CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Prophage number
CP024776	Bacillus thuringiensis LM1212 plasmid pLM8, complete sequence	0 crisprs	NA	0	0
CP024772	Bacillus thuringiensis LM1212 plasmid pLM1, complete sequence	0 crisprs	WYL,csa3	0	13
CP024779	Bacillus thuringiensis LM1212 plasmid pLM7, complete sequence	0 crisprs	NA	0	0
CP024774	Bacillus thuringiensis LM1212 plasmid pLM3, complete sequence	0 crisprs	csa3	0	1
CP024775	Bacillus thuringiensis LM1212 plasmid pLM4, complete sequence	0 crisprs	NA	0	1
CP024773	Bacillus thuringiensis LM1212 plasmid pLM2, complete sequence	0 crisprs	csa3,cas14j,RT	0	2
CP024777	Bacillus thuringiensis LM1212 plasmid pLM6, complete sequence	0 crisprs	NA	0	0
CP024778	Bacillus thuringiensis LM1212 plasmid pLM5, complete sequence	0 crisprs	NA	0	0
CP024771	Bacillus thuringiensis LM1212 chromosome, complete genome	2 crisprs	cas3,csa3,cas14k,DEDDh,c2c9_V-U4,WYL,RT,cas14j,DinG	1	13

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3049 : 60196

Bacillus_phage(41.18%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11343.1\|3049_4486_+\|transposase	IS4 family transposase	NA	NA	NA	NA
AXY11344.1\|4880_5063_-	hypothetical protein	NA	NA	NA	NA
AXY11345.1\|5731_6439_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
AXY11346.1\|7098_7986_-	ATPase	NA	NA	NA	NA
AXY11347.1\|9614_10304_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.4e-69	58.7
AXY11348.1\|10404_10620_-	hypothetical protein	NA	NA	NA	NA
AXY11470.1\|10821_12114_+	hypothetical protein	NA	NA	NA	NA
AXY11349.1\|12298_13168_+	glycosyl transferase	A0A2K9L5M2	Tupanvirus	1.3e-09	24.3
AXY11350.1\|13150_13940_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11351.1\|13938_14256_+	hypothetical protein	NA	NA	NA	NA
AXY11471.1\|14534_15851_+	hypothetical protein	NA	NA	NA	NA
AXY11472.1\|16304_19298_-\|transposase	DDE transposase	A0A125RQ78	Bacillus_phage	0.0e+00	55.5
AXY11352.1\|19457_20330_+	DNA invertase	A0A219Y9V9	Aeromonas_phage	2.5e-37	48.6
AXY11353.1\|20729_21647_-	ATPase	NA	NA	NA	NA
AXY11354.1\|22085_22394_-	50S ribosomal protein L7ae	NA	NA	NA	NA
AXY11355.1\|22463_22754_-	transcriptional regulator	NA	NA	NA	NA
AXY11356.1\|22868_23147_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	7.4e-20	60.7
AXY11357.1\|23199_23433_-	RNA chaperone Hfq	NA	NA	NA	NA
AXY11358.1\|23454_23736_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A1B1P791	Bacillus_phage	8.3e-11	31.4
AXY11473.1\|24306_24837_-	signal peptidase I	NA	NA	NA	NA
AXY11474.1\|26947_27202_-	hypothetical protein	NA	NA	NA	NA
AXY11359.1\|27508_28216_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5
AXY11360.1\|28537_36145_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	9.4e-141	26.1
AXY11361.1\|36417_37020_+	recombinase family protein	I1ZBD6	Salisaeta_icosahedral_phage	1.7e-08	26.1
AXY11362.1\|37493_38906_-\|transposase	transposase	NA	NA	NA	NA
AXY11363.1\|38985_39480_+	hypothetical protein	NA	NA	NA	NA
AXY11364.1\|39611_40187_+	hypothetical protein	NA	NA	NA	NA
AXY11365.1\|40420_40894_+	hypothetical protein	NA	NA	NA	NA
AXY11366.1\|40950_42363_+\|transposase	transposase	NA	NA	NA	NA
AXY11367.1\|42673_43759_-	hypothetical protein	NA	NA	NA	NA
AXY11368.1\|44193_45306_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	1.4e-80	49.1
AXY11369.1\|45489_45714_-	hypothetical protein	NA	NA	NA	NA
AXY11370.1\|45758_46055_-	hypothetical protein	NA	NA	NA	NA
AXY11475.1\|46209_46437_-	DUF2187 domain-containing protein	NA	NA	NA	NA
AXY11371.1\|47468_47705_-	hypothetical protein	NA	NA	NA	NA
AXY11372.1\|47797_48046_-	DNA-binding protein	A0A2H4JDR0	uncultured_Caudovirales_phage	2.7e-13	46.1
AXY11373.1\|48559_48784_+	XRE family transcriptional regulator	A0A0S2MVM0	Bacillus_phage	6.8e-16	50.6
AXY11374.1\|48785_49400_-	hypothetical protein	H0USY2	Bacillus_phage	8.1e-43	45.1
AXY11375.1\|49338_50520_-	cell division protein FtsK	H0USY1	Bacillus_phage	4.0e-123	56.2
AXY11376.1\|50620_50806_-	hypothetical protein	NA	NA	NA	NA
AXY11377.1\|50807_51104_-	hypothetical protein	H0USY0	Bacillus_phage	2.2e-14	45.5
AXY11378.1\|51537_52632_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	3.5e-81	45.8
AXY11379.1\|52633_52771_+	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
AXY11380.1\|53264_53705_-	hypothetical protein	NA	NA	NA	NA
AXY11381.1\|53711_54902_-	hypothetical protein	NA	NA	NA	NA
AXY11382.1\|55130_55685_-	MerR family transcriptional regulator	NA	NA	NA	NA
AXY11383.1\|56330_57275_-	Replicase RepFR55	NA	NA	NA	NA
AXY11384.1\|57619_58117_-	transcriptional regulator	NA	NA	NA	NA
AXY11385.1\|58320_58524_+	XRE family transcriptional regulator	NA	NA	NA	NA
AXY11386.1\|59406_60196_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

68963 : 132849

Bacillus_phage(40.0%)

transposase,integrase

attL 67792:67851|attR 112122:113835

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
67792:67851	attL	NA	NA	NA	NA
AXY11397.1\|68963_69437_-\|transposase	transposase family protein	NA	NA	NA	NA
AXY11398.1\|69491_70022_+	hypothetical protein	NA	NA	NA	NA
AXY11399.1\|70093_70567_+	hypothetical protein	NA	NA	NA	NA
AXY11400.1\|70641_71046_+	hypothetical protein	NA	NA	NA	NA
AXY11401.1\|71213_73934_+	ATPase	NA	NA	NA	NA
AXY11402.1\|73933_74134_+	hypothetical protein	NA	NA	NA	NA
AXY11403.1\|74151_76326_+	hypothetical protein	NA	NA	NA	NA
AXY11404.1\|76390_76681_+	hypothetical protein	NA	NA	NA	NA
AXY11405.1\|76694_77555_+	hypothetical protein	NA	NA	NA	NA
AXY11406.1\|77564_79505_+	type IV secretion system protein VirB4	NA	NA	NA	NA
AXY11407.1\|79508_80630_+	hypothetical protein	F8WPZ7	Bacillus_phage	2.6e-23	45.0
AXY11408.1\|80666_80969_+	hypothetical protein	NA	NA	NA	NA
AXY11409.1\|80980_81580_+	MerR family transcriptional regulator	NA	NA	NA	NA
AXY11410.1\|81951_82824_+	hypothetical protein	NA	NA	NA	NA
AXY11411.1\|83081_83339_+	hypothetical protein	NA	NA	NA	NA
AXY11412.1\|83335_84544_+	hypothetical protein	NA	NA	NA	NA
AXY11413.1\|84540_85008_+	hypothetical protein	NA	NA	NA	NA
AXY11414.1\|85026_85332_+	hypothetical protein	NA	NA	NA	NA
AXY11415.1\|85362_85644_+	hypothetical protein	NA	NA	NA	NA
AXY11416.1\|85636_87475_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
AXY11417.1\|87568_88711_+	hypothetical protein	NA	NA	NA	NA
AXY11418.1\|88796_88985_+	hypothetical protein	NA	NA	NA	NA
AXY11419.1\|89134_91789_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	6.8e-30	25.8
AXY11420.1\|91999_92605_+	hypothetical protein	NA	NA	NA	NA
AXY11421.1\|92656_94069_+\|transposase	transposase	NA	NA	NA	NA
AXY11422.1\|95927_96947_+	hypothetical protein	NA	NA	NA	NA
AXY11423.1\|97007_98201_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8
AXY11424.1\|98497_99160_+	restriction endonuclease	NA	NA	NA	NA
AXY11425.1\|99477_99666_+	hypothetical protein	NA	NA	NA	NA
AXY11426.1\|99912_100152_+	hypothetical protein	NA	NA	NA	NA
AXY11427.1\|100978_102841_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.3e-31	30.2
AXY11428.1\|103572_103815_+	hypothetical protein	NA	NA	NA	NA
AXY11429.1\|104192_104471_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	6.0e-14	68.9
AXY11430.1\|104532_104805_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.8e-23	65.6
AXY11431.1\|104917_105340_-	hypothetical protein	NA	NA	NA	NA
AXY11432.1\|106389_107271_+	ATPase	NA	NA	NA	NA
AXY11433.1\|107521_108475_-\|integrase	integrase	NA	NA	NA	NA
AXY11434.1\|108584_109604_-	hypothetical protein	A0A1B1P7Q7	Bacillus_phage	2.5e-134	62.2
AXY11435.1\|110535_111009_+\|transposase	transposase family protein	NA	NA	NA	NA
AXY11436.1\|110998_112105_+	hypothetical protein	NA	NA	NA	NA
AXY11437.1\|113312_114431_-\|transposase	IS110 family transposase	NA	NA	NA	NA
112122:113835	attR	NA	NA	NA	NA
AXY11438.1\|115736_117047_+	hypothetical protein	NA	NA	NA	NA
AXY11439.1\|117372_118461_+	glycosyl transferase	A0A2K9L5M2	Tupanvirus	6.9e-13	22.1
AXY11476.1\|118792_120139_+	hypothetical protein	NA	NA	NA	NA
AXY11440.1\|120428_120644_+	hypothetical protein	NA	NA	NA	NA
AXY11441.1\|121188_122010_-	hypothetical protein	NA	NA	NA	NA
AXY11442.1\|122425_123418_-	hypothetical protein	NA	NA	NA	NA
AXY11443.1\|123496_124570_-	hypothetical protein	NA	NA	NA	NA
AXY11444.1\|125990_126780_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11445.1\|128037_128745_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
AXY11446.1\|132141_132849_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP024772

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1940

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11173.1\|680_1940_+	hypothetical protein	A0A125RQ78	Bacillus_phage	9.4e-171	68.3

DBSCAN-SWA_2

5403 : 92056

Streptococcus_phage(64.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11175.1\|5403_6111_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.6e-40	43.4
AXY11331.1\|6667_7375_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.6e-40	43.4
AXY11176.1\|8904_9612_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-38	39.9
AXY11333.1\|10365_10734_+	hypothetical protein	A0A1B1P8B2	Bacillus_phage	1.6e-54	90.5
AXY11332.1\|11348_12056_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-38	39.5
AXY11177.1\|14136_15756_+	hypothetical protein	NA	NA	NA	NA
AXY11178.1\|15919_18511_+	iota toxin protein Ib	A0A1V0E026	Clostridioides_phage	7.1e-141	42.0
AXY11179.1\|18585_19275_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.6e-69	60.0
AXY11180.1\|19789_21694_-	hypothetical protein	NA	NA	NA	NA
AXY11181.1\|21742_24298_-	hypothetical protein	NA	NA	NA	NA
AXY11182.1\|24385_24967_-	ABC transporter permease	NA	NA	NA	NA
AXY11183.1\|26970_27633_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	6.5e-30	33.5
AXY11184.1\|28293_29001_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-38	39.5
AXY11185.1\|30915_33321_+	PAS domain-containing sensor histidine kinase	A0A2K9L5I4	Tupanvirus	1.9e-07	24.7
AXY11186.1\|35472_35742_+	hypothetical protein	NA	NA	NA	NA
AXY11187.1\|36051_36841_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11334.1\|37640_37940_+	hypothetical protein	NA	NA	NA	NA
AXY11188.1\|38030_40658_+	iota toxin protein Ib	A0A1V0E026	Clostridioides_phage	4.0e-139	41.9
AXY11189.1\|41292_42082_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11190.1\|42842_44540_-	hypothetical protein	NA	NA	NA	NA
AXY11191.1\|45386_45602_-	hypothetical protein	NA	NA	NA	NA
AXY11192.1\|45589_47290_+	hypothetical protein	NA	NA	NA	NA
AXY11193.1\|49555_52876_+	Iota toxin protein Ib	A0A1V0E026	Clostridioides_phage	2.1e-116	32.9
AXY11194.1\|53334_54042_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	6.2e-39	42.9
AXY11195.1\|54198_55650_+	hypothetical protein	NA	NA	NA	NA
AXY11196.1\|58359_58746_-	AraC family transcriptional regulator	NA	NA	NA	NA
AXY11197.1\|58807_59719_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	1.1e-08	29.3
AXY11198.1\|60365_61073_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5
AXY11199.1\|61550_61763_-	hypothetical protein	NA	NA	NA	NA
AXY11200.1\|63838_64628_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11201.1\|65219_66281_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.0e-12	35.4
AXY11202.1\|68273_69440_+	hypothetical protein	NA	NA	NA	NA
AXY11203.1\|69467_69887_+	hypothetical protein	NA	NA	NA	NA
AXY11204.1\|70531_71239_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-37	39.0
AXY11205.1\|71426_72104_+	hypothetical protein	NA	NA	NA	NA
AXY11206.1\|72482_72671_-	hypothetical protein	NA	NA	NA	NA
AXY11207.1\|72892_73231_-	hypothetical protein	NA	NA	NA	NA
AXY11208.1\|73320_73527_+	hypothetical protein	NA	NA	NA	NA
AXY11209.1\|73532_73697_+	hypothetical protein	NA	NA	NA	NA
AXY11210.1\|73862_74090_-	hypothetical protein	NA	NA	NA	NA
AXY11211.1\|74926_75634_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.6e-40	43.4
AXY11212.1\|75650_76085_-	hypothetical protein	A0A1X9I6E7	Streptococcus_phage	2.0e-27	47.9
AXY11213.1\|76834_78232_+	hypothetical protein	M1I2Z8	Paramecium_bursaria_Chlorella_virus	4.1e-66	37.5
AXY11214.1\|78372_79080_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	7.4e-40	43.4
AXY11215.1\|79773_80703_+	ATPase	NA	NA	NA	NA
AXY11216.1\|80955_81663_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5
AXY11217.1\|81775_81985_-	hypothetical protein	NA	NA	NA	NA
AXY11218.1\|82305_83868_-	toxin	A0A0K2CYN4	Paenibacillus_phage	2.1e-18	27.2
AXY11219.1\|84663_85371_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-38	39.5
AXY11220.1\|85691_86516_-	type-1Aa cytolytic delta-endotoxin	NA	NA	NA	NA
AXY11221.1\|88023_88731_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
AXY11222.1\|89083_89770_-	hypothetical protein	NA	NA	NA	NA
AXY11223.1\|89878_90184_-	hypothetical protein	NA	NA	NA	NA
AXY11224.1\|90579_90948_+	hypothetical protein	NA	NA	NA	NA
AXY11225.1\|91266_92056_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

95306 : 95894

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11226.1\|95306_95894_-	hypothetical protein	A0A1Z1LZN4	Bacillus_phage	2.3e-10	36.3

DBSCAN-SWA_4

102738 : 167873

Streptococcus_phage(53.33%)

bacteriocin,integrase,transposase

attL 91255:91314|attR 118492:119344

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
91255:91314	attL	NA	NA	NA	NA
AXY11230.1\|102738_103899_-\|integrase	integrase	NA	NA	NA	NA
AXY11231.1\|104416_104614_+	hypothetical protein	NA	NA	NA	NA
AXY11232.1\|104880_105210_+	hypothetical protein	A0A1B1P776	Bacillus_phage	1.1e-09	36.6
AXY11233.1\|105244_105952_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-38	39.5
AXY11234.1\|106555_106756_+	hypothetical protein	NA	NA	NA	NA
AXY11235.1\|106788_107751_+\|integrase	integrase	NA	NA	NA	NA
AXY11236.1\|108126_109020_-	ATPase	NA	NA	NA	NA
AXY11237.1\|109682_109988_-	transcriptional regulator	NA	NA	NA	NA
AXY11238.1\|110081_110789_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-38	39.5
AXY11239.1\|110854_111232_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.0e-27	57.0
AXY11240.1\|112324_113554_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.0e-84	48.8
AXY11241.1\|114032_114284_-	hypothetical protein	NA	NA	NA	NA
AXY11242.1\|115819_116926_-	hypothetical protein	NA	NA	NA	NA
AXY11243.1\|116915_117389_-\|transposase	transposase family protein	NA	NA	NA	NA
AXY11244.1\|117673_117925_-	hypothetical protein	NA	NA	NA	NA
AXY11245.1\|118323_118521_+	hypothetical protein	NA	NA	NA	NA
AXY11246.1\|118503_119293_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11247.1\|119270_119459_-	hypothetical protein	NA	NA	NA	NA
118492:119344	attR	NA	NA	NA	NA
AXY11248.1\|119773_120016_-	hypothetical protein	NA	NA	NA	NA
AXY11249.1\|120122_120368_-	hypothetical protein	NA	NA	NA	NA
AXY11250.1\|120415_120943_-	hypothetical protein	NA	NA	NA	NA
AXY11251.1\|121605_123018_-\|transposase	transposase	NA	NA	NA	NA
AXY11252.1\|123889_125089_-	macrolide ABC transporter permease	NA	NA	NA	NA
AXY11253.1\|125085_125766_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.1e-36	40.1
AXY11254.1\|125762_126956_-	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AXY11255.1\|127292_127616_+\|bacteriocin	circular bacteriocin, circularin A/uberolysin family	NA	NA	NA	NA
AXY11256.1\|127700_129407_+	hypothetical protein	NA	NA	NA	NA
AXY11257.1\|129411_129921_+	stage II sporulation protein M	NA	NA	NA	NA
AXY11258.1\|129934_130483_+	hypothetical protein	NA	NA	NA	NA
AXY11259.1\|130472_131111_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	5.5e-10	26.4
AXY11260.1\|131073_131301_+	hypothetical protein	NA	NA	NA	NA
AXY11261.1\|131851_132127_-	hypothetical protein	NA	NA	NA	NA
AXY11262.1\|132145_132823_-	recombinase	Q1MVP4	Enterobacteria_phage	6.0e-15	30.5
AXY11263.1\|133119_133419_+	hypothetical protein	NA	NA	NA	NA
AXY11264.1\|133528_133861_+	DeoR family transcriptional regulator	NA	NA	NA	NA
AXY11265.1\|134070_134664_+	cell division protein FtsN	NA	NA	NA	NA
AXY11266.1\|134797_134989_-	hypothetical protein	NA	NA	NA	NA
AXY11267.1\|135214_135448_-	RNA chaperone Hfq	NA	NA	NA	NA
AXY11268.1\|135469_135751_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	1.1e-10	59.0
AXY11269.1\|135876_136182_-	transcriptional regulator	NA	NA	NA	NA
AXY11270.1\|136297_136882_-	hypothetical protein	NA	NA	NA	NA
AXY11335.1\|137601_138309_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5
AXY11271.1\|138941_139731_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11272.1\|140467_141142_-	hypothetical protein	NA	NA	NA	NA
AXY11273.1\|142692_142881_-	hypothetical protein	NA	NA	NA	NA
AXY11274.1\|142838_143628_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11275.1\|144358_145060_-	ADP-ribosyltransferase	Q331X8	Clostridium_botulinum_C_phage	4.9e-28	35.3
AXY11276.1\|145253_147854_-	iota toxin protein Ib	A0A1V0E026	Clostridioides_phage	1.6e-140	39.3
AXY11277.1\|148050_148242_-	hypothetical protein	NA	NA	NA	NA
AXY11278.1\|148261_148498_-	hypothetical protein	NA	NA	NA	NA
AXY11279.1\|156261_157050_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11280.1\|157244_157952_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5
AXY11281.1\|158405_160397_-	hypothetical protein	NA	NA	NA	NA
AXY11282.1\|160985_161693_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.6e-37	39.0
AXY11283.1\|162358_163861_-	endoglycoceramidase	NA	NA	NA	NA
AXY11284.1\|164460_166791_-	carbohydrate-binding cenc domain protein	NA	NA	NA	NA
AXY11285.1\|167165_167873_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.8e-38	39.5

DBSCAN-SWA_5

170921 : 171959

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11288.1\|170921_171959_+	cysteine synthase family protein	A0A1W6JHY1	Lactococcus_phage	6.6e-37	34.4

DBSCAN-SWA_6

181751 : 182468

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11336.1\|181751_182468_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.1e-38	39.0

DBSCAN-SWA_7

191098 : 191806

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11294.1\|191098_191806_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-37	39.0

DBSCAN-SWA_8

202570 : 203278

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11340.1\|202570_203278_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	4.0e-38	39.5

DBSCAN-SWA_9

208303 : 209533

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11304.1\|208303_209533_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.9e-85	48.8

DBSCAN-SWA_10

215135 : 223342

Streptococcus_phage(60.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11307.1\|215135_216365_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	3.8e-84	48.5
AXY11308.1\|216554_218552_-	ABC transporter permease	NA	NA	NA	NA
AXY11309.1\|218538_219306_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.5e-33	40.5
AXY11310.1\|219633_220644_-	sensor histidine kinase	A0A2K9L0Z8	Tupanvirus	3.8e-05	28.8
AXY11311.1\|220640_221315_-	DNA-binding response regulator	NA	NA	NA	NA
AXY11312.1\|221398_222106_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-39	43.4
AXY11341.1\|222634_223342_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5

DBSCAN-SWA_11

232029 : 235915

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11318.1\|232029_232737_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	9.6e-40	43.4
AXY11319.1\|233665_233884_-	hypothetical protein	NA	NA	NA	NA
AXY11320.1\|235207_235915_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-38	39.5

DBSCAN-SWA_12

239404 : 241480

uncultured_Caudovirales_phage(66.67%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11323.1\|239404_239644_-\|holin	holin	A0A2H4J378	uncultured_Caudovirales_phage	2.2e-33	97.5
AXY11324.1\|239643_239880_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	100.0
AXY11325.1\|240772_241480_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	39.5

DBSCAN-SWA_13

245915 : 246788

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11329.1\|245915_246788_-	DNA invertase	A0A219Y9V9	Aeromonas_phage	2.5e-37	48.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP024771

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP024771_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP024771_3

4123389-4123544

Orphan

Consensus_repeat	Method
AGGAATGAATATTCATTCCGGAA	CRISPRCasFinder

2 spacers

The CRISPR arrays of CP024771_3

>merge|CP024771|3|4123389-4123544|CRISPRCasFinder
AGGAATGAATATTCATTCCTAAATAGAATTAAAAAATGAGAGTAGGAGAGGGTATTTGTGCAACTAAAGGAATGAATATTCATTCCGGAAAGACTAGTTTAATAGAGTTTACAAAATAATGTAATAAAATGATAGGAATGAATATTCATTCCGTAA

>CP024771|3|3|4123389-4123544|CRISPRCasFinder
AGGAATGAATATTCATTCCTAAA	TAGAATTAAAAAATGAGAGTAGGAGAGGGTATTTGTGCAACTAA
AGGAATGAATATTCATTCCGGAA	AGACTAGTTTAATAGAGTTTACAAAATAATGTAATAAAATGAT
AGGAATGAATATTCATTCCGTAA

Protein	Signature genes	Signature genes Name	Protein_function
CP024771.1\|AXY09407.1\|4116370_4116469_+\|hypothetical-protein	unknown	unknown	unknown
CP024771.1\|AXY09421.1\|4135942_4137214_+\|PTS-ascorbate-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|236502
CP024771.1\|AXY09422.1\|4137383_4137809_+\|PadR-family-transcriptional-regulator	unknown	unknown	unknown
CP024771.1\|AXY09406.1\|4115230_4116307_+\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	unknown	unknown	gnl\|CDD\|183614
CP024771.1\|AXY09404.1\|4110298_4110736_-\|DUF2512-domain-containing-protein	unknown	unknown	gnl\|CDD\|371204
CP024771.1\|AXY09415.1\|4127134_4127983_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|180682
CP024771.1\|AXY09411.1\|4119990_4121280_+\|3-phosphoshikimate-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|235037
CP024771.1\|AXY09405.1\|4110886_4114399_+\|DUF4020-domain-containing-protein	unknown	unknown	gnl\|CDD\|238697
CP024771.1\|AXY09416.1\|4128372_4129998_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|237894
CP024771.1\|AXY09418.1\|4132548_4133223_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|163429
CP024771.1\|AXY09413.1\|4122801_4123368_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|292911
CP024771.1\|AXY09414.1\|4123570_4126696_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
CP024771.1\|AXY09410.1\|4118873_4119974_+\|prephenate-dehydrogenase	unknown	unknown	gnl\|CDD\|235824
CP024771.1\|AXY09412.1\|4121415_4122573_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|226925
CP024771.1\|AXY09423.1\|4137849_4138677_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200569
CP024771.1\|AXY09419.1\|4133529_4135635_+\|PTS-lichenan-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|226234
CP024771.1\|AXY09420.1\|4135648_4135918_+\|PTS-lactose-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99905
CP024771.1\|AXY09408.1\|4116589_4117762_+\|chorismate-synthase	unknown	unknown	gnl\|CDD\|171518
CP024771.1\|AXY09409.1\|4117780_4118881_+\|histidinol-phosphate-transaminase	unknown	unknown	gnl\|CDD\|134568
CP024771.1\|AXY09417.1\|4130518_4132492_+\|glycerol-phosphate-lipoteichoic-acid-synthase	unknown	unknown	gnl\|CDD\|224287

Protein	Function_ID	Function_description	E-value
CP024771.1\|AXY09421.1\|4135942_4137214_+\|PTS-ascorbate-transporter-subunit-IIC	gnl\|CDD\|236502	PRK09410, ulaA, PTS system ascorbate-specific transporter subunit IIC; Reviewed.	0
CP024771.1\|AXY09406.1\|4115230_4116307_+\|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase	gnl\|CDD\|183614	PRK12595, PRK12595, bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed.	0
CP024771.1\|AXY09404.1\|4110298_4110736_-\|DUF2512-domain-containing-protein	gnl\|CDD\|371204	pfam10710, DUF2512, Protein of unknown function (DUF2512). Proteins in this family are predicted to be integral membrane proteins, and many of them are annotated as being YndM protein. They are all found in Firmicutes. The true function is not known.	4.48148e-45
CP024771.1\|AXY09415.1\|4127134_4127983_+\|hypothetical-protein	gnl\|CDD\|180682	PRK06761, PRK06761, hypothetical protein; Provisional.	5.72342e-147
CP024771.1\|AXY09411.1\|4119990_4121280_+\|3-phosphoshikimate-1-carboxyvinyltransferase	gnl\|CDD\|235037	PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.	0
CP024771.1\|AXY09405.1\|4110886_4114399_+\|DUF4020-domain-containing-protein	gnl\|CDD\|238697	cd01406, SIR2-like, Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.	4.05141e-56
CP024771.1\|AXY09416.1\|4128372_4129998_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|237894	PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional.	0
CP024771.1\|AXY09418.1\|4132548_4133223_-\|hypothetical-protein	gnl\|CDD\|163429	TIGR03717, R_switched_YjbE, integral membrane protein, YjbE family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family commonly are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains protein YjbE from Bacillus subtilis. A transport function is proposed.	8.39162e-74
CP024771.1\|AXY09413.1\|4122801_4123368_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|292911	pfam16295, TetR_C_10, Tetracycline repressor, C-terminal all-alpha domain.	3.38872e-64
CP024771.1\|AXY09414.1\|4123570_4126696_+\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	2.83981e-77
CP024771.1\|AXY09410.1\|4118873_4119974_+\|prephenate-dehydrogenase	gnl\|CDD\|235824	PRK06545, PRK06545, prephenate dehydrogenase; Validated.	4.35509e-159
CP024771.1\|AXY09412.1\|4121415_4122573_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|226925	COG4552, Eis, Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only].	4.50547e-73
CP024771.1\|AXY09423.1\|4137849_4138677_-\|polysaccharide-deacetylase	gnl\|CDD\|200569	cd10944, CE4_SmPgdA_like, Catalytic NodB homology domain of Streptococcus mutans polysaccharide deacetylase PgdA, Bacillus subtilis YheN, and similar proteins. This family is represented by a putative polysaccharide deacetylase PgdA from the oral pathogen Streptococcus mutans (SmPgdA) and Bacillus subtilis YheN (BsYheN), which are members of the carbohydrate esterase 4 (CE4) superfamily. SmPgdA is an extracellular metal-dependent polysaccharide deacetylase with a typical CE4 fold, with metal bound to a His-His-Asp triad. It possesses de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. SmPgdA plays a role in tuning cell surface properties and in interactions with (salivary) agglutinin, an essential component of the innate immune system, most likely through deacetylation of an as-yet-unidentified polysaccharide. SmPgdA shows significant homology to the catalytic domains of peptidoglycan deacetylases from Streptococcus pneumoniae (SpPgdA) and Listeria monocytogenes (LmPgdA), both of which are involved in the bacterial defense mechanism against human mucosal lysozyme. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. The biological function of BsYheN is still unknown. This family also includes many uncharacterized polysaccharide deacetylases mainly found in bacteria.	4.88683e-85
CP024771.1\|AXY09419.1\|4133529_4135635_+\|PTS-lichenan-transporter-subunit-IIC	gnl\|CDD\|226234	COG3711, BglG, Transcriptional antiterminator [Transcription].	3.86028e-56
CP024771.1\|AXY09420.1\|4135648_4135918_+\|PTS-lactose-transporter-subunit-IIB	gnl\|CDD\|99905	cd05563, PTS_IIB_ascorbate, PTS_IIB_ascorbate: subunit IIB of enzyme II (EII) of the L-ascorbate-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is an L-ascorbate-specific permease with two cytoplasmic subunits (IIA and IIB) and a transmembrane channel IIC subunit. Subunits IIA, IIB, and IIC are encoded by the sgaA, sgaB, and sgaT genes of the E. coli sgaTBA operon. In some bacteria, the IIB (SgaB) domain is fused C-terminal to the IIA (SgaT) domain. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include ascorbate, chitobiose/lichenan, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	5.50815e-34
CP024771.1\|AXY09408.1\|4116589_4117762_+\|chorismate-synthase	gnl\|CDD\|171518	PRK12463, PRK12463, chorismate synthase; Reviewed.	0
CP024771.1\|AXY09409.1\|4117780_4118881_+\|histidinol-phosphate-transaminase	gnl\|CDD\|134568	PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated.	0
CP024771.1\|AXY09417.1\|4130518_4132492_+\|glycerol-phosphate-lipoteichoic-acid-synthase	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	0

>CP024771.1|AXY09413.1|4122801_4123368_+|TetR-family-transcriptional-regulator
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKANVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIAKGFLRPLPPVALIIIVYQPLEKLTKVIATGQLEYSKELVKELEESSWNAIRII
>CP024771.1|AXY09412.1|4121415_4122573_+|GNAT-family-N-acetyltransferase
MNVIRLKEDKFREALGLSEYAFQYKVEEERMQQQLTKMKESHEVYGIMEGEELAAKLHLIPFHIYIGKEKFKMGGVAGVATYPEYRRSGYVKELLQHSLQTMKKDGYTVSMLHPFAVSFYRKYGWELCADLLVCHMTKSDLVMKKQVNGTVKRFNKEHHPEEVEKLYETFAERFSGMLVRNEKWWLQAVYDDLTLAIYYDENKTAAGYMLYKIENNKMIVEEFVPLHNEARNGLWNFICQHDSMIKELEMTVSKNEPLLYTLQEPRVKTEIKPYFMGRIVDVEQFLKQYELNWNNVQQEVIVHITDSFAPWNNITVRLANHEITIVEETTEKGIKLDINALSAIMLGYKRPLELNELELISGSEEEIRAFENVVPVQKPFIYDFF
>CP024771.1|AXY09411.1|4119990_4121280_+|3-phosphoshikimate-1-carboxyvinyltransferase
MKERTIQPVNNGLNGNITIPGDKSISHRAVMFGAIAEGKTTIKGFLPGADCLSTISCFKKMGVDIVQNGDEVTVVGKGLEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDASIAKRPMKRVTNPLKQMGANIDGREEGTFTPLTIRGGDLKAIEYTSPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHTERMLEAFGVKVTREGKTVKLAGGQKLTATDVQVPGDVSSAAFFLVAGAIIPNSKLVLQNVGMNPTRTGIIDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATEDGMIIYGKSVLKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK
>CP024771.1|AXY09410.1|4118873_4119974_+|prephenate-dehydrogenase
MRKQVVLIGTGLIGGSLALAIKKEHDVTITGYDIFQEQVERAKELHVVDEIAVDLQHACEEAHLIVFASPVEETKKLLHKLASFRLRKDVIVTDVGSTKGTIMNEAEALFSKEISFIGGHPMAGSHKTGVESAKAHLFENAFYILTPMNHVPNEHVKELKDWLKGTGSHFLVLNTEEHDYVTGIVSHFPHLIAAGLVKQVEKHAGDNPLIHQLAAGGFKDITRIASSSPKMWSDIVKQNREHLMVLLKEWISEMEGLYDTVSTGDAGEIQNYFADAKEYRDSLPVRKRGAIPAYHDLYVDVLDKVGALAHITSILAREEISITNLQILEAREGLLGVLRISFQREEDRTKAKLALGEEKYQTYETI
>CP024771.1|AXY09409.1|4117780_4118881_+|histidinol-phosphate-transaminase
MQVKDQLSSLQPYKPGKSPEQMKEVYGDHSFVKLASNENPFGCSPRVLDELQKSWLDHALYPDGGATTLRQTIANKLHVQMEQVLCGSGLDEVIQIISRAVLKAGDNIVTAGATFPQYRHHAIIEGCEVKEVPLNNGVYDLDEISSAVDNNTKIVWICNPNNPTGTYVNDRKLTQFIEGISENTLIVIDEAYYEYVTAKDFRETLPLLEKHKNILVLRTFSKAYGLASFRVGYAIGQEELIEKLNVVRLPFNVSSLAQKAATIAFCDDEFIEEVVRVNTEGLQQYESFCKENDIPFYPSQTNFIFLPVENAGEIYEACAHAGFIIRPFPNGVRITVGTREQNEGVISVLQQHFENKKRKSRDEANA
>CP024771.1|AXY09408.1|4116589_4117762_+|chorismate-synthase
MRYITAGESHGPQLTVILEGVPAGLTLAAEHINKELLRRQKGHGRGRRMQIETDTVEIVSGVRHGMTLGSPITLIVKNDDFKHWTKVMGAEPISEKESKDMKRTITKPRPGHADLNGAIKYGHRDIRNVLERSSARETTVRVAAGAVAKQILKELGVEIAGHVLEIGGVKAKHISNLSIEEIQTITENSPVRCLDKEVEQEMMDAIDHAKSSGDSIGGIVEVIAEGMPIGVGSYVHYDRKLDAKLAGAIMSINAFKGAEIGVGFEAARQPGSKVHDEILWDEEQGYTRKTNNAGGLEGGMTTGMPIVVRGVMKPIPTLYKPLASVDIDTKEAFQASIERSDSCAVPAAGVVAESVVAWELAHALVEQFGKDRMELIQQNITQHNKYAKEF
>CP024771.1|AXY09407.1|4116370_4116469_+|hypothetical-protein
MVGVNQYKGKHELQPWSIFSANFWRGRRSNDR
>CP024771.1|AXY09406.1|4115230_4116307_+|bifunctional-3-deoxy-7-phosphoheptulonate-synthase/chorismate-mutase
MANHELDQLRKQVDEINLQLLHLLNKRGEIVQKIGEQKQVQGTKRFDPVREREVLDMIAENNEGPFETSTVQHIFKTIFKASLELQEDDNRKALLVSRKKKQENTIVDVKGELIGNGTQTFIMGPCAVESLEQVRQVGQAMKDQGLKLMRGGAFKPRTSPYDFQGLGVEGLQILRQVADEFDLAIISEILNPNDVEMALDYVDVIQVGARNMQNFDLLRAVGKVNKPVLLKRGLAATIDEFINAAEYIIAQGNDQIILCERGIRTYERATRNTLDISAVPILKKETHLPVVVDVTHSTGRRDLLLPTAKAALAIGADAVMAEVHPDPAVALSDSAQQMDIPEFHRFMDELKGFKNKLS
>CP024771.1|AXY09405.1|4110886_4114399_+|DUF4020-domain-containing-protein
MTFLGKGESWVWITSEVEIPDELIDHLEQGKLVLFVGAGVSMKGKSNLPNFDDLVDEIAKTLYVEKREITEPHDYYLGKIAKSKDVHQVARDLVHIEKSKPNPLHYAIPRLFPLDTEVRIVTTNFDRHFTTAIKEMNRELNVYYAPALPTGRAFKGLAYIHGNIEQEKEALILTDGDFGRAYLTEGWARRFLVDLFSNYTVLFVGYSHNDPVMKYLATGLPPSTRRYAFVAQGENTYHWEHLGIRPIVYPNKGNNHQSLVKAVKRWAELMGDNYITKRMRIRDIVTVPPSVEQEQLSYIKQSIKKIETVRYFVEFAHDYEWVEWLEAEGKLQNLFLITSNYNEVDELLAKWLVEQFLFSHQKELFQLIFKNHSKISPLLWRTICSYLNETKMKMNPLLFARWTLLLVETAEKDSKSIETISYLLQKCSFPEHKEIALLLLTFILDGKLKLKRERKWGNDTGESIELEESSRLPVSIFSYVEQIWNEKMKPHISYYAVPIMMMGIEKMRMLSLRQTALKKRDKENAEKEFQQNDLAFLIQIVKECLAYLCENNEKKANYYITEMIEANSILQNRIAIDAMNKNIFVSADEKIKWLLQEGILLDVTYKQEVFQLIKNHYALSLEKTKEEVIQIVLKDLAEERAFDVCFVLDLLFNCDTNSPSTAKGYELMKQKHPHFHSDRYSVQKKEAAEQSITCNVTADGLLQLKDEEIMKQVRQFSQDGVFEQRHFLEMLSKACKLNTEWSISFAYQLVGMHEISNEVWFVCIREWRNNRGLTNEQIQKVIPLLQKFVRNTAFHWLISSFLYEISNRLEELEENSIRNVKRFAFSVFPQVMKSDTDFKLGKQDFYNESIQHPVGKMTAVLLKLLSYDHLYDRNVYEYLFLFEEQVRISTERTNFMLARLVADITFLYHIEKQWCRKYLLPYLELKKENEITKYAWAGLCYTQINLPLFTEMKRFIKYAVEHLEVLHPHTREAFLKWLSFVFIKCVLYWEQKTDWLYPLLIRENEENKIKFMQFLCYYVKTLSAREQQKFWAAWLSIFLRERPKMGEITAREYVMLLRIILFMDEIVERGLSIICKSFSDVGGKGNQTELKQLFNEILEKTESIKMYKDLYANVFFTLLQTLQEADLLETEIIQIKELLIGYRVEKCVINAIDNEIIRIGIVMENLQEEM
>CP024771.1|AXY09404.1|4110298_4110736_-|DUF2512-domain-containing-protein
MNDFTVVLIKFISCIIAFSIGLALFFPATFVQIISFSLFVTIVSYMFVDKIILNRIGNTGAIMSDFLLTYLSVWIFGNILLDNYMQIAWGSFLSAIVFTLSEVIVHRFSGSHTRHHNDNIRINRRFAYGTEFAEEQNILDKDKKK
>CP024771.1|AXY09414.1|4123570_4126696_+|MMPL-family-transporter
MMQMSKLKNWRSLSFLLWIVITITMIVTMPNMDKLVKEKGHITIPNTEQSSIADKMIKEMDKGGTEKYDIIAVFNSGSKTALTTEQKEEITKTINALQNEKEQLGIKEVVSHLDNKELEKQFVSKDNTTILTQISIDKKHGEISKVTNNLHKKVQTKGVKTYLTGSDLVAGDFLKSSQEGVKKTEVISIIFILVVLIIVFRSPVVPIISLLTVGVSYLVSMGVIAHLVDQFNFPFSNFTQVFVVVVLFGVGTDYNILLFTRFKEELSKQENAFLATKETFKSAGKTVLYSGIAVLIGFASLALASFKLYQSTSAVAIGVFVLLLVLTTLNPFFMVLLGKGMFYPVKNFKGHEDSRLWGFFAKNSVARPFVALIIVCVISIPFVLKYSNTLNYNDLFEVDNKYESKMGINVIEEHFPPGFSSPSTLVIQSNNKLDEASSLHTLDELTDKILKVKGVSEVYSPTRPTGDRIKELYINKQAGELNTGLGDANGGIKEINDGLTTAKDKMGNKDSNSLANVQKLIDGTNEAKNGVSALGTALNQLSNGINDGAQGAQQIESGLTSVNENISVLSHATSQLHSGYTQLEKGLSSYDQYFGSISQAIDGAKKGYEQIEMLMTNFIQTKPELANDPNILQTIGIAKEAQKQLGGLSNELNQLATQHNAAMGSFKEANQSLLKVDNGLKEMNNGVTKLQKGAADLKNGLNEGASGSKQIANKSSELQTGLTKINDGQGQLLTGLKDLQEQMGQLQTGLSKSTEGLGKVSNGLNDAQKYLGELNESKSSEKFYIPKEVLEGEDFQKALNTYMSHDRKTAKMTIILDVNPYSKEAMPIIQEINKTINGTLKGTELNNAKTAIGGTTARNVDLKEVTGQDFLRTATIMLIGIAIVLIVITRSLLNTIFIIGSLLLAYFASLGISEQISTHILHVDSLSWNVPFFSFIMIVALGVDYSIFVMMRYNELEGDPATKIVTASRHIGGVVLSAALILGGTFAALIPSGVLTLIQVASVVGVALLLLAIIVMPILLPALIGLTSKMKNYAKKLSERK
>CP024771.1|AXY09415.1|4127134_4127983_+|hypothetical-protein
MNTKLIIVEGLPGFGKSTTAKLINEILSQNKIEVELFLEGNLNHPADYDGVSCFNKFEFDRLLSRSGDFKEVLLKRVIKKGSNYLLPYRKMKNEFGDQFSDELFNTISKNDIYELPFDKNVELIADKWNDFAEIALEDNKVYIFECGFIQNPLTIGMIKYGEQKEKIINYVMKVAKIIENLNPMLLYVEQDNLELSFRKALKERTPEWSTGFVDYYTNQGYGKEHNHSGVEGTIKVLEARRNLELEIFDMLKMNKEKINNTKYEIDSYRSMLKDKLTIQMVK
>CP024771.1|AXY09416.1|4128372_4129998_+|ABC-transporter-ATP-binding-protein
MITVSNVSLRFADRKLFEDVNIKFTPGNCYGLIGANGAGKSTFLKILSGEIEPSTGDIHITPGERLAVLKQNHFEYEEFPVLETVIMGHTQLYKVMQEKNAIYMKEDFSDEDGMRAAELEGEFAELNGWEAESEAAILLKGLGIGEDLHDKKLSELTGAEKVKVLLAQALFGKPDILLLDEPTNHLDLKAIQWLENFLMNFENTVIVVSHDRHFLNKVCTHMADLDFGKIQLYVGNYDFWYESSQLALKLTQDANKKKEEKVKELQNFIARFSSNASKAKQATSRKKLLDKITLDDIRPSSRRYPFVGFTPEREVGNDLLTVEGLSKTIDGEKVLDNVYFTLNKGDKVAFIGRNDIAMTTLFKILMGEMEPDSGSFKWGVTTSQSYFPRDNSKYFENSDLNLVEWLRQFSPQDESESFLRGFLGRMLFSGEEVKKNVSVLSGGEKVRCMLSKMMLSGANVITLDDPTNHLDLESITALNNGLIAFKGTMLFTSHDHQFVQTIANRIIEVTPNGVIDKEATYDEFLENEELQKQVDAMYKGQ
>CP024771.1|AXY09417.1|4130518_4132492_+|glycerol-phosphate-lipoteichoic-acid-synthase
MKQFLLKSKSVLSNHFGFFLFAVILFWLKTYAAYVTEFNLGISNTIQKFLLFFNPLSSAVLFLGLALFAKGKRSYIWLIVINLLLSILLYANVVYYRFFSDFITFPTLTQTNNFGDLGGSIVALLHLYDPLYFLDTIILIVLVATKFANPKPIRVAKHKVSLVFVAGILLFSVNLGLAESDRPELLTRTFDRNYIVKYLGAYNYTIYDGIQSAKASTERALADGDNMTEVRNYLTSTYASPNPEYFGKGKGMNVIYIHLESFQNFLIDYKLNGQEVTPFLNSFTKDANTLYFDNFFHQTGQGKTSDAEFMLENSMFGLPQGSVFTTKSHNTYQSAPAILGQQGYTSAVFHGNYKTFWNRDDIYKSFGFNKFFDASYYDMNEKDVVNYGLKDKPFFNESIPLLETLKQPFYTKFITLSNHFPYPIDKEEATIEPANTGDSSVDTYFQTARYLDESVKGFIDYLKQSGLYDNSIIVMYGDHYGISDNHNAAMSKVMGKEINSFENAQLQRVPLIVRVPGVKGGVQHQYGGEIDVLPTLLHLLGTDTKNYVQFGSDLLSPDHKQVVAFRNGNYVSPTVTALNGKYYDTTTGKPVEFTDEIKQNEQMVQNSLKYSDQVVNGDLLRFYTPEGFTPIDRSKYNYNNRDKNKKKVKTTPEGEAK
>CP024771.1|AXY09418.1|4132548_4133223_-|hypothetical-protein
MDFLSADYLSALLAIIVIDLVLAGDNAIVIGLAARRLPKNQQKKVIIWGTIGAIAIRALATLVVVWLLKIPGLLLIGGVLLIWIAYKLIAEGKDHDIKAEEGFWSAIKTIIIADALMGIDNVLAVAGAAHGNFSLVIIGLLVSIPVVVWGSTLILKWVDRYPIIITIGAAVLAYTAAKMIVDEKWFAAFFESNPFMKWALIIIIIVGVVFFGKAKQKATDGSIS
>CP024771.1|AXY09419.1|4133529_4135635_+|PTS-lichenan-transporter-subunit-IIC
MILDTRSINILQQIIQAEDYVSINQLIDVIQVSKRTLYYDIKKIDDWLQEEGLHSIEYIRHLGYCLNKETKQMIVKKLNESMNNQYEYSPKERKIWLILYLLIQEKRILLEDLINLLQVSRNTVLADLKKLKVEFNKYNLSLHFYRKEGYQIVGNEQSKRNLLILSLSQIISQNGWGYLISQVNYIMSDMGSETDTLARETLYTIKKIFANCEEFLGVQYTDEVLENLSVYMYLFHRRILKGKCVEMEEAEKNVLKDSKQFEAAKYIAKQFERAFVVKFPIDEIYYITTHLLGAKVNYQENVYEKNNMDEIHSIVHCMIKDFQHYACVLFQDFKGLFTDLYLHMKPAFYRVKYGIEIENPLRNTIQENYEEVYFLTKKVIHHFEEYVRKSVSDDEIAYVTMHFGAWMRKEGIVPNPRKTALLVCPNGIGTSRMLQYQLEKLFSNIDILNAISKREYESNTFDVDCIITTTEIEKGNVPVLKVNPILSDSEKAALLRKVNGVLYGENHKDSVDLVMGIIQKYADVVDEKSLKRELIEFMSGPAYFEKEEKYKPMLNELLTREFIHLEDRVDNWKDAIRLAADPLLQNQYIFEEYINEMIVNVEKLGPYIVIAPKIAIPHARPEAGVKKLGMSLLQLKDSVLFSEKQEHAANLIIVLAAIDNETHLKALAQLSEMLSDSKNVEMLIHSNSIDEMLKTIAKYSN
>CP024771.1|AXY09420.1|4135648_4135918_+|PTS-lactose-transporter-subunit-IIB
MKKILVVCGNGLGSSFIVEMNVKKILNELGLQAEVSHTDLASSKSEQADLYLGAKDIICNLEDGTRTVAGLTNILDLNEIKEALQKHLM
>CP024771.1|AXY09421.1|4135942_4137214_+|PTS-ascorbate-transporter-subunit-IIC
MFDIIMKDILGQPAILVGLFAMCGLLLQKKNFADTVSGTLKTIMGFVVLGGGATILIGALDVFGKIFDKAFHIKGIIPNNEAVVAIAQQTLGKETALIMVFGMIANLLIARFTKFKYVFLTGHHTLFMACLISAVFSTTGMQGATLVIVGSIILGALMVIFPALLQPYVRKITGMDDIAIGHFGSVGYLAAGFVGSKFGNKDKSTEQIKVPKSLGFLRDTSVSMSLTMAVLFFIVAPFAGKEFIETELSNGQNYLVYSFMQAITFAAGVYIILAGVRMLIAEIVPAFKGIADKLVPNAKPALDCPTIFPFAPNAVIIGFLTSFIAGLLSMFILPFIGLSVIVPGLIPHFFTGATAAVFGNATGGRRGAILGAFVNGLLISFLPAILLPILGGLGFENTTFGDSDFAVVGILISEIVKLVGYIF
>CP024771.1|AXY09422.1|4137383_4137809_+|PadR-family-transcriptional-regulator
MIFQNEIVSLHVEALKYEFNNAFDTFDRNWLIIKVKLSEGNKVFETMDPFLQTSELQHMKEWFQTLPNPTYTRIDFIEPNLSFEFIGEKEEIFQIIVRLSIELNPSWCKEEEYEFCITITQEDRKNIIRLIEEQQIKFPKR
>CP024771.1|AXY09423.1|4137849_4138677_-|polysaccharide-deacetylase
MHNGIRMTTLVKRAMLICAGVLFTYEAALGSAHTALASTEDEAKSVQLVSEIQSSLAPKEAPKQYNGQVRKVAYLTFDDGPGKYTAELLDMLKKENAKATFFLIGSNVKAFPDLVKREDTEGHYVGMHSMTHNYKKLYTEGHYVDEMKEDQGLIAGVLGKSPVLTRPSYGSMPGLNEALRNKVVENGLKVWDWTIDSLDWRYNKMPVDAASAKIVENVINGANKPTEVILMHDIHPQSVKAVPGIIKGLKEKGYELEAYSENEHFPLNFWHDNRM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP024771_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP024771_4

5244110-5244213

Orphan

Consensus_repeat	Method
CAAGTTTAGGTTTCTTTTGAGAATGT	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of CP024771_4

>merge|CP024771|4|5244110-5244213|CRISPRCasFinder
CAAGTTTAGGTTTCTTTTGAGAATGTGGTATATTTACATGTCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTGACAATTTAGGTTTCTTTTGAGAATGT

>CP024771|4|4|5244110-5244213|CRISPRCasFinder
CAAGTTTAGGTTTCTTTTGAGAATGT	GGTATATTTACATGTCCCGAAGTAGCCGTGGATTGTCTCCTTTCCTTCCTTG
ACAATTTAGGTTTCTTTTGAGAATGT

Protein	Signature genes	Signature genes Name	Protein_function
CP024771.1\|AXY10489.1\|5233273_5234095_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133382
CP024771.1\|AXY10502.1\|5250498_5252133_-\|FAD-binding-monooxygenase	unknown	unknown	gnl\|CDD\|366675
CP024771.1\|AXY10493.1\|5240908_5241760_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176133
CP024771.1\|AXY11156.1\|5234134_5235112_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377332
CP024771.1\|AXY10494.1\|5241893_5242571_+\|YdcF-family-protein	unknown	unknown	gnl\|CDD\|99750
CP024771.1\|AXY11157.1\|5235490_5236504_-\|agmatine-deiminase-family-protein	unknown	unknown	gnl\|CDD\|377332
CP024771.1\|AXY10500.1\|5247797_5248079_-\|hypothetical-protein	unknown	unknown	unknown
CP024771.1\|AXY10495.1\|5242614_5243559_-\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176543
CP024771.1\|AXY10504.1\|5252999_5253998_+\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
CP024771.1\|AXY10497.1\|5245757_5246024_-\|DUF4176-domain-containing-protein	unknown	unknown	gnl\|CDD\|379364
CP024771.1\|AXY10498.1\|5246020_5246800_-\|hypothetical-protein	unknown	unknown	unknown
CP024771.1\|AXY10499.1\|5246817_5247801_-\|WXG100-family-type-VII-secretion-target	unknown	unknown	gnl\|CDD\|274862
CP024771.1\|AXY10496.1\|5244848_5245502_-\|hypothetical-protein	unknown	unknown	unknown
CP024771.1\|AXY10490.1\|5236926_5238054_-\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|365903
CP024771.1\|AXY10501.1\|5248480_5249896_+\|transposase	unknown	unknown	gnl\|CDD\|376980
CP024771.1\|AXY10505.1\|5254175_5255642_+\|YdiU-family-protein	unknown	unknown	gnl\|CDD\|234583
CP024771.1\|AXY11158.1\|5239586_5240795_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341028
CP024771.1\|AXY10491.1\|5238312_5238543_+\|hypothetical-protein	unknown	unknown	unknown
CP024771.1\|AXY10492.1\|5238664_5239454_+\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|379129
CP024771.1\|AXY10503.1\|5252636_5252981_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042

Protein	Function_ID	Function_description	E-value
CP024771.1\|AXY10489.1\|5233273_5234095_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133382	cd01107, HTH_BmrR, Helix-Turn-Helix DNA binding domain of the BmrR transcription regulator. Helix-turn-helix (HTH) multidrug-efflux transporter transcription regulator, BmrR and YdfL of Bacillus subtilis, and related proteins; N-terminal domain. Bmr is a membrane protein which causes the efflux of a variety of toxic substances and antibiotics. BmrR is comprised of two distinct domains that harbor a regulatory (effector-binding) site and an active (DNA-binding) site. The conserved N-terminal domain contains a winged HTH motif that mediates DNA binding, while the C-terminal domain binds coactivating, toxic compounds. BmrR shares the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.	6.48115e-31
CP024771.1\|AXY10502.1\|5250498_5252133_-\|FAD-binding-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	8.68967e-108
CP024771.1\|AXY10493.1\|5240908_5241760_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.89395e-91
CP024771.1\|AXY11156.1\|5234134_5235112_-\|hypothetical-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	6.92063e-16
CP024771.1\|AXY10494.1\|5241893_5242571_+\|YdcF-family-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	7.47367e-20
CP024771.1\|AXY11157.1\|5235490_5236504_-\|agmatine-deiminase-family-protein	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	1.32318e-113
CP024771.1\|AXY10495.1\|5242614_5243559_-\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176543	cd08601, GDPD_SaGlpQ_like, Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized glycerophosphodiester phosphodiesterase (GP-GDE, EC 3.1.4.46) from Staphylococcus aureus, Bacillus subtilis and similar proteins. Members in this family show very high sequence similarity to Escherichia coli periplasmic phosphodiesterase GlpQ, which catalyzes the Ca2+-dependent degradation of periplasmic glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.	2.82804e-148
CP024771.1\|AXY10504.1\|5252999_5253998_+\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	9.94823e-150
CP024771.1\|AXY10497.1\|5245757_5246024_-\|DUF4176-domain-containing-protein	gnl\|CDD\|379364	pfam13780, DUF4176, Domain of unknown function (DUF4176).	1.77547e-34
CP024771.1\|AXY10499.1\|5246817_5247801_-\|WXG100-family-type-VII-secretion-target	gnl\|CDD\|274862	TIGR03930, WXG100_ESAT6, WXG100 family type VII secretion target. Members of this protein family include secretion targets for the two main variants of type VII secretion systems (T7SS), one found in the Actinobacteria, one found in the Firmicutes. This model was derived through iteration from pfam06013. The best characterized member of this family is ESAT-6 from Mycobacterium tuberculosis. Members of this family usually are ~100 amino acids in length but occasionally have a long C-terminal extension.	1.21808e-16
CP024771.1\|AXY10490.1\|5236926_5238054_-\|penicillin-binding-protein	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	1.2906e-59
CP024771.1\|AXY10501.1\|5248480_5249896_+\|transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	5.195e-60
CP024771.1\|AXY10505.1\|5254175_5255642_+\|YdiU-family-protein	gnl\|CDD\|234583	PRK00029, PRK00029, YdiU family protein.	0
CP024771.1\|AXY11158.1\|5239586_5240795_-\|MFS-transporter	gnl\|CDD\|341028	cd17475, MFS_MT3072_like, Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072 and similar transporters of the Major Facilitator Superfamily. This family includes the Mycobacterium tuberculosis uncharacterized MFS-type transporter MT3072. It belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.17437e-97
CP024771.1\|AXY10492.1\|5238664_5239454_+\|IS5/IS1182-family-transposase	gnl\|CDD\|379129	pfam13340, DUF4096, Putative transposase of IS4/5 family (DUF4096).	1.69431e-21
CP024771.1\|AXY10503.1\|5252636_5252981_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.4805e-14

>CP024771.1|AXY10495.1|5242614_5243559_-|glycerophosphodiester-phosphodiesterase
MRKIISVLVIFFMTGSIFAGGAVHAKAEGQHEWNTNKFLNIAHRGASGHAPEHTFASYDLVKKMKADYLELDIQLTKDGQLIAMHDTAVDRTTNGTGEVRDKTLSEIKSLDAGSWFNKAYPEKAKQEYVGQKVPTLEEIFQKYGRSMKYYIETKSPDVYPGMEEKLLALLKKYNLVGQNMSSSRVMIQSFSKDSLTKIHSMNKNIPLVQLLWYYPNENNEIVEWSGITHEPKSVTNEDFQEIKKYAVGIGPNLRNDNGELIIDESYMKMARNNGLLIHPYTINEKPDMRLLMKWGATGMFTNYPDRLHSVLKEK
>CP024771.1|AXY10494.1|5241893_5242571_+|YdcF-family-protein
MVIPKYPDVPTLTKKQIDQITEIAFLKEITPQKCDVIFVFGGSHPGNWQAPLEAYRQGLGNQIIVTGGTSLHGMKHPSWNYGDLSEAEVIVNKLMEHGVPKGAIMFETNSLHSIANVMEAKKIFDFTKVNRLLFVCKSLGAGRQYRVLKKHLPKTITCIPYTFDTSFDGEFIMNRYNWMENEKSRSMIFGEYLRNICYGRKGGIEPPENEVEGLEEYVSYYYNLA
>CP024771.1|AXY10493.1|5240908_5241760_+|LysR-family-transcriptional-regulator
MDIKDLTVFYEVTKENNISHAAKNLNYVQSGVTMRMKQLENELGVPLFYRNGKGVTLTSNGEILLTYAKQIIDLMDQSIKAVQSNGTEPKGTLKIGCTESTTAVRLPSILTAYYEKYPKVDLILETNTTEQLIKLVLERKLDGAFIAGSTQHTELHTNVFHEEELVLISKKTLSSLKDIEGMNLLAFSHGCYYRSLLEDWLQEEDISPKRVLEFGTIEAILACVKSNMGVAIMMKSILKEHEHDVSFNPLPNSFKKVPTTFITRKDIFRSAALQKFMEMTHNA
>CP024771.1|AXY11158.1|5239586_5240795_-|MFS-transporter
MEERMNSTYKWVMLIVATIAQTTATLITYGVGVFALFWKEEYALTNTESGLLVSVVNIGPLFCMLFVGRLLDQYNEKILISISSLLLGGSLLLTNIVSGFNGLLFVLLLIGMFYSVSQPGGSKVILKWFPKENRGLAMGIRQAGIPIGGALAGVLIPFLTIQYNVTYAINSIACICIIGGLLFFMFYKEPYVQEEARKGHIKISFWTELKVVICKKELYPIYITGICMISLQMVLVGHFMKFLVREQSITSIVAGTVFSVMFFSGMIGRVVLAAISDVFYKGNRRIPLFIAVCASIGLVLLLVMSIHTITSGVLYGVSALLGFFSIGWFSLFIAEVAELASEESVGITVSVALTLNQIAITIAPVLFGYVVDEKGYTYAWLCIVVLLSISAVSLSRNLPDSK
>CP024771.1|AXY10492.1|5238664_5239454_+|IS5/IS1182-family-transposase
MIHNYTSNITREQFELIREDLENARKKTRPRTVDLYEVFCGVLYLLTTGCQWRNLPSDFPHWKTVYAYYQIWRKVDENGISLLEKCIKKLVETYREQDGRKNQTSFCIVDAQSVKNTWIAGEKGYDAGKKVSGIKRHIAVDTNGLIHAIDVTTANITDREGAIQMCERHKKTLEKVTNILCDGGYTGPSFAQSIKETIDCSVEIIKRSELHKFVVLPKRWIVERTFAWLENYRRLWKNCERTLENSRQSCLLASVAILLKRF
>CP024771.1|AXY10491.1|5238312_5238543_+|hypothetical-protein
MKNTDKRNRLNDRTFHYRVTKNNIVLIEYYGKQIIILKGNDAKKFLYKINHAHNDTEKQLIMAKVTGNFKRGNERN
>CP024771.1|AXY10490.1|5236926_5238054_-|penicillin-binding-protein
MLKKWLIVFFIFAIFCGSVVALIHANKGKKYDIKAFSNVNSKQKDDMQEVNATEKKRYEAVAGKLDQYLKDKGFNGSVLVASKDHVILRKGYGYANAKDKVVTTPRTKYRIGSITKTVVAISIMQLKEKGKLNIEDNVNKYIPSFPADKNITLRNLLTHTSGLPDQGQGRVDAGSRLKLVTWIGAQKLQFPAGTGWKYTDYNYMVLAYIVEKITNKPLAEYVKENIFTPAGMHESGMGATLPEDIFLAEGYTRKDNELIAAPRLKMNWLYGCGEMYTTVEDMKRLDEAIMDGKLLSKQSVLDMFTASPARKYGFSFYTYPDYYHNHGVLAGWNTFNNFNWDKKTFVILFSNVQNGMNDAFNQEFRKMANDLIEGK
>CP024771.1|AXY11157.1|5235490_5236504_-|agmatine-deiminase-family-protein
MPDEKDKHEGTWLQWPHEYTYGEEYQREVEPIWVKMASTLTEGEKVHIVAYDEEEKERINKLLIDKGLNMDKIDFFIAPTDDVWARDSGPIFVYDNNKNLKILDPAFNGWGKKTPYKNDARIRENVSKQAGIERIDWGNFVLEGGAIELDSNGTALLTRSAVTNKNRNPNLSEKEIEKYISDLGVSNFIWLDGVPNLDITDFHIDGFAKFHGKSTIVTMKEDDLAEWGLSNKDMDTLLDAKNASGQKYKYEYLPLSKGKVTLENGKALDYKGSYINYYIGNTVVLVPNYNDPNDKIANDTIQKLYPDRKVVGIDVRELYKNGGMIHCVTQQQPIALK
>CP024771.1|AXY11156.1|5234134_5235112_-|hypothetical-protein
MEQKQNGIIFTAIPDKSNEYYRPFYEDLIYFNEYLNENKSFTDQLVSLSVEEQDFHTSFFEYDDIWLRDVAPVVINHLVKFKYQPNYLPKDQWRYLDQQFNKWLKKNDFEYVKSPLILDGGNLIWNKKDTVIVTEHIFDDNYDWTEEEIIEQLEWDLDVSRVIIIPAEEGDVLAHADGMVKFIDEHTMFISDFLGDHEFRYNVQEIIQEQMPEAEFIVVPSSYTEKGQYDREIASAKGLYINMLETCDTIYVPKFGLAKDREVLRYIQQHTEKQAIQIHVGEISTMGGAINCLTWYCPHHLLPSKMKRLNNQNEDFSVRKIFDWF
>CP024771.1|AXY10489.1|5233273_5234095_-|MerR-family-transcriptional-regulator
MYTITEFSRICKISTRMLRHYDKEDILKPAYVNPENGYRYYELGQLEIALKIKKLREYKFPLPKIKIILQSSDQDSFVKHMQAQIIELSHEVKQNLQVISEMNEMVNVNNGLHIARHRSYDILIGMRNEITVITQRLQMNIDDMDDYFYDLYEKVQKHNFQIVGSPSTVFYDEEYIPNESDIELRIPILHENDKDVVQECEIKKLNPHQIVTTMHYGSYDYIGYAYIALEKWIERNSYVIVGSPYEVYIKGPECDCLVEEYVTQICLLVMKID
>CP024771.1|AXY10496.1|5244848_5245502_-|hypothetical-protein
MEKYHGKSTEQIIQKLMPDSVRSSVVMVWVVINFMILTPFLFPPTFTIYLYIILPFLLTANIWGVWVFFYKPNEPRLVHILYNGFMGITFSFGSFIVIQKIAYTFIKIETPLFFIVTFVLYILTIYKLISIGMKSFLRRLNNEENDNIKISPIVYLSGLGYVIGQICIGTLSQNGLATVLILVFSLFAIVLSISGVYIWIYVDLKRKEMDGMHNGQI
>CP024771.1|AXY10497.1|5245757_5246024_-|DUF4176-domain-containing-protein
MNSQLFPIGSIVILKEGTKKLMIFGRKQQVATDEVRKFDYMGCPYPEGYINPDFTYLFNHDDIQEVVSTGYEDQEERTFQENVLSKIQ
>CP024771.1|AXY10498.1|5246020_5246800_-|hypothetical-protein
MDKYNGNSIDDCMRILIPFDIRNIVGAFVWVIMNFMLLIILFIFPPFNIYSYVALPFYVICNLWGILVSIYKPRQPQLQHLLYSGFVALSISFCSFIAVQKLAYEFVEIESPLFFILSLIAYSLIVYKSELFWIKYFTARLRGITDQDVKIPKIVYFSGLGYMIGQVSIGILSQKAMAIVLIVIFSFISVVFLALSTHLYFYFDFKKQGITSRHLKELYFQKKPKLSRKERRQSTAASGHVNIPHSQKKTKLTRKEKRQ
>CP024771.1|AXY10499.1|5246817_5247801_-|WXG100-family-type-VII-secretion-target
MSGEIKVTPAHLRKLASNIEQTAHELSETYQRINQQLFDLPFQISGRDAVLNQSQYAGSMLATITTVLKEHSDALRKAADRFEKADQQEVLFGEEAIDVNWFAPLGGDIGDWKENPTGSLFTLLGTVTEGAAAYKLAALHNKGLRVTPFTNEKGKEMVRFQNRTVLKDKNGLNVIRRTKLPLAEVKQIDDVKRYVLSPKEILKDSLKLKTNVLGYAAVGWDVINDTKENIENKASKTKIAGDIIGDAAIGIGSTAASALTGAAIGTVIGGPIGTVVGAGIGFGVSIGISWLTDGIKFNKGDWNHDGKQDSVKDRVKSGIGNVLDKIF
>CP024771.1|AXY10500.1|5247797_5248079_-|hypothetical-protein
MTLYLDDEASSELANIIHNREELNTVQVHYYIKDSWSTDCIQFLYSQNQYWLIQKVLDNEQTQTNFICLDTFTLTEEIKKMVLYLKSLGGETR
>CP024771.1|AXY10501.1|5248480_5249896_+|transposase
MIEQKIILDAYQKGPEAVVSLFEETFHKLEMRIQELENRSKKTSKNSHKPPSTDGFRKPATTSLRKPSHRQTGGQLGHKGHTLRFTETPDHIVRHSLTTCSHCQTSLEQEPTVGYRIRQVYDLPPIQLEVTQHEVEQKECPHCHSFQESTFPTTVSQPVQYGPRVKAFVPYLTQYQCLSYKRTRELFQDCFEHTISEGTLINHNRAFSQQLDPFIQEAKQQILQSPVGHFDETGMRVEKKTQWLHTASTPEVTIQYVHEKRGKDAMDAGEILPSFSGIAVHDGWKSYDAYTDCRHVLCNAHLLRDLQGILDSTKQKWAQEMKSLLQQALELKKHQNGNVSDMEKQRIASTYQAILKKGQDIQPSITLVPGQKVKHTPAQNLLNRFIKYQDRILAFLDGPHIPFDNNQAERDIRMTKVKQKVSGTFRSQSGADVFSRTRSFISTMKKQKQSVLQAMRQVLETGTVPWAQNIQ
>CP024771.1|AXY10502.1|5250498_5252133_-|FAD-binding-monooxygenase
MEDKYMKSNDVPVLIVGGGLSGLASALFLAKHNIEYLLIERHPSTAIHPKAGGLTFRTMELFRELGLEQRIKLAGKALENCRGRIVVHTIAEANKEELEQMRATQYGNDEELLQKIEKISPSKQTACYQIILEEMMLQEAKTLGGQLSFYHELVSFEQNENGVKATIRNRETEKESVIHCDYLIAADGAKSKIREQLGISTEGRGTIGGYYMNIYFEADLSEFIQGDAFGFSMVLHPEVLGALIPVDNARRWIYHVSYDPLKGERPEDFTIERCKQILQTAIGSTNVESEIVSVLPWEATESTATKFQDNRVFLVGDSAHIMPPTGGFGSNTGIQDAHNLAWKLGAVIKGKAKPKLLETYHEERYHVAKLTTAYASSLLFRAANREEGSLNNMDGLAVTVGYQYCSEAILDESATPHRMDIVDLNGRPGTRAPHFWGMYKGKEVSILDLFGNNFVLLTGVDNSSWAEAVYDVSSNLGINIKVYRVGLSGDFIAQENVFCELYGIENEGVVLIRPDGFIGWRSEKAVVNPDVMLEEVMSNLVCDF
>CP024771.1|AXY10503.1|5252636_5252981_+|ArsR-family-transcriptional-regulator
MIEMNKQEQLNIIKRDFIDSQKVLLAIGDETRQAILLVLMETECQTGLRVGEITKQTHLSRPAVSHHLRILREAGIILMRKEGTKNFYYIDIRTKLSLLKNLVLDIEKLLHNFY
>CP024771.1|AXY10504.1|5252999_5253998_+|NADP-dependent-oxidoreductase
MKAMIIDKYGKVPMRMAEVPTPEINEYEVLAEIYAASINPIDFKIRDGKVKMLLKYEMPLILGNDFSGVITKVGSKVTRFKVGDEIYARPRKNKIGTFAEYIAIHEDDIALKPKNLSFEEAASIPLVGLTSYQALHDIMQLQKGQKILIHAGSGGVGTFAIQLAKIMGATVTTTASEAGANLVKSLGADEIINYKTEKFEDILKDYDAVFDTIGGTTLEKSFNIIKSGGNIVSVSGMPNARFGKEFGSGFFKTLLFSLASKKLTALEKKHNARYSFLFMKPSGDQLRTIANYIEAGKIKPIIDRVFSFEDAQKAMEYSEAGRAKGKIIVKIK
>CP024771.1|AXY10505.1|5254175_5255642_+|YdiU-family-protein
MTKNNEAGWNLDNSYATLPQSFYTDIPPTPVSSPELVKLNHSLAISLGFNPEELKKEVEIAIFAGNALPEGSHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTPYSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVASSHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDHENRYTALLQEVIKKQASLIAKWQLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWDLARLAESLIPILHEDEEEALKIAQDEISKFSVQYEKQWFIGMKKKLGLFSNEEQDHSLIEQLLKMMEKYKADYTNTFRSLTLDTLENIPLFDSPEFKEWYKLWQSRLERQEELKENAYEMMKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNRPYRTFCGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP024771_4	4.1\|5244136\|52\|CP024771\|CRISPRCasFinder	5244136-5244187	52	CP024771.1	5246070-5246121	1	0.981

1. spacer 4.1|5244136|52|CP024771|CRISPRCasFinder matches to position: 5246070-5246121, mismatch: 1, identity: 0.981

ggtatatttacatgtcccgaagtagccgtggattgtctcctttccttccttg	CRISPR spacer
ggtatatttacatgtcccgaagcagccgtggattgtctcctttccttccttg	Protospacer
**********************.*****************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

34562 : 105500

Bacillus_phage(79.63%)

tail,portal,protease,integrase,capsid,tRNA,head,transposase,terminase

attL 26751:26767|attR 99975:99991

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
26751:26767	attL	NA	NA	NA	NA
AXY05450.1\|34562_37328_-\|tRNA	isoleucine--tRNA ligase 1	A0A2K9L9X8	Tupanvirus	2.0e-85	26.8
AXY05451.1\|37677_38184_-	septum formation initiator	NA	NA	NA	NA
AXY05452.1\|38273_39041_-	RNA-binding protein	NA	NA	NA	NA
AXY05453.1\|39056_39320_-	YggT family protein	NA	NA	NA	NA
AXY05454.1\|39326_39797_-	cell division protein SepF	NA	NA	NA	NA
AXY05455.1\|39816_40491_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AXY05456.1\|40487_41306_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
AXY05457.1\|41424_41709_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
AXY05458.1\|41855_42635_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
AXY05459.1\|42792_43512_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
AXY05460.1\|43531_44458_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
AXY05461.1\|44763_45918_-	cell division protein FtsZ	NA	NA	NA	NA
AXY05462.1\|45957_47265_-	cell division protein FtsA	NA	NA	NA	NA
AXY05463.1\|47665_48436_-	cell division protein FtsQ	NA	NA	NA	NA
AXY05464.1\|48534_49440_-	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
AXY05465.1\|49501_50596_-	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase	NA	NA	NA	NA
AXY05466.1\|50701_51793_-	stage V sporulation protein E	NA	NA	NA	NA
AXY05467.1\|51883_53236_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
AXY05468.1\|53236_54211_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
AXY05469.1\|54233_55709_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AXY05470.1\|55913_57830_-	stage V sporulation protein D	NA	NA	NA	NA
AXY05471.1\|57911_60062_-	dihydropteridine reductase	NA	NA	NA	NA
AXY05472.1\|60083_60446_-	cell division protein FtsL	NA	NA	NA	NA
AXY05473.1\|60461_61394_-	ribosomal RNA small subunit methyltransferase H	NA	NA	NA	NA
AXY05474.1\|61763_63380_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
AXY05475.1\|63459_64350_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AXY05476.1\|64644_65118_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXY05477.1\|65151_65658_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	5.1e-11	34.7
AXY05478.1\|65787_65961_-	50S ribosomal protein L32	NA	NA	NA	NA
AXY05479.1\|66022_66523_-	DUF177 domain-containing protein	NA	NA	NA	NA
AXY10934.1\|66796_67378_-	hypothetical protein	A0A288WG23	Bacillus_phage	2.4e-81	78.4
AXY05480.1\|67355_68540_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	2.6e-138	60.9
AXY05481.1\|68658_68841_-	hypothetical protein	A0A288WGN6	Bacillus_phage	3.1e-19	78.3
AXY05482.1\|68837_69134_-	hypothetical protein	A0A288WG38	Bacillus_phage	1.2e-23	52.6
AXY05483.1\|69318_69531_+	XRE family transcriptional regulator	Q2I8E4	Bacillus_phage	2.7e-30	100.0
AXY05484.1\|69523_70015_+	hypothetical protein	Q3HL01	Bacillus_phage	1.2e-76	98.2
AXY05485.1\|70071_70869_-	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.8e-111	69.8
AXY10935.1\|70868_71012_-	hypothetical protein	D2XR32	Bacillus_phage	2.3e-17	85.1
AXY05486.1\|71083_71323_-	peptidase	A0A1B1P7E0	Bacillus_phage	8.0e-31	86.1
AXY05487.1\|71413_71746_-	hypothetical protein	A0A1B2APY3	Phage_Wrath	8.8e-28	60.7
AXY05488.1\|71809_73300_-	hypothetical protein	A0A0S2SXW1	Bacillus_phage	1.6e-31	41.0
AXY05489.1\|73358_74978_-	hypothetical protein	A0A0K1LLF9	Bacillus_phage	3.6e-98	38.3
AXY05490.1\|74993_75857_-\|tail	phage tail family protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.7e-75	56.0
AXY05491.1\|75861_80376_-	hypothetical protein	A6XMK6	Bacillus_virus	1.6e-111	52.9
AXY05492.1\|80554_81016_-	hypothetical protein	A0A1B1P772	Bacillus_phage	2.5e-49	61.8
AXY05493.1\|81083_81671_-\|tail	phage tail protein	A0A1B1P778	Bacillus_phage	3.6e-93	85.1
AXY05494.1\|81672_82101_-	hypothetical protein	A0A1B1P769	Bacillus_phage	1.3e-63	85.1
AXY10936.1\|82087_82465_-	hypothetical protein	A0A1B1P759	Bacillus_phage	2.1e-46	76.8
AXY10937.1\|82481_82838_-\|head,tail	phage head-tail adapter protein	A0A1B1P760	Bacillus_phage	2.2e-53	86.4
AXY10938.1\|82818_83118_-	hypothetical protein	A0A1B1P751	Bacillus_phage	6.2e-41	84.5
AXY05495.1\|83127_83367_-	hypothetical protein	NA	NA	NA	NA
AXY05496.1\|83381_84533_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.5e-204	93.5
AXY10939.1\|84561_85287_-\|protease	Clp protease ClpP	A0A1B1P753	Bacillus_phage	7.9e-106	82.6
AXY05497.1\|85288_86455_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	1.6e-204	92.0
AXY05498.1\|86469_88152_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	1.2e-311	94.4
AXY05499.1\|88135_88456_-	hypothetical protein	A0A1B1P762	Bacillus_phage	1.7e-44	85.8
AXY05500.1\|88563_88872_-	hypothetical protein	A0A1B1P767	Bacillus_phage	5.6e-45	90.4
AXY10940.1\|88874_89069_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	1.4e-30	95.3
AXY05501.1\|89182_89434_-	hypothetical protein	A0A1B1P743	Bacillus_phage	9.3e-14	52.4
AXY05502.1\|89438_89735_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.2e-07	50.0
AXY05503.1\|89741_89966_-	hypothetical protein	A0A1B1P745	Bacillus_phage	6.1e-25	85.1
AXY05504.1\|90499_91054_-	hypothetical protein	NA	NA	NA	NA
AXY05505.1\|91444_91987_-\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	2.3e-89	91.1
AXY05506.1\|91983_92454_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	7.5e-49	63.2
AXY05507.1\|92474_92645_-	hypothetical protein	NA	NA	NA	NA
AXY05508.1\|92940_94134_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
AXY05509.1\|94319_94502_-	hypothetical protein	NA	NA	NA	NA
AXY05510.1\|94521_94644_-	DUF3983 domain-containing protein	NA	NA	NA	NA
AXY05511.1\|94693_95119_-	hypothetical protein	NA	NA	NA	NA
AXY10941.1\|95154_95463_-	hypothetical protein	NA	NA	NA	NA
AXY05512.1\|95831_96080_-	XRE family transcriptional regulator	A0A0U3J7D7	Bacillus_phage	4.2e-35	89.0
AXY05513.1\|96196_96406_-	hypothetical protein	A0A1B1P8C8	Bacillus_phage	6.8e-18	68.8
AXY05514.1\|96431_96611_-	hypothetical protein	A0A1B1P7M8	Bacillus_phage	9.2e-24	94.5
AXY05515.1\|96610_96808_-	hypothetical protein	A0A097BYE4	Leuconostoc_phage	6.2e-05	38.7
AXY05516.1\|96845_97139_-	hypothetical protein	NA	NA	NA	NA
AXY05517.1\|97976_98168_-	hypothetical protein	NA	NA	NA	NA
AXY05518.1\|98209_98692_-	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
AXY05519.1\|98711_98963_-	helix-turn-helix domain containing protein	A0A0K2CNP4	Brevibacillus_phage	4.9e-07	42.2
AXY05520.1\|98988_99156_-	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
AXY05521.1\|99174_99534_-	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	1.1e-31	53.3
AXY05522.1\|99526_99805_-	AbrB family transcriptional regulator	A0A2I7SC16	Paenibacillus_phage	3.5e-14	64.4
AXY05523.1\|99821_100016_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.9e-22	81.2
99975:99991	attR	NA	NA	NA	NA
AXY05524.1\|100018_100882_-	hypothetical protein	A0A1B0T6C3	Bacillus_phage	1.3e-102	71.1
AXY05525.1\|100823_101699_-	replication protein	V5UQV4	Oenococcus_phage	4.2e-37	38.3
AXY05526.1\|101704_101881_-	hypothetical protein	A0A1B1P7U0	Bacillus_phage	6.5e-22	82.8
AXY05527.1\|101910_102075_-	hypothetical protein	A0A0U3B230	Bacillus_phage	1.1e-18	85.2
AXY05528.1\|102131_102332_-	DNA-binding protein	A0A0U4IIS1	Bacillus_phage	3.9e-07	48.0
AXY05529.1\|102384_102609_-	XRE family transcriptional regulator	NA	NA	NA	NA
AXY05530.1\|102827_103196_+	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	4.1e-10	39.6
AXY05531.1\|103459_103609_-	hypothetical protein	NA	NA	NA	NA
AXY05532.1\|103621_104719_-	hypothetical protein	NA	NA	NA	NA
AXY05533.1\|105155_105500_+	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	6.1e-16	36.6

DBSCAN-SWA_2

656001 : 663680

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY06132.1\|656001_656925_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-46	47.8
AXY06133.1\|657050_657986_-	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	4.3e-11	25.9
AXY06134.1\|657987_658680_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.8e-36	38.7
AXY06135.1\|658848_659022_+	hypothetical protein	NA	NA	NA	NA
AXY06136.1\|659022_659217_+	hypothetical protein	NA	NA	NA	NA
AXY06137.1\|659256_660456_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	6.1e-71	41.2
AXY06138.1\|660751_661075_+	heme-degrading monooxygenase	NA	NA	NA	NA
AXY06139.1\|661140_661905_-	SrtB family sortase	NA	NA	NA	NA
AXY06140.1\|661936_662707_-	ABC transporter ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.7e-05	24.4
AXY06141.1\|662696_663680_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	7.1e-17	26.6

DBSCAN-SWA_3

1031678 : 1109953

Bacillus_phage(44.68%)

tail,portal,protease,integrase,coat,capsid,tRNA,holin,head,transposase,terminase

attL 1053480:1053497|attR 1113523:1113540

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY06510.1\|1031678_1033055_+\|tRNA	glycine--tRNA ligase	A0A1V0SIF1	Klosneuvirus	2.6e-49	28.1
AXY06511.1\|1033094_1033478_-	esterase	NA	NA	NA	NA
AXY06512.1\|1033573_1034317_+	DUF3298/DUF4163 domain-containing protein	NA	NA	NA	NA
AXY06513.1\|1034367_1034949_+	BioY family transporter	NA	NA	NA	NA
AXY06514.1\|1034990_1035878_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	7.7e-79	52.7
AXY06515.1\|1035986_1037711_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	5.2e-180	54.4
AXY06516.1\|1037854_1038460_+	hypothetical protein	NA	NA	NA	NA
AXY06517.1\|1038543_1040028_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	8.7e-59	37.2
AXY06518.1\|1040172_1040832_-	hypothetical protein	A0A0H3UZG2	Geobacillus_virus	1.0e-14	43.9
AXY06519.1\|1040885_1041203_-	hypothetical protein	NA	NA	NA	NA
AXY06520.1\|1041199_1041706_-	NUDIX hydrolase	NA	NA	NA	NA
AXY06521.1\|1041828_1043040_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AXY06522.1\|1043493_1044489_+	Ferredoxin--NADP reductase 2	Q9JRK7	Streptococcus_phage	3.0e-31	52.4
AXY06523.1\|1044615_1045092_+	AraC family transcriptional regulator	NA	NA	NA	NA
AXY06524.1\|1045423_1046671_+	MFS transporter	NA	NA	NA	NA
AXY06525.1\|1046681_1047569_-	decarboxylase	NA	NA	NA	NA
AXY06526.1\|1047649_1048111_+	DUF523 domain-containing protein	NA	NA	NA	NA
AXY06527.1\|1048433_1049498_+	cytosolic protein	A0A0S2MVF4	Bacillus_phage	9.2e-10	48.8
AXY06528.1\|1049646_1049838_+	hypothetical protein	NA	NA	NA	NA
AXY06529.1\|1049851_1050118_+	hypothetical protein	NA	NA	NA	NA
AXY06530.1\|1050510_1051686_-	D-alanyl-D-alanine carboxypeptidase	R4JG75	Mycobacterium_phage	1.2e-26	28.5
1053480:1053497	attL	NA	NA	NA	NA
AXY06531.1\|1053828_1054896_-	N-acetylmuramoyl-L-alanine amidase	A0A0A7AQV3	Bacillus_phage	4.3e-193	91.8
AXY06532.1\|1054892_1055132_-\|holin	holin	A0A2H4J378	uncultured_Caudovirales_phage	1.5e-32	97.5
AXY06533.1\|1055131_1055368_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	97.4
AXY06534.1\|1055777_1059773_-	peptidase S74	Q2LIB7	Bacillus_phage	0.0e+00	85.3
AXY06535.1\|1059769_1061260_-\|tail	phage tail protein	Q2LIB8	Bacillus_phage	3.3e-276	93.8
AXY06536.1\|1061265_1065126_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	0.0e+00	91.1
AXY06537.1\|1065346_1065664_-	hypothetical protein	A0A288WFU2	Bacillus_phage	1.2e-53	100.0
AXY06538.1\|1065713_1066322_-\|tail	phage tail protein	A0A288WG55	Bacillus_phage	1.1e-103	98.5
AXY06539.1\|1066322_1066682_-	DUF3168 domain-containing protein	A0A0S2GLE3	Bacillus_phage	2.7e-59	95.0
AXY06540.1\|1066678_1067116_-	hypothetical protein	A0A288WGM7	Bacillus_phage	1.0e-76	99.3
AXY06541.1\|1067108_1067432_-\|head,tail	head-tail adaptor protein	H0USW8	Bacillus_phage	7.0e-54	92.5
AXY06542.1\|1067428_1067707_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	5.8e-41	94.6
AXY06543.1\|1067727_1068900_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	3.0e-195	88.5
AXY06544.1\|1068937_1069648_-\|protease	Clp protease ClpP	A0A0S2GLD5	Bacillus_phage	1.3e-124	96.2
AXY06545.1\|1069634_1070888_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	1.7e-236	97.4
AXY06546.1\|1071076_1072771_-\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	0.0e+00	99.6
AXY06547.1\|1072772_1073276_-\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	6.7e-88	99.4
AXY06548.1\|1073384_1073759_-	HNH endonuclease	H0USW1	Bacillus_phage	2.0e-60	88.5
AXY06549.1\|1073748_1074003_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	3.8e-39	88.1
AXY06550.1\|1074003_1074258_-	hypothetical protein	A0A1B1P7X2	Bacillus_phage	2.8e-18	59.3
AXY06551.1\|1074280_1074502_-	hypothetical protein	NA	NA	NA	NA
AXY10983.1\|1074716_1075106_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	3.5e-36	57.4
AXY06552.1\|1075763_1076030_-	hypothetical protein	A0A0H3V0M3	Geobacillus_virus	1.3e-13	51.2
AXY06553.1\|1076073_1076232_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
AXY06554.1\|1076245_1076785_-	nuclease	A0A0S2SXQ1	Bacillus_phage	3.5e-50	54.2
AXY06555.1\|1076787_1077216_-	hypothetical protein	A0A2H4JFQ6	uncultured_Caudovirales_phage	1.5e-56	69.5
AXY06556.1\|1077203_1077443_-	hypothetical protein	NA	NA	NA	NA
AXY06557.1\|1077768_1080111_-	DNA primase	A0A2H4J990	uncultured_Caudovirales_phage	0.0e+00	84.7
AXY06558.1\|1080182_1080659_-	DUF669 domain-containing protein	A0A1B2AQ07	Phage_Wrath	3.0e-29	46.9
AXY06559.1\|1080658_1081360_-	DNA-binding protein	A0A2H4JHI2	uncultured_Caudovirales_phage	1.6e-71	58.1
AXY06560.1\|1081360_1081555_-	hypothetical protein	NA	NA	NA	NA
AXY06561.1\|1081705_1081942_-	hypothetical protein	NA	NA	NA	NA
AXY06562.1\|1082215_1082416_-	hypothetical protein	A0A1B1P7L2	Bacillus_phage	7.7e-11	56.5
AXY06563.1\|1082678_1083467_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY06564.1\|1083464_1084076_-	sigma-70 family RNA polymerase sigma factor	A0A0S2GLJ1	Bacillus_phage	2.7e-75	68.0
AXY06565.1\|1084096_1084285_-	transcriptional regulator	A0A1B2APY7	Phage_Wrath	9.4e-19	75.8
AXY06566.1\|1084296_1084494_-	hypothetical protein	NA	NA	NA	NA
AXY06567.1\|1084689_1085010_-	XRE family transcriptional regulator	NA	NA	NA	NA
AXY06568.1\|1085188_1085527_+	XRE family transcriptional regulator	E9LUL4	Lactobacillus_phage	1.4e-09	35.2
AXY06569.1\|1085677_1087129_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY06570.1\|1087250_1087427_-	hypothetical protein	NA	NA	NA	NA
AXY10984.1\|1087714_1088854_-	hypothetical protein	H0UST6	Bacillus_phage	1.0e-139	65.3
AXY06571.1\|1090373_1091435_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	2.1e-171	83.6
AXY06572.1\|1091522_1091876_-	DUF1093 domain-containing protein	A0A0K2CYS5	Paenibacillus_phage	3.2e-12	39.5
AXY10985.1\|1091982_1092120_-	methyltransferase	NA	NA	NA	NA
AXY06573.1\|1092600_1093164_+	N-acetyltransferase	NA	NA	NA	NA
AXY06574.1\|1093270_1093624_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	6.3e-16	43.3
AXY06575.1\|1093665_1094532_-	diaminopimelate epimerase	NA	NA	NA	NA
AXY06576.1\|1094777_1095017_-	hypothetical protein	NA	NA	NA	NA
AXY06577.1\|1095369_1096440_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AXY06578.1\|1096671_1096845_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
AXY06579.1\|1096899_1097559_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	35.2
AXY06580.1\|1097542_1098340_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AXY06581.1\|1098480_1098822_-	alkylphosphonate utilization protein	NA	NA	NA	NA
AXY06582.1\|1099358_1100036_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AXY06583.1\|1100134_1101013_-	nucleotidyltransferase	NA	NA	NA	NA
AXY06584.1\|1100981_1101290_-	DUF1462 domain-containing protein	NA	NA	NA	NA
AXY06585.1\|1101496_1101733_+	NifU family protein	Q58MC7	Prochlorococcus_phage	2.0e-10	46.6
AXY06586.1\|1101927_1102143_+	carbonic anhydrase	NA	NA	NA	NA
AXY06587.1\|1102204_1103206_-\|coat	spore coat protein YutH	NA	NA	NA	NA
AXY06588.1\|1103326_1103818_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	3.5e-41	53.8
AXY06589.1\|1103838_1104318_-	N-acetyltransferase	NA	NA	NA	NA
AXY06590.1\|1104820_1107397_-	permease	NA	NA	NA	NA
AXY06591.1\|1107377_1108166_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-33	39.5
AXY06592.1\|1108540_1109953_-\|transposase	transposase	NA	NA	NA	NA
1113523:1113540	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1953713 : 1962086

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY07358.1\|1953713_1955021_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
AXY07359.1\|1955109_1955829_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
AXY07360.1\|1955821_1956076_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AXY07361.1\|1956072_1956756_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AXY07362.1\|1956739_1958959_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.3e-162	41.0
AXY07363.1\|1958943_1960359_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-55	35.0
AXY07364.1\|1960461_1961502_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.4e-68	45.6
AXY07365.1\|1961498_1962086_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.7e-26	35.8

DBSCAN-SWA_5

1980787 : 2070790

104

Bacillus_phage(67.31%)

tail,integrase,protease,coat,capsid,head,tRNA,holin,portal,transposase,terminase

attL 2003933:2003963|attR 2043729:2043759

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY07385.1\|1980787_1982200_-\|transposase	transposase	NA	NA	NA	NA
AXY11015.1\|1982428_1982635_-	DUF3926 domain-containing protein	NA	NA	NA	NA
AXY07386.1\|1982612_1983794_-	arsenic-transporting ATPase	NA	NA	NA	NA
AXY07387.1\|1983871_1984354_-	MarR family transcriptional regulator	NA	NA	NA	NA
AXY07388.1\|1984585_1984822_+	hypothetical protein	NA	NA	NA	NA
AXY07389.1\|1984963_1985254_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C	NA	NA	NA	NA
AXY07390.1\|1985269_1986727_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A	NA	NA	NA	NA
AXY07391.1\|1986741_1988169_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B	NA	NA	NA	NA
AXY07392.1\|1988639_1989545_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	3.1e-27	30.8
AXY07393.1\|1989684_1990431_+	HAD family hydrolase	NA	NA	NA	NA
AXY07394.1\|1990585_1991950_+	4-aminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
AXY07395.1\|1992066_1993434_+	RNA polymerase subunit sigma-54	NA	NA	NA	NA
AXY07396.1\|1993426_1994878_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AXY07397.1\|1994925_1995249_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AXY07398.1\|1995289_1996519_-	aminopeptidase	NA	NA	NA	NA
AXY07399.1\|1997001_1997475_+\|transposase	transposase family protein	NA	NA	NA	NA
AXY07400.1\|1997464_1998571_+	hypothetical protein	NA	NA	NA	NA
AXY07401.1\|1999597_2000701_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
AXY07402.1\|2000977_2002174_-	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AXY07403.1\|2002599_2003979_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	5.0e-117	46.5
2003933:2003963	attL	NA	NA	NA	NA
AXY07404.1\|2004037_2005162_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	9.7e-212	98.7
AXY07405.1\|2005206_2005425_+	hypothetical protein	NA	NA	NA	NA
AXY07406.1\|2005437_2005782_-	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	1.2e-32	61.3
AXY07407.1\|2006272_2007424_+	hypothetical protein	D2XQ10	Bacillus_virus	7.0e-72	43.3
AXY07408.1\|2007930_2008290_-	XRE family transcriptional regulator	A0A0A7AR52	Bacillus_phage	4.3e-20	41.2
AXY07409.1\|2008460_2008664_+	XRE family transcriptional regulator	A0A0A7AQV9	Bacillus_phage	3.4e-14	59.7
AXY07410.1\|2008730_2009462_+	Rha family transcriptional regulator	A0A1B1P7T7	Bacillus_phage	2.1e-122	89.3
AXY07411.1\|2009505_2009856_+	DNA-binding protein	A0A1B0T6C2	Bacillus_phage	4.6e-51	81.0
AXY11016.1\|2009855_2010020_+	hypothetical protein	A0A0U3B230	Bacillus_phage	3.3e-20	88.9
AXY07412.1\|2010049_2010226_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	1.2e-23	86.2
AXY07413.1\|2010230_2011118_+	chromosomal replication initiator DnaA	A0A0U3TZZ4	Bacillus_phage	5.5e-93	66.4
AXY07414.1\|2011132_2012047_+	AAA family ATPase	A0A0U3U1U1	Bacillus_phage	2.9e-169	98.7
AXY07415.1\|2012059_2012254_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	8.2e-26	87.5
AXY07416.1\|2012270_2012549_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	7.4e-12	59.3
AXY07417.1\|2012541_2012901_+	cell division protein SepF	A0A1B1P7A1	Bacillus_phage	1.1e-31	53.3
AXY07418.1\|2012919_2013087_+	DUF3954 domain-containing protein	A0A1B0T6B8	Bacillus_phage	1.4e-13	62.3
AXY07419.1\|2013112_2013364_+	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	1.3e-15	48.7
AXY07420.1\|2013383_2013866_+	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
AXY07421.1\|2013904_2014144_+	hypothetical protein	NA	NA	NA	NA
AXY07422.1\|2014364_2014697_+	hypothetical protein	NA	NA	NA	NA
AXY07423.1\|2014724_2015420_+	hypothetical protein	A0A1I9S6E4	Bacillus_phage	8.4e-113	81.0
AXY07424.1\|2015637_2015817_+	hypothetical protein	NA	NA	NA	NA
AXY07425.1\|2015855_2016038_+	hypothetical protein	A0A0A7AR63	Bacillus_phage	2.2e-12	54.4
AXY07426.1\|2016074_2016311_+	hypothetical protein	NA	NA	NA	NA
AXY07427.1\|2016570_2016753_+	hypothetical protein	G9J254	Bacillus_phage	3.9e-14	70.4
AXY11017.1\|2016781_2016964_+	hypothetical protein	G9J1S8	Bacillus_phage	1.9e-08	51.7
AXY07428.1\|2016974_2017097_+	DUF3983 domain-containing protein	NA	NA	NA	NA
AXY07429.1\|2017117_2017300_+	hypothetical protein	NA	NA	NA	NA
AXY07430.1\|2017404_2017575_+	hypothetical protein	NA	NA	NA	NA
AXY07431.1\|2017595_2018072_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	9.3e-47	61.0
AXY07432.1\|2018068_2018611_+\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	3.6e-87	88.3
AXY07433.1\|2019214_2019427_+	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	2.2e-08	39.1
AXY11018.1\|2019628_2019862_+	hypothetical protein	NA	NA	NA	NA
AXY07434.1\|2019875_2020193_+	hypothetical protein	Q2I8B8	Bacillus_phage	2.3e-09	55.1
AXY07435.1\|2020194_2020536_+	hypothetical protein	A0A1B1P7D2	Bacillus_phage	9.7e-06	35.2
AXY07436.1\|2020546_2020858_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-33	68.0
AXY07437.1\|2020861_2021161_+	hypothetical protein	NA	NA	NA	NA
AXY07438.1\|2021267_2021591_+	hypothetical protein	A0A1B1P762	Bacillus_phage	5.5e-43	87.6
AXY07439.1\|2021571_2023245_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	7.8e-290	89.7
AXY07440.1\|2023261_2024425_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	2.3e-131	59.4
AXY07441.1\|2024521_2025640_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AXY07442.1\|2025990_2026734_+\|protease	Clp protease ClpP	Q8W605	Listeria_phage	1.4e-60	65.4
AXY07443.1\|2026771_2027914_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.5e-122	57.8
AXY07444.1\|2028075_2028381_+	hypothetical protein	A0A1B1P751	Bacillus_phage	1.2e-18	54.1
AXY07445.1\|2028364_2028712_+\|head,tail	head-tail adaptor protein	A0A1B1P760	Bacillus_phage	1.8e-31	62.7
AXY07446.1\|2028701_2029088_+	hypothetical protein	NA	NA	NA	NA
AXY07447.1\|2029077_2029500_+	hypothetical protein	R4IBU7	Listeria_phage	2.3e-20	39.7
AXY07448.1\|2029506_2030100_+\|tail	phage tail protein	A0A1B1P778	Bacillus_phage	5.0e-58	55.3
AXY07449.1\|2030118_2030571_+	hypothetical protein	A0A1B1P772	Bacillus_phage	2.1e-19	36.3
AXY07450.1\|2030753_2032364_+	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	8.2e-103	71.4
AXY11019.1\|2033976_2034999_+	hypothetical protein	A0A2I7SCT8	Paenibacillus_phage	1.3e-24	62.4
AXY07451.1\|2034991_2035678_+\|tail	phage tail protein	A0A2H4J851	uncultured_Caudovirales_phage	4.9e-81	61.4
AXY07452.1\|2035674_2038290_+	hypothetical protein	A0A2H4JFY7	uncultured_Caudovirales_phage	4.1e-277	52.1
AXY07453.1\|2038279_2040004_+	hypothetical protein	A0A2H4J855	uncultured_Caudovirales_phage	5.2e-39	54.0
AXY07454.1\|2040091_2040514_+\|holin	holin	D2XPZ9	Bacillus_virus	1.4e-67	97.1
AXY07455.1\|2040596_2041790_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
AXY07456.1\|2042086_2042884_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.3e-112	72.1
AXY07457.1\|2043112_2043466_-	YolD-like family protein	A0A2H4JEH6	uncultured_Caudovirales_phage	1.4e-10	34.7
AXY07458.1\|2043868_2044858_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
2043729:2043759	attR	NA	NA	NA	NA
AXY07459.1\|2044982_2045180_+	hypothetical protein	NA	NA	NA	NA
AXY07460.1\|2045173_2047192_+	ATPase	NA	NA	NA	NA
AXY07461.1\|2047269_2047788_+	DUF1456 domain-containing protein	Q9EYF4	Enterobacteria_phage	1.0e-22	37.7
AXY07462.1\|2048163_2049900_-	hypothetical protein	NA	NA	NA	NA
AXY07463.1\|2050247_2050955_+	M48 family peptidase	NA	NA	NA	NA
AXY07464.1\|2051015_2051711_-	N-acetyltransferase	NA	NA	NA	NA
AXY07465.1\|2051725_2052835_-	dipeptide epimerase	Q6A202	Oenococcus_phage	8.6e-19	25.5
AXY07466.1\|2052927_2054199_+	transcriptional regulator	NA	NA	NA	NA
AXY07467.1\|2054187_2055609_-	Na+/H+ antiporter NhaC	NA	NA	NA	NA
AXY07468.1\|2055903_2057019_+	amidohydrolase	NA	NA	NA	NA
AXY07469.1\|2057151_2057760_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AXY07470.1\|2057763_2058510_+	hypothetical protein	NA	NA	NA	NA
AXY07471.1\|2058562_2060089_-	alkyl hydroperoxide reductase subunit F	A0A1W6JNB4	Lactococcus_phage	9.1e-19	30.8
AXY07472.1\|2060103_2060667_-	peroxiredoxin	NA	NA	NA	NA
AXY07473.1\|2061257_2062487_+	S-methyl-5-thioribose kinase	NA	NA	NA	NA
AXY07474.1\|2062496_2063540_+	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
AXY07475.1\|2063595_2064237_+	fuculose phosphate aldolase	NA	NA	NA	NA
AXY07476.1\|2064277_2065285_-	iron ABC transporter permease	NA	NA	NA	NA
AXY07477.1\|2065281_2066298_-	iron ABC transporter permease	NA	NA	NA	NA
AXY07478.1\|2066370_2067288_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AXY07479.1\|2067620_2068583_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	2.7e-13	26.2
AXY07480.1\|2068778_2069147_-	hypothetical protein	NA	NA	NA	NA
AXY07481.1\|2069328_2069568_+	hypothetical protein	NA	NA	NA	NA
AXY07482.1\|2069804_2070320_+\|coat	spore coat protein	NA	NA	NA	NA
AXY07483.1\|2070340_2070790_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_6

2961331 : 3000230

Acinetobacter_phage(30.0%)

coat,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY08296.1\|2961331_2962069_+\|coat	spore coat protein	I7I009	Enterobacteria_phage	8.7e-52	44.9
AXY08297.1\|2962077_2962623_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	3.9e-33	44.1
AXY08298.1\|2962638_2963610_+	dTDP-glucose 4,6-dehydratase	M1IBX1	Acanthocystis_turfacea_Chlorella_virus	5.3e-73	44.6
AXY08299.1\|2963621_2964476_+	dTDP-4-dehydrorhamnose reductase	H9NCE8	Sphingomonas_phage	8.1e-09	26.6
AXY08300.1\|2964584_2965355_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AXY08301.1\|2965496_2966045_+	hypothetical protein	NA	NA	NA	NA
AXY08302.1\|2966105_2966564_-\|coat	spore coat protein	NA	NA	NA	NA
AXY08303.1\|2966689_2967049_+	DUF1360 domain-containing protein	NA	NA	NA	NA
AXY08304.1\|2967152_2967338_+	cytochrome C oxidase subunit III	NA	NA	NA	NA
AXY08305.1\|2967414_2967918_-	hypothetical protein	NA	NA	NA	NA
AXY08306.1\|2968085_2968556_-\|coat	spore coat protein	NA	NA	NA	NA
AXY08307.1\|2968698_2970765_-	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	1.8e-78	31.8
AXY08308.1\|2970864_2971287_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXY08309.1\|2971288_2971807_-	hypothetical protein	NA	NA	NA	NA
AXY08310.1\|2971899_2972631_-	esterase family protein	NA	NA	NA	NA
AXY08311.1\|2972834_2973746_+	EamA/RhaT family transporter	NA	NA	NA	NA
AXY08312.1\|2974241_2974640_-	hypothetical protein	NA	NA	NA	NA
AXY08313.1\|2974803_2976282_-	sodium/proline symporter PutP	A0A219Y9P9	Aeromonas_phage	2.6e-10	24.6
AXY08314.1\|2976587_2976761_+	hypothetical protein	NA	NA	NA	NA
AXY11050.1\|2977155_2978583_+	anthranilate synthase component I	NA	NA	NA	NA
AXY08315.1\|2978579_2979167_+	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	3.9e-47	47.4
AXY08316.1\|2979163_2980189_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	6.0e-51	34.5
AXY08317.1\|2980190_2980952_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.4e-36	41.0
AXY08318.1\|2980948_2981563_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
AXY08319.1\|2981559_2982753_+	tryptophan synthase subunit beta	NA	NA	NA	NA
AXY08320.1\|2982756_2983533_+	tryptophan synthase subunit alpha	NA	NA	NA	NA
AXY08321.1\|2983607_2983967_+	hypothetical protein	NA	NA	NA	NA
AXY08322.1\|2984082_2985582_+	L-lactate permease	NA	NA	NA	NA
AXY08323.1\|2985672_2986356_+	DUF2278 domain-containing protein	NA	NA	NA	NA
AXY08324.1\|2986370_2987204_-	hypothetical protein	NA	NA	NA	NA
AXY08325.1\|2987364_2988477_-\|transposase	transposase	A0A288TXV8	Enterococcus_phage	5.5e-82	47.5
AXY08326.1\|2988906_2989692_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
AXY08327.1\|2989711_2990947_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
AXY08328.1\|2990985_2991414_-	hypothetical protein	NA	NA	NA	NA
AXY08329.1\|2991516_2991612_+	hypothetical protein	NA	NA	NA	NA
AXY08330.1\|2991613_2992948_+	CoA-disulfide reductase	NA	NA	NA	NA
AXY08331.1\|2993048_2993537_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXY08332.1\|2993683_2994094_+	DUF3908 domain-containing protein	NA	NA	NA	NA
AXY08333.1\|2994124_2994715_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AXY08334.1\|2994807_2996349_-	NADH oxidase	NA	NA	NA	NA
AXY08335.1\|2996364_2998314_-\|bacteriocin	bacteriocin biosynthesis protein SagD	NA	NA	NA	NA
AXY08336.1\|2998310_3000230_-\|bacteriocin	putative thiazole-containing bacteriocin maturation protein	NA	NA	NA	NA

DBSCAN-SWA_7

3145325 : 3224661

Bacillus_phage(74.0%)

tail,integrase,protease,bacteriocin,capsid,head,portal,transposase,terminase

attL 3162561:3162578|attR 3190206:3190223

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY08500.1\|3145325_3147212_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.9e-87	34.3
AXY08501.1\|3147418_3148528_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	2.1e-142	76.2
AXY08502.1\|3148953_3149298_-	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	7.7e-19	42.9
AXY08503.1\|3149822_3150962_+	hypothetical protein	H0UST6	Bacillus_phage	8.4e-62	37.1
AXY08504.1\|3151411_3151759_-	XRE family transcriptional regulator	A0A0A7AR52	Bacillus_phage	4.2e-49	91.3
AXY08505.1\|3151934_3152153_+	XRE family transcriptional regulator	A0A0A7AQV9	Bacillus_phage	4.7e-30	90.3
AXY08506.1\|3152211_3152886_+	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	4.0e-59	52.2
AXY08507.1\|3152923_3153199_+	DNA-binding protein	A0A0U3ULL9	Bacillus_phage	2.1e-35	86.5
AXY08508.1\|3153234_3153399_+	hypothetical protein	A0A0U3B230	Bacillus_phage	7.2e-15	70.4
AXY08509.1\|3153428_3153605_+	hypothetical protein	A0A0U3SQC4	Bacillus_phage	2.7e-20	79.3
AXY08510.1\|3153609_3154359_+	DnaD domain protein	A0A1B0T6C0	Bacillus_phage	3.8e-71	77.9
AXY08511.1\|3154297_3155173_+	hypothetical protein	Q2I8C8	Bacillus_phage	2.6e-63	45.5
AXY08512.1\|3155188_3155383_+	hypothetical protein	A0A1B1P7U7	Bacillus_phage	1.8e-20	78.1
AXY08513.1\|3155408_3155582_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	2.6e-23	91.2
AXY08514.1\|3155596_3155851_+	hypothetical protein	A0A1B0T6B9	Bacillus_phage	1.1e-35	85.7
AXY08515.1\|3156341_3156542_+	glyoxalase	A0A1B0T6B5	Bacillus_phage	6.5e-26	92.1
AXY08516.1\|3156600_3156819_+	hypothetical protein	NA	NA	NA	NA
AXY08517.1\|3156995_3158225_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.0e-84	48.8
AXY08518.1\|3158595_3159171_+	hypothetical protein	A0A219UQR9	Bacillus_phage	3.7e-13	34.7
AXY08519.1\|3159215_3159461_+	hypothetical protein	A0A0S2MVC7	Bacillus_phage	1.6e-18	58.0
AXY08520.1\|3159511_3159703_+	hypothetical protein	NA	NA	NA	NA
AXY08521.1\|3159744_3160047_+	hypothetical protein	Q3HKX6	Bacillus_phage	2.2e-33	73.0
AXY11058.1\|3160110_3160209_+	DUF3983 domain-containing protein	NA	NA	NA	NA
AXY08522.1\|3160229_3160412_+	hypothetical protein	NA	NA	NA	NA
AXY08523.1\|3160597_3161791_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
AXY08524.1\|3162086_3162257_+	hypothetical protein	NA	NA	NA	NA
AXY08525.1\|3162280_3162751_+	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	4.6e-54	67.7
3162561:3162578	attL	NA	NA	NA	NA
AXY08526.1\|3162747_3163290_+\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	4.2e-96	99.4
AXY08527.1\|3163893_3164106_+	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	2.2e-08	39.1
AXY11059.1\|3164307_3164541_+	hypothetical protein	NA	NA	NA	NA
AXY08528.1\|3164554_3164872_+	hypothetical protein	Q2I8B8	Bacillus_phage	2.3e-09	55.1
AXY08529.1\|3164873_3165215_+	hypothetical protein	A0A1B1P7D2	Bacillus_phage	9.7e-06	35.2
AXY08530.1\|3165225_3165537_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-33	68.0
AXY08531.1\|3165540_3165840_+	hypothetical protein	NA	NA	NA	NA
AXY08532.1\|3165946_3166267_+	hypothetical protein	A0A1B1P762	Bacillus_phage	4.2e-43	85.8
AXY08533.1\|3166250_3167933_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	9.3e-312	94.3
AXY08534.1\|3167947_3169105_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	3.3e-207	93.4
AXY08535.1\|3169201_3170320_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AXY08536.1\|3170670_3171390_+\|protease	Clp protease ClpP	A0A2H4JC91	uncultured_Caudovirales_phage	7.7e-53	49.4
AXY08537.1\|3171431_3172595_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.3e-86	44.1
AXY08538.1\|3172609_3172834_+	hypothetical protein	NA	NA	NA	NA
AXY08539.1\|3172843_3173143_+	hypothetical protein	A0A1B1P751	Bacillus_phage	2.1e-41	87.6
AXY08540.1\|3173123_3173522_+\|head,tail	phage head-tail adapter protein	A0A1B1P760	Bacillus_phage	3.9e-46	77.1
AXY08541.1\|3173496_3173874_+	hypothetical protein	A0A1B1P759	Bacillus_phage	2.8e-46	72.8
AXY08542.1\|3173860_3174289_+	hypothetical protein	A0A1B1P769	Bacillus_phage	2.3e-73	97.9
AXY08543.1\|3174289_3174877_+\|tail	phage tail protein	A0A1B1P778	Bacillus_phage	1.3e-95	86.6
AXY08544.1\|3174950_3175412_+	hypothetical protein	A0A1B1P772	Bacillus_phage	2.1e-75	94.1
AXY08545.1\|3175590_3177423_+	hypothetical protein	A0A1B1P775	Bacillus_phage	6.0e-134	98.9
AXY08546.1\|3178997_3180401_-\|transposase	transposase	NA	NA	NA	NA
AXY08547.1\|3181903_3183781_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.2e-20	24.2
AXY08548.1\|3183912_3185547_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	3.8e-63	33.6
AXY11060.1\|3186134_3186857_+	hypothetical protein	NA	NA	NA	NA
AXY08549.1\|3187162_3187348_-	Spo0E family sporulation regulatory protein-aspartic acid phosphatase	NA	NA	NA	NA
AXY08550.1\|3187469_3187751_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	4.0e-13	67.2
AXY08551.1\|3187772_3188006_+	RNA chaperone Hfq	NA	NA	NA	NA
AXY08552.1\|3188058_3188337_-	HU family DNA-binding protein	A3E2K9	Sodalis_phage	1.9e-20	57.3
AXY08553.1\|3188696_3190112_-\|transposase	transposase	NA	NA	NA	NA
AXY08554.1\|3190630_3208750_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	4.8e-159	26.8
3190206:3190223	attR	NA	NA	NA	NA
AXY08555.1\|3209011_3209821_+	hypothetical protein	NA	NA	NA	NA
AXY08556.1\|3209981_3211109_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
AXY08557.1\|3212051_3212783_+	phosphopantetheine-protein transferase	NA	NA	NA	NA
AXY08558.1\|3212993_3213278_-	hypothetical protein	A0A1V0SCG6	Indivirus	8.9e-05	34.6
AXY11061.1\|3213634_3214375_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	2.5e-38	41.2
AXY11062.1\|3214467_3215661_-\|transposase	transposase	NA	NA	NA	NA
AXY11063.1\|3216068_3217262_-\|transposase	transposase	NA	NA	NA	NA
AXY08559.1\|3219272_3219959_+\|tail	phage tail protein	A0A2H4J851	uncultured_Caudovirales_phage	2.0e-82	62.3
AXY08560.1\|3219955_3222571_+	hypothetical protein	A0A2H4JFY7	uncultured_Caudovirales_phage	5.3e-277	52.2
AXY08561.1\|3222560_3224285_+	DUF2479 domain-containing protein	A0A2H4J855	uncultured_Caudovirales_phage	2.0e-38	54.0
AXY08562.1\|3224430_3224661_+\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	5.3e-32	93.4

DBSCAN-SWA_8

3662951 : 3697158

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY08988.1\|3662951_3663740_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY08989.1\|3664201_3664399_-	hypothetical protein	NA	NA	NA	NA
AXY08990.1\|3665353_3665677_-	transcriptional regulator	NA	NA	NA	NA
AXY08991.1\|3665796_3666333_+	flavodoxin family protein	NA	NA	NA	NA
AXY11082.1\|3666476_3667970_+	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	5.2e-35	25.0
AXY08992.1\|3668135_3668681_+	N-acetyltransferase	G9BWD5	Planktothrix_phage	2.1e-10	31.8
AXY08993.1\|3668826_3669390_+	N-acetyltransferase	NA	NA	NA	NA
AXY08994.1\|3669386_3670091_+	short-chain dehydrogenase	NA	NA	NA	NA
AXY08995.1\|3670084_3670864_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXY08996.1\|3670875_3671775_+	isomerase	NA	NA	NA	NA
AXY08997.1\|3671807_3672017_-	hypothetical protein	NA	NA	NA	NA
AXY11083.1\|3672192_3672996_+	aminoglycoside phosphotransferase family protein	NA	NA	NA	NA
AXY08998.1\|3673059_3673617_+	hypothetical protein	NA	NA	NA	NA
AXY08999.1\|3673642_3674470_+	hypothetical protein	NA	NA	NA	NA
AXY09000.1\|3674486_3675053_+	esterase	A0A0N9RRL9	Staphylococcus_phage	3.6e-05	27.0
AXY09001.1\|3675097_3675514_-	SRPBCC family protein	NA	NA	NA	NA
AXY09002.1\|3675594_3676605_-	aldo/keto reductase	NA	NA	NA	NA
AXY09003.1\|3677007_3677352_+	HxlR family transcriptional regulator	NA	NA	NA	NA
AXY09004.1\|3677544_3677871_+	transcriptional regulator	NA	NA	NA	NA
AXY09005.1\|3678180_3679371_+	class I SAM-dependent methyltransferase	A0A2K9L0U7	Tupanvirus	5.9e-50	40.2
AXY09006.1\|3679587_3680649_+	oxidoreductase	NA	NA	NA	NA
AXY09007.1\|3680681_3681419_+	GntR family transcriptional regulator	NA	NA	NA	NA
AXY09008.1\|3681485_3681827_-	transcriptional regulator	NA	NA	NA	NA
AXY09009.1\|3681839_3682019_+	hypothetical protein	NA	NA	NA	NA
AXY09010.1\|3682409_3682805_+	transcriptional regulator Spx	NA	NA	NA	NA
AXY09011.1\|3682852_3682987_+	hypothetical protein	NA	NA	NA	NA
AXY09012.1\|3683096_3683231_+	hypothetical protein	NA	NA	NA	NA
AXY09013.1\|3683394_3683808_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
AXY09014.1\|3683935_3684271_+	IDEAL domain-containing protein	NA	NA	NA	NA
AXY09015.1\|3684540_3685330_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY09016.1\|3685405_3686599_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8
AXY09017.1\|3686894_3687596_+	hypothetical protein	NA	NA	NA	NA
AXY09018.1\|3687700_3688489_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY09019.1\|3688752_3688965_+	hypothetical protein	NA	NA	NA	NA
AXY11084.1\|3689458_3690775_-	hypothetical protein	NA	NA	NA	NA
AXY09020.1\|3691053_3692142_-	glycosyl transferase	S5WBE2	Pseudomonas_phage	4.6e-09	22.2
AXY11085.1\|3692344_3693637_-	hypothetical protein	NA	NA	NA	NA
AXY09021.1\|3693838_3694111_+	hypothetical protein	NA	NA	NA	NA
AXY09022.1\|3694276_3695395_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AXY09023.1\|3695745_3697158_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_9

4254000 : 4261504

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY09555.1\|4254000_4254807_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	4.7e-107	68.5
AXY09556.1\|4254871_4255084_-	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	9.6e-12	52.9
AXY09557.1\|4255086_4256472_-	S-layer protein	Q0H255	Geobacillus_phage	2.7e-78	59.5
AXY09558.1\|4256918_4257323_+	N-acetyltransferase	NA	NA	NA	NA
AXY09559.1\|4257338_4257692_+	cytoplasmic protein	NA	NA	NA	NA
AXY09560.1\|4257713_4258421_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.1e-16	27.0
AXY09561.1\|4258486_4258873_+	DUF2809 domain-containing protein	NA	NA	NA	NA
AXY09562.1\|4258894_4259398_+	topology modulation protein	A0A097BYE2	Leuconostoc_phage	3.6e-41	45.5
AXY09563.1\|4259544_4260225_+	cytoplasmic protein	A0A075BUR2	Microcystis_phage	7.8e-31	38.7
AXY09564.1\|4260310_4261504_+	glycosyl transferase family 1	B0LUM8	Spodoptera_litura_multicapsid_nucleopolyhedrovirus	9.9e-13	27.2

DBSCAN-SWA_10

4642973 : 4667465

Bacillus_phage(88.24%)

tail,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY09912.1\|4642973_4644167_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
AXY09913.1\|4644463_4645246_+	arginase	NA	NA	NA	NA
AXY09914.1\|4645920_4647393_-	recombinase family protein	Q2XVV3	Bacillus_phage	5.7e-143	54.4
AXY09915.1\|4647727_4647955_-	hypothetical protein	NA	NA	NA	NA
AXY09916.1\|4648006_4648240_-	hypothetical protein	NA	NA	NA	NA
AXY09917.1\|4648236_4648860_-	hypothetical protein	H0USY2	Bacillus_phage	1.4e-95	79.6
AXY09918.1\|4648801_4649992_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	9.8e-146	64.9
AXY09919.1\|4650107_4650290_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.5e-21	88.3
AXY09920.1\|4650286_4650589_-	hypothetical protein	A0A288WG38	Bacillus_phage	3.4e-26	54.1
AXY09921.1\|4650588_4650855_-	hypothetical protein	NA	NA	NA	NA
AXY09922.1\|4651040_4651241_+	XRE family transcriptional regulator	Q2I8E4	Bacillus_phage	2.4e-12	53.0
AXY09923.1\|4651996_4652347_-	hypothetical protein	NA	NA	NA	NA
AXY09924.1\|4652526_4652766_+	XRE family transcriptional regulator	A0A288WFZ7	Bacillus_phage	2.0e-21	67.1
AXY09925.1\|4652842_4653175_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	7.0e-17	43.5
AXY09926.1\|4653196_4653478_+	hypothetical protein	NA	NA	NA	NA
AXY09927.1\|4653544_4654300_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	8.5e-103	75.3
AXY09928.1\|4654316_4654547_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	2.2e-25	75.0
AXY09929.1\|4654561_4654846_-	hypothetical protein	NA	NA	NA	NA
AXY09930.1\|4655046_4655604_-	hypothetical protein	D2XPZ8	Bacillus_virus	8.3e-71	70.1
AXY09931.1\|4655618_4657028_-	hypothetical protein	A0A1B1P836	Bacillus_phage	8.9e-45	34.7
AXY09932.1\|4656985_4657775_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY09933.1\|4657813_4658047_-	hypothetical protein	NA	NA	NA	NA
AXY09934.1\|4658069_4658327_-	hypothetical protein	A0A1B1P7E8	Bacillus_phage	1.2e-32	76.5
AXY09935.1\|4658353_4660732_-	hypothetical protein	A0A1B1P7E6	Bacillus_phage	1.9e-180	35.1
AXY09936.1\|4660728_4662240_-\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	1.1e-160	58.0
AXY11123.1\|4662252_4665900_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	3.7e-42	41.3
AXY09937.1\|4666185_4666479_-	hypothetical protein	NA	NA	NA	NA
AXY09938.1\|4666529_4666907_-	hypothetical protein	NA	NA	NA	NA
AXY09939.1\|4666967_4667465_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA

DBSCAN-SWA_11

4671269 : 4686258

Bacillus_phage(41.67%)

portal,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY09946.1\|4671269_4672043_-	scaffolding protein	Q4ZC70	Staphylococcus_virus	7.3e-09	40.9
AXY09947.1\|4672110_4673628_-\|portal	phage portal protein	A0A142F1L7	Bacillus_phage	4.0e-67	30.0
AXY09948.1\|4673644_4675360_-	hypothetical protein	A0A142F1L6	Bacillus_phage	1.3e-154	53.9
AXY09949.1\|4675376_4675844_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.7e-32	51.1
AXY09950.1\|4675999_4676563_-	recombinase family protein	A0A0A8WIK3	Clostridium_phage	1.3e-34	46.0
AXY09951.1\|4676962_4677352_-	hypothetical protein	NA	NA	NA	NA
AXY09952.1\|4677610_4677937_-	hypothetical protein	NA	NA	NA	NA
AXY09953.1\|4678084_4678264_-	hypothetical protein	A0A1B1P7M4	Bacillus_phage	3.3e-13	64.0
AXY09954.1\|4678260_4678788_-	hypothetical protein	NA	NA	NA	NA
AXY09955.1\|4678765_4679224_-	hypothetical protein	NA	NA	NA	NA
AXY11125.1\|4679226_4679394_-	hypothetical protein	NA	NA	NA	NA
AXY09956.1\|4679420_4679618_-	hypothetical protein	A0A1L2JY50	Aeribacillus_phage	8.6e-07	49.1
AXY09957.1\|4679622_4679901_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	5.1e-13	59.0
AXY09958.1\|4679925_4680120_-	hypothetical protein	NA	NA	NA	NA
AXY09959.1\|4680238_4680385_-	hypothetical protein	NA	NA	NA	NA
AXY09960.1\|4680387_4681365_-	hypothetical protein	NA	NA	NA	NA
AXY09961.1\|4681381_4681699_-	transglycosylase	NA	NA	NA	NA
AXY09962.1\|4681714_4682362_-	hypothetical protein	NA	NA	NA	NA
AXY09963.1\|4682358_4682769_-	hypothetical protein	S5MUC4	Brevibacillus_phage	1.3e-12	59.3
AXY09964.1\|4682811_4684353_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	4.3e-117	38.4
AXY09965.1\|4684383_4684581_-	hypothetical protein	A0A1B1P7W9	Bacillus_phage	1.9e-22	76.9
AXY09966.1\|4685064_4686258_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8

DBSCAN-SWA_12

5131179 : 5140498

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY10393.1\|5131179_5132052_-	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.1e-66	45.1
AXY10394.1\|5132185_5132857_-	O-methyltransferase	W8CYT3	Bacillus_phage	3.7e-65	92.7
AXY10395.1\|5133004_5133733_-	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	6.0e-61	100.0
AXY10396.1\|5133913_5134507_+	DUF3139 domain-containing protein	NA	NA	NA	NA
AXY11150.1\|5134530_5135586_-	sensor histidine kinase	W8CYF6	Bacillus_phage	9.3e-172	90.3
AXY10397.1\|5135600_5136365_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.1e-121	94.0
AXY10398.1\|5136366_5138127_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-270	96.9
AXY10399.1\|5138367_5139132_+	alpha/beta hydrolase	NA	NA	NA	NA
AXY10400.1\|5139229_5140498_-	peptidoglycan endopeptidase	A0A1V0DZX6	Clostridioides_phage	7.6e-11	32.0

DBSCAN-SWA_13

5285621 : 5396224

113

Bacillus_phage(80.0%)

tail,integrase,protease,portal,capsid,holin,head,transposase,terminase

attL 5325324:5325383|attR 5396216:5397065

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY10533.1\|5285621_5286411_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY10534.1\|5287050_5287962_-	hypothetical protein	NA	NA	NA	NA
AXY10535.1\|5288247_5288667_+	hypothetical protein	NA	NA	NA	NA
AXY10536.1\|5288783_5289875_+	hypothetical protein	NA	NA	NA	NA
AXY11160.1\|5290188_5290500_-	hypothetical protein	NA	NA	NA	NA
AXY10537.1\|5290714_5290924_+	hypothetical protein	NA	NA	NA	NA
AXY10538.1\|5291131_5291977_-	exonuclease	G3MBN3	Bacillus_virus	3.7e-14	28.0
AXY10539.1\|5292167_5292368_-	cold-shock protein	Q9AZD3	Lactococcus_phage	5.0e-18	64.6
AXY10540.1\|5292584_5293484_-	hypothetical protein	NA	NA	NA	NA
AXY10541.1\|5293500_5293944_-	flavodoxin	A7KUZ7	Bacillus_phage	1.1e-09	32.3
AXY10542.1\|5294083_5294704_-	transcriptional regulator	NA	NA	NA	NA
AXY10543.1\|5294790_5295186_-	NUDIX domain-containing protein	NA	NA	NA	NA
AXY10544.1\|5295182_5295524_-	ASCH domain-containing protein	NA	NA	NA	NA
AXY10545.1\|5295634_5296192_+	antibiotic acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	2.2e-39	51.4
AXY10546.1\|5296238_5303711_-	hypothetical protein	NA	NA	NA	NA
AXY10547.1\|5303827_5304577_+	short-chain dehydrogenase	NA	NA	NA	NA
AXY10548.1\|5304612_5305446_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AXY10549.1\|5305512_5307021_-	argininosuccinate lyase	NA	NA	NA	NA
AXY10550.1\|5307122_5308232_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
AXY10551.1\|5308349_5309282_-	nucleoside hydrolase	NA	NA	NA	NA
AXY10552.1\|5309399_5310839_-	sodium/panthothenate symporter	NA	NA	NA	NA
AXY10553.1\|5310842_5311121_-	DUF997 domain-containing protein	NA	NA	NA	NA
AXY10554.1\|5311394_5312879_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AXY10555.1\|5312929_5313670_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	9.8e-19	28.2
AXY10556.1\|5314174_5316028_-	squalene--hopene cyclase	NA	NA	NA	NA
AXY10557.1\|5316127_5316553_-	divergent PAP2 family protein	NA	NA	NA	NA
AXY10558.1\|5316632_5317574_-	EamA family transporter RarD	NA	NA	NA	NA
AXY10559.1\|5317666_5317915_-	DUF1294 domain-containing protein	NA	NA	NA	NA
AXY10560.1\|5318073_5318472_-	hypothetical protein	NA	NA	NA	NA
AXY10561.1\|5318514_5318739_-	group-specific protein	NA	NA	NA	NA
AXY10562.1\|5318752_5319802_-	MRP family ATP-binding protein	NA	NA	NA	NA
AXY10563.1\|5320020_5320257_-	molybdopterin converting factor subunit 1	NA	NA	NA	NA
AXY10564.1\|5320261_5320726_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AXY10565.1\|5320706_5322014_-	molybdopterin molybdenumtransferase	NA	NA	NA	NA
AXY10566.1\|5322032_5323049_-	thiamine biosynthesis protein MoeB	NA	NA	NA	NA
AXY10567.1\|5323073_5323853_-	formate/nitrite transporter	NA	NA	NA	NA
AXY10568.1\|5323839_5323947_-	hypothetical protein	NA	NA	NA	NA
AXY10569.1\|5324053_5325070_-	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
5325324:5325383	attL	NA	NA	NA	NA
AXY10570.1\|5325374_5326163_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY10571.1\|5326731_5327076_-	DUF2294 domain-containing protein	NA	NA	NA	NA
AXY10572.1\|5327191_5327674_-	DUF1641 domain-containing protein	NA	NA	NA	NA
AXY10573.1\|5330309_5331134_+	cytosolic protein	A0A2H4J969	uncultured_Caudovirales_phage	3.2e-111	75.0
AXY10574.1\|5331143_5331764_-	hypothetical protein	H0USY2	Bacillus_phage	8.0e-99	84.0
AXY10575.1\|5331705_5332887_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.4e-189	82.7
AXY10576.1\|5333002_5333185_-	hypothetical protein	Q2I8E2	Bacillus_phage	1.0e-22	90.0
AXY10577.1\|5333181_5333499_-	hypothetical protein	H0USY0	Bacillus_phage	3.5e-50	95.2
AXY10578.1\|5333702_5333906_+	XRE family transcriptional regulator	Q2I8E4	Bacillus_phage	2.4e-12	51.5
AXY10579.1\|5333910_5334489_+	hypothetical protein	A0A288WFT6	Bacillus_phage	1.0e-79	72.6
AXY10580.1\|5334555_5335308_-	N-acetylmuramoyl-L-alanine amidase	S5M842	Bacillus_phage	5.2e-100	74.0
AXY10581.1\|5335324_5335555_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	5.3e-32	92.1
AXY10582.1\|5335597_5335837_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
AXY10583.1\|5335852_5336821_-\|integrase	integrase	D2XR30	Bacillus_phage	2.6e-176	94.7
AXY10584.1\|5336969_5338694_-	DUF2479 domain-containing protein	A0A2H4J855	uncultured_Caudovirales_phage	2.0e-38	54.0
AXY10585.1\|5338683_5341299_-	hypothetical protein	A0A2H4JFY7	uncultured_Caudovirales_phage	5.3e-277	52.2
AXY10586.1\|5341295_5341982_-\|tail	phage tail protein	A0A2H4J851	uncultured_Caudovirales_phage	2.0e-82	62.3
AXY11161.1\|5341974_5344824_-	hypothetical protein	A0A1B1P764	Bacillus_phage	1.8e-209	85.1
AXY10587.1\|5345047_5346880_-	hypothetical protein	A0A1B1P775	Bacillus_phage	6.0e-134	98.9
AXY10588.1\|5347058_5347520_-	hypothetical protein	A0A1B1P772	Bacillus_phage	2.1e-75	94.1
AXY10589.1\|5347593_5348181_-\|tail	phage tail protein	A0A1B1P778	Bacillus_phage	1.3e-95	86.6
AXY10590.1\|5348181_5348610_-	hypothetical protein	A0A1B1P769	Bacillus_phage	2.3e-73	97.9
AXY10591.1\|5348596_5348974_-	hypothetical protein	A0A1B1P759	Bacillus_phage	2.8e-46	72.8
AXY10592.1\|5348948_5349347_-\|head,tail	phage head-tail adapter protein	A0A1B1P760	Bacillus_phage	3.9e-46	77.1
AXY10593.1\|5349327_5349627_-	hypothetical protein	A0A1B1P751	Bacillus_phage	2.1e-41	87.6
AXY10594.1\|5349636_5349861_-	hypothetical protein	NA	NA	NA	NA
AXY10595.1\|5349875_5351039_-\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	2.3e-86	44.1
AXY10596.1\|5351080_5351800_-\|protease	Clp protease ClpP	A0A2H4JC91	uncultured_Caudovirales_phage	1.0e-52	49.4
AXY10597.1\|5351786_5352953_-\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.6e-210	93.8
AXY10598.1\|5352967_5354650_-\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	9.3e-312	94.3
AXY10599.1\|5354633_5354954_-	hypothetical protein	A0A1B1P762	Bacillus_phage	4.2e-43	85.8
AXY10600.1\|5355060_5355360_-	hypothetical protein	NA	NA	NA	NA
AXY10601.1\|5355363_5355675_-	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-33	68.0
AXY10602.1\|5355685_5356027_-	hypothetical protein	A0A1B1P7D2	Bacillus_phage	9.7e-06	35.2
AXY10603.1\|5356028_5356346_-	hypothetical protein	Q2I8B8	Bacillus_phage	2.3e-09	55.1
AXY11162.1\|5356359_5356593_-	hypothetical protein	NA	NA	NA	NA
AXY10604.1\|5356794_5357007_-	cell division protein FtsK	A0A1B1P7C1	Bacillus_phage	2.2e-08	39.1
AXY10605.1\|5357611_5358154_-\|integrase	site-specific integrase	A0A1B1P746	Bacillus_phage	2.3e-89	91.1
AXY10606.1\|5358150_5358621_-	ArpU family transcriptional regulator	A0A1B1P744	Bacillus_phage	7.5e-49	63.2
AXY10607.1\|5358641_5358812_-	hypothetical protein	NA	NA	NA	NA
AXY10608.1\|5359107_5360301_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-24	25.1
AXY10609.1\|5360486_5360669_-	hypothetical protein	NA	NA	NA	NA
AXY10610.1\|5360688_5360811_-	DUF3983 domain-containing protein	NA	NA	NA	NA
AXY10611.1\|5360860_5361286_-	hypothetical protein	NA	NA	NA	NA
AXY11163.1\|5361321_5361630_-	hypothetical protein	NA	NA	NA	NA
AXY10612.1\|5362408_5362573_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	2.9e-24	98.1
AXY10613.1\|5362623_5362890_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	4.1e-36	85.2
AXY10614.1\|5362886_5363189_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	2.0e-18	51.6
AXY10615.1\|5363192_5363999_-	hypothetical protein	D2XQ17	Bacillus_virus	1.8e-122	81.6
AXY10616.1\|5365116_5365764_-	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	2.6e-100	84.7
AXY10617.1\|5366019_5366352_-	hypothetical protein	W8CYU1	Bacillus_phage	1.5e-43	88.9
AXY10618.1\|5366514_5367309_-	phage regulatory protein	A0A0S2GLP8	Bacillus_phage	4.9e-133	93.6
AXY10619.1\|5367521_5367710_-	XRE family transcriptional regulator	W8CYN7	Bacillus_phage	6.7e-25	93.5
AXY10620.1\|5367777_5367984_-	XRE family transcriptional regulator	NA	NA	NA	NA
AXY10621.1\|5368153_5368498_+	XRE family transcriptional regulator	H0UST7	Bacillus_phage	6.1e-16	41.5
AXY10622.1\|5368898_5370119_-	hypothetical protein	A0A0U3TNF6	Bacillus_phage	2.2e-108	49.5
AXY10623.1\|5370859_5371951_+\|integrase	site-specific integrase	A0A0S2GLI2	Bacillus_phage	1.8e-162	79.3
AXY10624.1\|5371924_5372650_-	formate dehydrogenase	NA	NA	NA	NA
AXY10625.1\|5373064_5374603_+	spore germination protein	NA	NA	NA	NA
AXY10626.1\|5374599_5375697_+	spore gernimation protein	NA	NA	NA	NA
AXY10627.1\|5375697_5376834_+	Ger(x)C family spore germination protein	NA	NA	NA	NA
AXY10628.1\|5376912_5377047_-	phosphonate ABC transporter permease	NA	NA	NA	NA
AXY10629.1\|5377104_5380467_-	phosphonate ABC transporter permease	NA	NA	NA	NA
AXY10630.1\|5380545_5382645_-	VWA domain-containing protein	NA	NA	NA	NA
AXY10631.1\|5382902_5383241_-	VOC family protein	NA	NA	NA	NA
AXY10632.1\|5383311_5383647_-	hypothetical protein	NA	NA	NA	NA
AXY10633.1\|5383781_5384177_+	hypothetical protein	NA	NA	NA	NA
AXY10634.1\|5384218_5384938_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AXY10635.1\|5385051_5386758_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AXY10636.1\|5387038_5388745_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AXY11164.1\|5389121_5390819_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AXY10637.1\|5392649_5393687_-	LytR family transcriptional regulator	NA	NA	NA	NA
AXY10638.1\|5393704_5394733_-	anti-sigma factor	NA	NA	NA	NA
AXY10639.1\|5394745_5395279_-	RNA polymerase subunit sigma-24	NA	NA	NA	NA
AXY10640.1\|5395434_5396224_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
5396216:5397065	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP024774

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4435 : 52639

Streptococcus_phage(57.14%)

transposase,integrase

attL 3718:3731|attR 55332:55345

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3718:3731	attL	NA	NA	NA	NA
AXY11480.1\|4435_5077_-\|integrase	integrase	A0A1B0VBM1	Salmonella_phage	2.2e-14	33.2
AXY11481.1\|5311_5521_+	hypothetical protein	NA	NA	NA	NA
AXY11482.1\|5607_5943_+	hypothetical protein	NA	NA	NA	NA
AXY11483.1\|6022_6904_-	ATPase	NA	NA	NA	NA
AXY11484.1\|9922_13702_-	hypothetical protein	NA	NA	NA	NA
AXY11485.1\|15111_16602_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AXY11486.1\|16823_17030_+	transcriptional regulator	NA	NA	NA	NA
AXY11487.1\|17043_17430_+	hypothetical protein	NA	NA	NA	NA
AXY11488.1\|20028_20262_+	hypothetical protein	NA	NA	NA	NA
AXY11489.1\|20396_22094_-	hypothetical protein	NA	NA	NA	NA
AXY11490.1\|22465_23878_+\|transposase	transposase	NA	NA	NA	NA
AXY11491.1\|23992_25264_-	hypothetical protein	NA	NA	NA	NA
AXY11492.1\|25675_25834_+	hypothetical protein	NA	NA	NA	NA
AXY11493.1\|26339_26696_+	hypothetical protein	NA	NA	NA	NA
AXY11494.1\|26829_28059_-\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	5.0e-84	48.8
AXY11495.1\|31034_31742_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.1e-38	43.4
AXY11496.1\|31871_32312_-	hypothetical protein	NA	NA	NA	NA
AXY11497.1\|32372_34580_-	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-69	36.8
AXY11498.1\|34628_35117_-	hypothetical protein	NA	NA	NA	NA
AXY11499.1\|35135_35669_-	hypothetical protein	NA	NA	NA	NA
AXY11500.1\|35806_35980_+	ribbon-helix-helix domain-containing protein	B5LPT4	Bacillus_virus	8.4e-06	50.9
AXY11565.1\|36337_36757_-	hypothetical protein	NA	NA	NA	NA
AXY11501.1\|37442_38231_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AXY11502.1\|40248_41559_-	hypothetical protein	NA	NA	NA	NA
AXY11503.1\|41560_42565_-	hypothetical protein	NA	NA	NA	NA
AXY11504.1\|42579_43254_-	hypothetical protein	NA	NA	NA	NA
AXY11505.1\|43257_43824_-	hypothetical protein	NA	NA	NA	NA
AXY11506.1\|43889_44078_-	hypothetical protein	NA	NA	NA	NA
AXY11507.1\|44108_45188_-	hypothetical protein	A0A1S5SEZ8	Streptococcus_phage	1.6e-41	34.4
AXY11508.1\|45187_47125_-	hypothetical protein	NA	NA	NA	NA
AXY11509.1\|47099_47813_-	hypothetical protein	NA	NA	NA	NA
AXY11510.1\|47814_48183_-	hypothetical protein	NA	NA	NA	NA
AXY11511.1\|48197_48539_-	hypothetical protein	NA	NA	NA	NA
AXY11512.1\|48639_51150_-	cell wall anchor	NA	NA	NA	NA
AXY11513.1\|51445_52639_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	9.6e-24	24.8
55332:55345	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP024775

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28639 : 34618

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AXY11587.1\|28639_29329_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.7e-70	60.4
AXY11588.1\|29400_29835_-	hypothetical protein	NA	NA	NA	NA
AXY11589.1\|30408_30648_-	hypothetical protein	NA	NA	NA	NA
AXY11590.1\|30713_31403_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	6.0e-71	60.4
AXY11591.1\|31526_32021_-	hypothetical protein	NA	NA	NA	NA
AXY11592.1\|32418_32706_+	hypothetical protein	A0A1P8CWP5	Bacillus_phage	9.0e-05	37.5
AXY11593.1\|32753_33572_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-59	45.2
AXY11594.1\|34128_34386_+	hypothetical protein	A0A125RQ77	Bacillus_phage	1.0e-36	89.4
AXY11595.1\|34354_34618_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A125RQ76	Bacillus_phage	4.5e-43	98.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage