CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032450	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence	1 crisprs	DEDDh,cas14j	0	1	0	0
CP032449	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 chromosome, complete genome	2 crisprs	PD-DExK,WYL,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2,csa3,cas3,DEDDh,DinG	0	0	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032450_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032450_1

29067-29186

Orphan

Consensus_repeat	Method
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032450_1

>merge|CP032450|1|29067-29186|CRISPRCasFinder
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCAGTGCGCAGCCATCCACCTTTCATGAAAATTACAGTGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA

>CP032450|1|1|29067-29186|CRISPRCasFinder
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA	GTGCGCAGCCATCCACCTTTCATGAAAATTACAG
TGCGTACCCATCCACCTTTCAGTGCGTACCCATCCACCTTTCA

Protein	Signature genes	Signature genes Name	Protein_function
CP032450.1\|AYB81355.1\|23135_23471_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81371.1\|32411_32684_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81358.1\|26132_26363_+\|DNA-partition-complex-ParG	unknown	unknown	gnl\|CDD\|117819
CP032450.1\|AYB81369.1\|32000_32180_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81370.1\|32201_32399_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81354.1\|21334_22450_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|224117
CP032450.1\|AYB81365.1\|30717_31041_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81361.1\|27977_28814_-\|RepB-family-plasmid-replication-initiator-protein	unknown	unknown	gnl\|CDD\|376444
CP032450.1\|AYB81357.1\|25460_26081_+\|chromosome-partitioning-protein-ParA	unknown	unknown	gnl\|CDD\|349760
CP032450.1\|AYB81356.1\|23527_24094_+\|DUF2913-family-protein	unknown	unknown	gnl\|CDD\|371392
CP032450.1\|AYB81362.1\|29852_30053_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81363.1\|30049_30301_+\|plasmid-stabilization-protein	unknown	unknown	gnl\|CDD\|179484
CP032450.1\|AYB81364.1\|30290_30572_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
CP032450.1\|AYB81366.1\|31085_31331_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81360.1\|27491_27938_-\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81367.1\|31320_31536_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274805
CP032450.1\|AYB81368.1\|31628_31958_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81468.1\|27001_27355_-\|DNA-distortion-polypeptide-3	unknown	unknown	unknown
CP032450.1\|AYB81359.1\|26597_26777_+\|hypothetical-protein	unknown	unknown	unknown
CP032450.1\|AYB81467.1\|22535_22952_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176648

Protein	Function_ID	Function_description	E-value
CP032450.1\|AYB81364.1\|30290_30572_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	3.35296e-20
CP032450.1\|AYB81354.1\|21334_22450_+\|DNA-binding-protein	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	1.9546e-12
CP032450.1\|AYB81356.1\|23527_24094_+\|DUF2913-family-protein	gnl\|CDD\|371392	pfam11140, DUF2913, Protein of unknown function (DUF2913). This family of proteins with unknown function appear to be restricted to Gammaproteobacteria.	2.58094e-15
CP032450.1\|AYB81363.1\|30049_30301_+\|plasmid-stabilization-protein	gnl\|CDD\|179484	PRK02854, PRK02854, primosomal protein DnaT.	2.40816e-08
CP032450.1\|AYB81357.1\|25460_26081_+\|chromosome-partitioning-protein-ParA	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	2.18908e-34
CP032450.1\|AYB81367.1\|31320_31536_+\|hypothetical-protein	gnl\|CDD\|274805	TIGR03830, transcriptional_regulator_XRE_family, putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.	0.00331471
CP032450.1\|AYB81361.1\|27977_28814_-\|RepB-family-plasmid-replication-initiator-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.37525e-21
CP032450.1\|AYB81358.1\|26132_26363_+\|DNA-partition-complex-ParG	gnl\|CDD\|117819	pfam09274, ParG, ParG. Members of this family of plasmid partition proteins adopt a ribbon-helix-helix fold, with a core of four alpha-helices. They are an essential component of the DNA partition complex of the multidrug resistance plasmid TP228.	4.81797e-42
CP032450.1\|AYB81467.1\|22535_22952_+\|hypothetical-protein	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	6.72396e-09

>CP032450.1|AYB81361.1|27977_28814_-|RepB-family-plasmid-replication-initiator-protein
MNLLSVTKKTKIRHRNEINSTFSSLPLSARRILFMAMAQIDSREELSEGATFRITAREYAFIADIDVTGAYRQLKEGAEELQASVIRIPRNQLLTAQGNQSSGHTKKRGKLPSDAVRLMNLTAFCDYVESEGYIDIAFSHVIEPYITMLKDSYTTQVLISSVRLADQNSNMLYQFIRKQYSSGKKTFFDIEVDVLKDELELFRIDNGEKVYLYQNFKDFNKVFLQKNIEKINQYTEINHLEVRIVERVARRASKLRFSYKIDKESEGLDIRIPYGFRG
>CP032450.1|AYB81360.1|27491_27938_-|hypothetical-protein
MAKIYQFPQGEERAKFRKEIARERKKCFAVKTGCTFVKWLDWGWFYLRLLAASVLHFIFVFVLAILGAFKWAVFWLGGILCVITWYHLNQQLWTPQNLTIPVITATWILGLLAEPLMELLNKTMPWHKLLVPEPADESTENSSEISQQ
>CP032450.1|AYB81468.1|27001_27355_-|DNA-distortion-polypeptide-3
MKYLVKEFINEKYSKAVNILKDNLKEHYHVFYGVRLSEILFPTSEYGTDAFFKEFELINSVILPLVIFDFIDRKPIMVIGFEEVPGIDSLIDSGMEVVLLDGLSDLLLVEKLMPLFD
>CP032450.1|AYB81359.1|26597_26777_+|hypothetical-protein
MNGEQHTDSLLKICETIEKRLKIFCILIASQALMIEGKNHHYLINLTLISLNEETVKIN
>CP032450.1|AYB81358.1|26132_26363_+|DNA-partition-complex-ParG
MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE
>CP032450.1|AYB81357.1|25460_26081_+|chromosome-partitioning-protein-ParA
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRMFE
>CP032450.1|AYB81356.1|23527_24094_+|DUF2913-family-protein
MTLTEKSGHLAWCALVALALARQDGGVLSPAQENLFLTRWLATALKQRRFSRDVTPDIEWLLKQGRQMGVSAKLASKLNYLWRSCTGELSEQNDLFRLTYALETAKDMHWNYRLLSDREWSGRNAVALSAGVNGIYLSRAKLDVGFNDSGRQINSLTARLTGNVAGVMKLFDRCGWQSLMPPCPTSIR
>CP032450.1|AYB81355.1|23135_23471_+|hypothetical-protein
MENMLKTMREHFPVRTVVIEQSLDMFGVKRNEDGTLLFPRHSDKRFPVARIRKRLAAYGWRGERLNKEVARIVAGPDILPERRDYSIIFPYGWEKKQLTREMRRMFLRKTG
>CP032450.1|AYB81467.1|22535_22952_+|hypothetical-protein
MKPAPGAEPVRMYKSPYGGKYGVWRLADCVPMRAKRPQTEKQRLASTRLGLQARMKSERGRFAMLAHTWLALGPVFLDTETTGLDAGAQALEIGLVNARGERIFETRLKPTVGIDPAAAAVQIVTEPYRFPVLSVRLA
>CP032450.1|AYB81354.1|21334_22450_+|DNA-binding-protein
MRPATYEPEQIIEAGLALQAEGRNITGFALRNQVGGGNPTRLRQIWDEYQASQSTVVTEPVAELPVEVAEEVKAVSAALSERITQLATELNDKAVRAAERRVAEVTRAAGEQTAQAERELADAAQTVDDLEEKLDELQDRYDSLTLALESERSLRQQHDVEMAQLKERLAAAEENTRQREERYQEQKTVLQDALNAEQAQHKNTREDLQKRLEQISAEANARTEELKSERDKVNTLLTRLESQENALASERQQHLATRETLQQRLEQAIADTQARAGEIALERDRVSSLTARLESQEKASSEQLVRMGSEIASLTERCTQLENQRDDARLETMGEKETVAALRGEAEALKRQNQSLMAALSGNKQTGGQNA
>CP032450.1|AYB81362.1|29852_30053_+|hypothetical-protein
MSSVKNRETVADYNETGKNAQNVLQSVLRRCRKELYLTCSDVFLNISTFKSAFKDAIMSMRQAEGL
>CP032450.1|AYB81363.1|30049_30301_+|plasmid-stabilization-protein
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNLDDL
>CP032450.1|AYB81364.1|30290_30572_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGRRESSEVYQIADLR
>CP032450.1|AYB81365.1|30717_31041_+|hypothetical-protein
MQNYAKSVATEILRQLGGNRFIVMTGAKSFSYFDENGECGVTFRLPSNFAMKGINLVKIKLDFTDTYQVKFSRVRGAEVKDISRFDNIYCDQLACLFTQETGLHTVL
>CP032450.1|AYB81366.1|31085_31331_+|hypothetical-protein
MDKDKIIKKNRGNYSYVIRTMDEDGDAVFHVLKYVKTIDKTKSRKTVRKLIMDEKLNLASLMLLDNGILCDCLTKGDENAE
>CP032450.1|AYB81367.1|31320_31536_+|hypothetical-protein
MQNKPTPEEVKNARVAAGLTLKEAADIFGYQLNSWQMKESAGKASRSLSVGEYQYLLLLANMHPSYRLVKK
>CP032450.1|AYB81368.1|31628_31958_+|hypothetical-protein
MKVLTFKNDTVSVGDVFVSSWGYEQTNVTFYQVLSVHGKKNVTVREIRANSEYTDSMVGFKTPVLNDFTGECFKRQIKDFGDELAIKIEDFETAYKTLPEEKHRFSSYY
>CP032450.1|AYB81369.1|32000_32180_+|hypothetical-protein
MEREFSAKASLNRNIKFWFKQCGLSKERVIRCIDNWYDFAYPPSEQEKAKKEAIEKLIK
>CP032450.1|AYB81370.1|32201_32399_+|hypothetical-protein
MGQPDTVTPDSIARNKMSERILSAINDVEKGGRPVFPLMPFHVFPEYMALLRKALEKKTQKRTDK
>CP032450.1|AYB81371.1|32411_32684_+|hypothetical-protein
MTKHDFVSFVSGELRQGAVRFSLAFNSKGEIVLHWTNKAGIRVWRILSGNRGKKPSKANLERMSNFRRWLFDARQGMEGYTQQPEQSNLS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_KX518744	Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence	63874-63907	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041286	Escherichia coli strain 54 plasmid p54-tetX, complete sequence	64169-64202	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_KU321583	Escherichia coli strain E80 plasmid pE80, complete sequence	38215-38248	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_KT990220	Escherichia coli strain 42-2 plasmid p42-2, complete sequence	37006-37039	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP010164	Escherichia coli strain H2 plasmid A, complete sequence	20751-20784	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP019647	Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence	239581-239614	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP022964	Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal1, complete sequence	30266-30299	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP024467	Shigella dysenteriae strain BU53M1 plasmid unnamed1, complete sequence	17630-17663	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_LS999563	Escherichia coli isolate EC-TO143 plasmid 4, complete sequence	16611-16644	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_LS999563	Escherichia coli isolate EC-TO143 plasmid 4, complete sequence	53074-53107	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP019284	Escherichia coli strain 13P484A plasmid p13P484A-4, complete sequence	32601-32634	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP047093	Salmonella sp. S13 plasmid pS13-4, complete sequence	1762-1795	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP051432	Escherichia sp. SCLE84 plasmid pSCLE2, complete sequence	23725-23758	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP046002	Escherichia coli strain 1916D6 plasmid p1916D6-2, complete sequence	35337-35370	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP045188	Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence	26770-26803	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	41390-41423	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP031548	Escherichia coli strain cq9 plasmid unnamed2, complete sequence	60962-60995	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032386	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_2, complete sequence	39391-39424	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032389	Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_2, complete sequence	9889-9922	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_LT904873	Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2	5696-5729	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_KT754163	Shigella dysenteriae 1 strain A5468 plasmid pA5468, complete sequence	12265-12298	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP033383	Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-2, complete sequence	7366-7399	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP020836	Escherichia coli strain CFSAN051542 plasmid pCFSAN051542, complete sequence	20407-20440	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP038140	Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence	93494-93527	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP043216	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.2-IncX1, complete sequence	32193-32226	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP042617	Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-2, complete sequence	25537-25570	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP031361	Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p2, complete sequence	27033-27066	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP044153	Shigella flexneri strain AR-0425 plasmid pAR-0425-1, complete sequence	25749-25782	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP040929	Escherichia coli strain YY76-1 plasmid pYY76-1-2, complete sequence	2187-2220	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP033386	Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-2, complete sequence	34721-34754	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041177	Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12367v2 plasmid p12367A, complete sequence	4942-4975	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP034761	Klebsiella pneumoniae strain NB5306 plasmid unnamed2, complete sequence	47580-47613	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050707	Salmonella enterica subsp. enterica serovar Enteritidis strain SE124 plasmid pSE124-1, complete sequence	14631-14664	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP047339	Klebsiella pneumoniae strain 2019036D plasmid p2019036D-35kb, complete sequence	28949-28982	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_010860	Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence	32623-32656	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP022453	Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-3, complete sequence	5893-5926	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP024153	Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence	53536-53569	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP030208	Salmonella enterica strain SA19992307 plasmid pSA19992307.1, complete sequence	39815-39848	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP005994	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 plasmid unnamed, complete sequence	30028-30061	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032450	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence	29110-29143	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP010155	Escherichia coli strain D9 plasmid C, complete genome	14497-14530	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050174	Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence	58667-58700	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP029061	Escherichia coli strain FORC_081 plasmid pFORC_081_4, complete sequence	10786-10819	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP042589	Escherichia coli strain PK6 plasmid pRHEcCUB-1, complete sequence	29459-29492	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP025677	Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence	79278-79311	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041453	Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence	54169-54202	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MN816373	Escherichia coli strain A127 plasmid pA127-X1, complete sequence	29459-29492	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP052879	Escherichia coli strain C21 plasmid pC21-2, complete sequence	61147-61180	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP033379	Escherichia coli strain L73 plasmid pL73-2, complete sequence	99797-99830	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP033632	Escherichia coli isolate ECCNB12-2 plasmid pTB-nb1, complete sequence	88012-88045	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050724	Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence	41949-41982	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP047573	Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence	53619-53652	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_019106	Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_77, complete sequence	32551-32584	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP010127	Escherichia coli strain C8 plasmid B, complete genome	33248-33281	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP027138	Escherichia coli strain AR_0369 plasmid unnamed2	85971-86004	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP022072	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed2, complete sequence	18650-18683	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	20398-20431	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP043935	Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence	147056-147089	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP045998	Escherichia coli strain 1916D18 plasmid p1916D18-1, complete sequence	35339-35372	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032394	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_2, complete sequence	32800-32833	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_019256	Shigella sp. LN126 plasmid pLN126_33, complete sequence	2112-2145	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MH884649	Salmonella sp. strain Sa21 plasmid pSa21-IncX1-28K, complete sequence	16816-16849	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MH884651	Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence	68260-68293	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MH229869	Escherichia coli plasmid pKANJ7, complete sequence	90-123	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050713	Salmonella enterica subsp. enterica serovar Enteritidis strain SE104 plasmid pSE104-1, complete sequence	33434-33467	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041439	Escherichia coli strain YPE12 plasmid pYPE12-106k, complete sequence	96892-96925	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041443	Escherichia coli strain YPE12 plasmid pYPE12-101k-tetX4, complete sequence	63333-63366	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MK461931	Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence	238663-238696	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MK656937	Escherichia coli strain T3 plasmid pT3, complete sequence	37880-37913	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MK731977	Escherichia coli strain ENV103 plasmid pSGMCR103, complete sequence	22155-22188	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MK673546	Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence	28203-28236	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032447	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU1-USMARC-69840, complete sequence	18380-18413	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	118004-118037	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MH179305	Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence	151970-152003	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MH287085	Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence	243053-243086	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MH287084	Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence	241163-241196	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP025558	Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532 plasmid p2PIR00532, complete sequence	11939-11972	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219825	Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence	90443-90476	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219826	Escherichia coli strain RW8-1 plasmid pRW8-1_122k_tetX, complete sequence	43726-43759	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG904998	Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence	48918-48951	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG197491	Escherichia coli strain FKU92 plasmid pHNFKU92, complete sequence	33352-33385	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG197498	Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence	58347-58380	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG197503	Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence	61256-61289	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG197495	Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence	61256-61289	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MF589339	Escherichia coli strain 2271 plasmid pCTXM-2271, complete sequence	27964-27997	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG197502	Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence	61256-61289	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219818	Escherichia coli strain RF148-1 plasmid pRF148-1_119k_tetX, complete sequence	43736-43769	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219820	Escherichia coli strain RF108-2 plasmid pRF108-2_97k_tetX, complete sequence	80789-80822	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219822	Escherichia coli strain RF14-1 plasmid pRF14-1_50k_tetX, complete sequence	38970-39003	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219823	Escherichia coli strain RF10-1 plasmid pRF10-1_119k_tetX, complete sequence	73817-73850	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_023323	Escherichia coli ACN001 plasmid pACN001-A, complete sequence	18865-18898	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MF554637	uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence	14942-14975	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP016575	Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00435 plasmid pAMR588-04-00435_37, complete sequence	296-329	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP020060	Escherichia coli strain AR_0061 plasmid unitig_2, complete sequence	30572-30605	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032994	Escherichia coli strain W5-6 plasmid p2_W5-6, complete sequence	10049-10082	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MN783746	Escherichia coli plasmid pIncX1_p1, complete sequence	5290-5323	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	40397-40430	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_KU254580	Escherichia coli strain YD786 plasmid pYD786-3, complete sequence	25507-25540	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP042633	Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-6, complete sequence	38916-38949	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032392	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_2, complete sequence	67739-67772	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP019272	Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence	35028-35061	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP053728	Escherichia coli strain CP61_Sichuan plasmid pCP61-IncN, complete sequence	69102-69135	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP037995	Salmonella enterica subsp. enterica serovar Brancaster strain sg_ww281 plasmid psg_ww281	7255-7288	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP053740	Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncX1, complete sequence	9971-10004	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP016580	Salmonella enterica subsp. enterica serovar Heidelberg strain SH13-006 plasmid pSH13-006_37, complete sequence	23703-23736	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP046001	Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence	49989-50022	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP021103	Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence	56470-56503	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP029182	Escherichia coli strain H9Ecoli plasmid p3-H9, complete sequence	2302-2335	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MN086778	Escherichia coli plasmid p16EC-IncN, complete sequence	90173-90206	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP053047	Escherichia fergusonii strain HNCF11W plasmid pHNCF11W-tetX4, complete sequence	9874-9907	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP014974	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY3-1898, complete sequence	295-328	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	220331-220364	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP035774	Klebsiella pneumoniae strain R46 plasmid pR46-27, complete sequence	12757-12790	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP044182	Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-1, complete sequence	25543-25576	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP042608	Escherichia coli strain NCYU-29-19 plasmid pNCYU-29-19-2_MCR3, complete sequence	7171-7204	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MK461930	Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence	45261-45294	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_019046	Escherichia coli plasmid pNMEC31_31, complete sequence	31361-31394	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP047460	Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence	89191-89224	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP047466	Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence	30748-30781	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP035315	Escherichia coli strain D72 plasmid pD72-IncX1, complete sequence	28493-28526	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050748	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-3, complete sequence	5878-5911	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_024961	Escherichia coli plasmid pIS15_43, strain ISI5, complete sequence	905-938	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_021842	Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_02, complete sequence	4017-4050	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_LT985261	Escherichia coli strain 657 plasmid RCS50_p, complete sequence	42585-42618	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_AP019678	Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-3, complete sequence	49115-49148	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP009074	Escherichia coli ATCC 25922 plasmid unnamed, complete sequence	21137-21170	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP010168	Escherichia coli strain H3 plasmid A, complete genome	25682-25715	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_010378	Escherichia coli plasmid pOLA52, complete sequence	34562-34595	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	CP016512	Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-028 plasmid pSH14-028_37, complete sequence	23704-23737	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP016529	Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_42, complete sequence	23704-23737	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP016518	Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435 plasmid pCE-R2-11-0435_37, complete sequence	23705-23738	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032988	Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence	50710-50743	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP017633	Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence	23885-23918	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP012922	Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_37, complete sequence	23704-23737	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP033093	Escherichia coli strain CP53 plasmid pCP53-38k, complete sequence	19532-19565	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP012926	Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_37, complete sequence	37369-37402	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP023360	Escherichia coli strain 1943 plasmid p54, complete sequence	52726-52759	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	CP043734	Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence	37807-37840	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP039600	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014867 plasmid p12-6334.1, complete sequence	32872-32905	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP030283	Escherichia coli strain E308 plasmid pLKSZ02, complete sequence	49947-49980	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_011204	Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence	70648-70681	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_017624	Salmonella enterica subsp. enterica serovar Heidelberg str. B182 plasmid pB182_37, complete sequence	23689-23722	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050710	Salmonella enterica subsp. enterica serovar Enteritidis strain SE109 plasmid pSE109-1, complete sequence	15569-15602	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP024290	Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed1, complete sequence	33653-33686	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP048777	Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-X, complete sequence	1446-1479	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041631	Escherichia coli strain PE15 plasmid pPE15-27K, complete sequence	4799-4832	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050773	Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-2, complete sequence	30707-30740	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP041444	Escherichia coli strain YPE10 plasmid pYPE10-78k, complete sequence	38005-38038	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP019180	Salmonella enterica subsp. enterica serovar Dublin str. ATCC 39184 plasmid pATCC39184, complete sequence	24566-24599	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050765	Salmonella enterica subsp. enterica serovar Indiana strain SI111 plasmid pSI111-1, complete sequence	6593-6626	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_010422	Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence	59434-59467	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050759	Salmonella enterica subsp. enterica serovar Indiana strain SI173 plasmid pSI173-2, complete sequence	5734-5767	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_AP022652	Escherichia coli strain 09-02E plasmid p2-09-02E, complete sequence	295-328	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP024136	Escherichia coli strain 14EC017 plasmid p14EC017b, complete sequence	79478-79511	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_LT985315	Escherichia coli strain ECOR 70 plasmid RCS99_p, complete sequence	47119-47152	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MN436006	Escherichia coli strain JS1-EC05 plasmid pEC05-X4, complete sequence	27492-27525	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MN436007	Escherichia coli strain JS3-EC12 plasmid pEC12-X4, complete sequence	27131-27164	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MK360096	Salmonella enterica strain 13-SA02717 plasmid pSE13-SA02717, complete sequence	44664-44697	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP045839	Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence	48284-48317	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP032381	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU2-USMARC-69807, complete sequence	12454-12487	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG825381	Escherichia coli strain 1108 plasmid p1108-NDM, complete sequence	43402-43435	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT197111	Escherichia coli strain RB3-1 plasmid pRB3-1_31K_tetX, complete sequence	12897-12930	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219817	Escherichia coli strain RF148-2 plasmid pRF148-2_101k_tetX, complete sequence	59284-59317	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219819	Escherichia coli strain RF52-1 plasmid pRF52-1_119k_tetX, complete sequence	118931-118964	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	MT219821	Escherichia coli strain RF45-1 plasmid pRF45-1_31k_tetX, complete sequence	3734-3767	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MG288677	Klebsiella pneumoniae strain F160070 plasmid p160070-CTXM, complete sequence	29004-29037	0	1.0
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP030195	Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence	159-192	1	0.971
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP033353	Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence	78450-78483	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP050780	Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence	203947-203980	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP022061	Salmonella enterica strain FDAARGOS_312 plasmid unnamed2, complete sequence	1711-1744	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	CP048927	Salmonella enterica subsp. enterica serovar Saintpaul strain NY-N14748 plasmid pN14748, complete sequence	45611-45644	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP029841	Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence	98434-98467	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP028313	Salmonella enterica subsp. enterica serovar Heidelberg strain CFSAN067218 plasmid pSH-04-2, complete sequence	41569-41602	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP018662	Salmonella enterica subsp. enterica serovar Enteritidis strain 95-0621 plasmid pSE95-0621-1, complete sequence	41992-42025	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	CP049987	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N16S133 plasmid pN16S133, complete sequence	41386-41419	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	CP049982	Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N52030 plasmid pN52030, complete sequence	42740-42773	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NC_010421	Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence	27662-27695	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_MK625201	Salmonella enterica subsp. enterica serovar Pullorum strain S9804 plasmid pSPUR, complete sequence	41824-41857	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP023476	Salmonella enterica subsp. enterica serovar Enteritidis strain FORC_075 plasmid pFORC75_2, complete sequence	33473-33506	2	0.941
CP032450_1	1.1\|29110\|34\|CP032450\|CRISPRCasFinder	29110-29143	34	NZ_CP044292	Escherichia coli strain P43A plasmid pP43A-1, complete sequence	44259-44292	4	0.882

1. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_KX518744 (Escherichia coli strain HYEC7 plasmid pHYEC7-110, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

2. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041286 (Escherichia coli strain 54 plasmid p54-tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

3. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_KU321583 (Escherichia coli strain E80 plasmid pE80, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

4. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_KT990220 (Escherichia coli strain 42-2 plasmid p42-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

5. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP010164 (Escherichia coli strain H2 plasmid A, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

6. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP019647 (Salmonella enterica subsp. enterica serovar Typhimurium strain TW-Stm6 plasmid pSTM6-275, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

7. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP022964 (Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

8. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP024467 (Shigella dysenteriae strain BU53M1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

9. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_LS999563 (Escherichia coli isolate EC-TO143 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

10. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_LS999563 (Escherichia coli isolate EC-TO143 plasmid 4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

11. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP019284 (Escherichia coli strain 13P484A plasmid p13P484A-4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

12. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP047093 (Salmonella sp. S13 plasmid pS13-4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

13. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP051432 (Escherichia sp. SCLE84 plasmid pSCLE2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

14. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP046002 (Escherichia coli strain 1916D6 plasmid p1916D6-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

15. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP045188 (Escherichia coli strain NT1F31 plasmid pNT1F31-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

16. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

17. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP031548 (Escherichia coli strain cq9 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

18. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032386 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

19. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032389 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

20. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_LT904873 (Salmonella enterica subsp. enterica serovar Typhi strain ERL11909 plasmid 2) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

21. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_KT754163 (Shigella dysenteriae 1 strain A5468 plasmid pA5468, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

22. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP033383 (Salmonella enterica subsp. enterica strain CFSA300 plasmid pCFSA300-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

23. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP020836 (Escherichia coli strain CFSAN051542 plasmid pCFSAN051542, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

24. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP038140 (Escherichia coli strain G3X16-2 plasmid pG3X16-2-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

25. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP043216 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.2-IncX1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

26. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP042617 (Escherichia coli strain NCYU-26-73 plasmid pNCYU-26-73-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

27. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP031361 (Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

28. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP044153 (Shigella flexneri strain AR-0425 plasmid pAR-0425-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

29. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP040929 (Escherichia coli strain YY76-1 plasmid pYY76-1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

30. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP033386 (Salