810.1\|2177986_2178250_-	hypothetical protein	NA	NA	NA	NA
AXY22811.1\|2178315_2178666_+	hypothetical protein	NA	NA	NA	NA
AXY22812.1\|2178662_2178788_+	hypothetical protein	NA	NA	NA	NA
AXY22813.1\|2178870_2179122_+	hypothetical protein	NA	NA	NA	NA
AXY22814.1\|2179121_2180042_+	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	4.3e-08	40.7
AXY22815.1\|2180034_2181522_+	Replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.8e-48	31.2
AXY22816.1\|2181649_2182000_+	hypothetical protein	NA	NA	NA	NA
AXY22817.1\|2181989_2182466_+	hypothetical protein	A0A2K8HN72	Pseudomonas_phage	1.1e-23	44.7
AXY22818.1\|2182449_2183196_+	Terminase-like family protein	F8TUP1	EBPR_podovirus	2.5e-70	56.4
AXY22819.1\|2183192_2183933_+	Terminase-like family protein	F8TUP1	EBPR_podovirus	1.5e-75	63.0
AXY22820.1\|2183966_2184164_+	hypothetical protein	NA	NA	NA	NA
AXY22821.1\|2184166_2185870_+\|head,tail	Bacteriophage head to tail connecting protein	A0A193GYI4	Enterobacter_phage	3.3e-86	33.7
AXY22822.1\|2185869_2186175_+	hypothetical protein	NA	NA	NA	NA
AXY22823.1\|2186164_2186368_+	hypothetical protein	NA	NA	NA	NA
AXY22824.1\|2186448_2187174_-\|transposase	transposase/IS protein	U5N3V8	Enterobacteria_phage	2.4e-33	38.6
AXY22825.1\|2187217_2188741_-	Integrase core domain protein	NA	NA	NA	NA
AXY22826.1\|2188868_2190698_+	Soluble lytic murein transglycosylase precursor	K4NWI2	Pseudomonas_phage	7.8e-25	34.5
AXY22827.1\|2190697_2192521_+	hypothetical protein	W6MVE3	Pseudomonas_phage	3.2e-18	38.6
AXY22828.1\|2192513_2194502_+	hypothetical protein	W6MWW8	Pseudomonas_phage	4.7e-92	34.3
AXY22829.1\|2194502_2196131_-	Transposase IS66 family protein	A0A0P0ZEB3	Stx2-converting_phage	1.1e-102	43.7
AXY22830.1\|2196178_2196526_-	IS66 Orf2 like protein	A0A0P0ZDM8	Stx2-converting_phage	3.9e-34	61.7
AXY22831.1\|2196522_2196924_-	Transposase	NA	NA	NA	NA
AXY22832.1\|2197114_2197642_+	hypothetical protein	W6MWW8	Pseudomonas_phage	3.6e-31	44.4
AXY22833.1\|2197645_2198122_-	hypothetical protein	NA	NA	NA	NA
AXY22834.1\|2198106_2198538_-	hypothetical protein	NA	NA	NA	NA
AXY22835.1\|2198579_2198699_-	hypothetical protein	NA	NA	NA	NA
AXY22836.1\|2199015_2199417_-	hypothetical protein	A0A222YXG1	Escherichia_phage	7.2e-08	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP023039

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

60060 : 122418

Stx2-converting_phage(15.38%)

holin,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY24181.1\|60060_60867_-\|transposase	transposase/IS protein	A0A2L1IVB6	Escherichia_phage	6.4e-32	36.2
AXY24182.1\|60829_62353_-	Integrase core domain protein	U5N3F9	Enterobacteria_phage	3.8e-33	29.6
AXY24183.1\|62596_63778_-	Major Facilitator Superfamily protein	NA	NA	NA	NA
AXY24184.1\|63774_66183_-	Pesticin receptor precursor	NA	NA	NA	NA
AXY24185.1\|66193_67726_-\|holin	Choline-sulfatase	A0A2K9L1A5	Tupanvirus	2.8e-20	25.9
AXY24186.1\|67847_68774_+	Glycine cleavage system transcriptional activator	NA	NA	NA	NA
AXY24187.1\|69064_70372_+	H(+)/Cl(-) exchange transporter ClcA	A0A1X9I5Z9	Streptococcus_phage	2.5e-09	28.1
AXY24188.1\|70360_71629_-	Na(+)/H(+) antiporter NhaP	A0A2H4J428	uncultured_Caudovirales_phage	6.0e-16	34.5
AXY24189.1\|71776_71953_-	hypothetical protein	NA	NA	NA	NA
AXY24190.1\|71952_73173_-\|transposase	putative transposase	A0A1B0VCD8	Salmonella_phage	4.6e-82	43.3
AXY24191.1\|73195_73609_+	Transposase IS200 like protein	A0A1S5RHE3	Helicobacter_phage	7.1e-43	62.8
AXY24192.1\|74441_75089_+	hypothetical protein	NA	NA	NA	NA
AXY24193.1\|75069_75729_-	Transcriptional activator protein LuxR	A0A1I9KF49	Aeromonas_phage	2.2e-09	27.7
AXY24194.1\|76240_76390_+	hypothetical protein	NA	NA	NA	NA
AXY24195.1\|76859_77309_-	hypothetical protein	NA	NA	NA	NA
AXY24196.1\|77305_78235_-	Thiol:disulfide interchange protein DsbG precursor	NA	NA	NA	NA
AXY24197.1\|78368_78833_+	hypothetical protein	NA	NA	NA	NA
AXY24198.1\|78832_79546_+	Transglycosylase SLT domain protein	NA	NA	NA	NA
AXY24199.1\|79542_79716_+	hypothetical protein	NA	NA	NA	NA
AXY24200.1\|79927_81235_+	hypothetical protein	NA	NA	NA	NA
AXY24201.1\|81210_81951_+	hypothetical protein	H6W806	Escherichia_phage	4.2e-22	37.8
AXY24202.1\|81962_82607_+	hypothetical protein	NA	NA	NA	NA
AXY24203.1\|82700_85847_-	Error-prone DNA polymerase	A0A0K1Y8J9	Streptomyces_phage	1.0e-96	28.9
AXY24204.1\|85850_86096_-	hypothetical protein	NA	NA	NA	NA
AXY24205.1\|86106_87507_-	impB/mucB/samB family protein	NA	NA	NA	NA
AXY24206.1\|87520_88321_-	hypothetical protein	NA	NA	NA	NA
AXY24207.1\|88392_89154_-	Transcriptional regulatory protein ros	A0A1P8VVG0	Erythrobacter_phage	2.2e-13	41.5
AXY24208.1\|89239_89431_-	hypothetical protein	NA	NA	NA	NA
AXY24209.1\|89435_89825_-	hypothetical protein	NA	NA	NA	NA
AXY24210.1\|89817_90021_-	hypothetical protein	NA	NA	NA	NA
AXY24211.1\|90246_90507_+	SpoVT / AbrB like domain protein	NA	NA	NA	NA
AXY24212.1\|90503_90920_+	Ribonuclease VapC1	NA	NA	NA	NA
AXY24213.1\|90965_92186_-\|transposase	putative transposase	A0A1B0VCD8	Salmonella_phage	4.6e-82	43.3
AXY24214.1\|92208_92622_+	Transposase IS200 like protein	A0A1S5RHE3	Helicobacter_phage	7.1e-43	62.8
AXY24215.1\|92543_93020_-	hypothetical protein	NA	NA	NA	NA
AXY24216.1\|92980_93376_-\|tRNA	tRNA(fMet)-specific endonuclease VapC	NA	NA	NA	NA
AXY24217.1\|93387_93657_-	SpoVT / AbrB like domain protein	NA	NA	NA	NA
AXY24218.1\|93960_94638_+	hypothetical protein	NA	NA	NA	NA
AXY24219.1\|94705_95389_+	RES domain protein	NA	NA	NA	NA
AXY24220.1\|95620_96532_+	Tyrosine recombinase XerD	S5W9T9	Leptospira_phage	3.2e-27	31.5
AXY24221.1\|96557_97736_+\|transposase	Putative transposase	NA	NA	NA	NA
AXY24222.1\|97762_99391_-	Transposase IS66 family protein	A0A0P0ZEB3	Stx2-converting_phage	1.1e-102	43.7
AXY24223.1\|99438_99786_-	IS66 Orf2 like protein	A0A0P0ZDM8	Stx2-converting_phage	3.9e-34	61.7
AXY24224.1\|99782_100184_-	Transposase	NA	NA	NA	NA
AXY24225.1\|100810_101683_-	Integrase core domain protein	Q716C2	Shigella_phage	7.7e-31	33.9
AXY24226.1\|101679_101991_-	Transposase	NA	NA	NA	NA
AXY24227.1\|102105_102597_-	Glyoxal reductase	A0A2H4PQR8	Staphylococcus_phage	5.1e-24	41.4
AXY24228.1\|102990_103974_-	General stress protein 69	NA	NA	NA	NA
AXY24229.1\|104123_105017_+	HTH-type transcriptional regulator DmlR	NA	NA	NA	NA
AXY24230.1\|105200_106013_+	Alpha/beta hydrolase family protein	NA	NA	NA	NA
AXY24231.1\|106103_106487_-	PIN domain protein	NA	NA	NA	NA
AXY24232.1\|106483_106756_-	hypothetical protein	NA	NA	NA	NA
AXY24233.1\|106830_107469_-	Tyrosine recombinase XerD	A0A2H4J6I5	uncultured_Caudovirales_phage	3.2e-10	32.5
AXY24234.1\|107623_108709_-	site-specific tyrosine recombinase XerD	NA	NA	NA	NA
AXY24235.1\|108902_110084_+	Adenosine monophosphate-protein transferase SoFic	NA	NA	NA	NA
AXY24236.1\|110275_111187_+	Tyrosine recombinase XerD	A0A1P8DJJ6	Virus_Rctr41k	4.0e-22	27.4
AXY24237.1\|111206_112085_+\|transposase	Putative transposase	NA	NA	NA	NA
AXY24238.1\|112094_112397_+\|transposase	Putative transposase	NA	NA	NA	NA
AXY24239.1\|112623_113112_+	Transposase	NA	NA	NA	NA
AXY24240.1\|113108_113456_+	IS66 Orf2 like protein	A0A0P0ZDM8	Stx2-converting_phage	9.5e-33	59.8
AXY24241.1\|113521_115090_+	Transposase IS66 family protein	A0A0P0ZBS5	Stx2-converting_phage	3.2e-104	45.3
AXY24242.1\|115673_117197_+	Integrase core domain protein	U5N3F9	Enterobacteria_phage	3.8e-33	29.6
AXY24243.1\|117159_117966_+\|transposase	transposase/IS protein	A0A2L1IVB6	Escherichia_phage	6.4e-32	36.2
AXY24244.1\|118046_118781_-	hypothetical protein	A0A220A398	Liberibacter_phage	1.2e-05	34.5
AXY24245.1\|118777_119713_-	Type-1 restriction enzyme EcoKI specificity protein	NA	NA	NA	NA
AXY24246.1\|120030_122418_-	putative type I restriction enzymeP M protein	A0A2H4PQP4	Staphylococcus_phage	2.2e-64	35.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP023037

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP023040

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP023036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP023039

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection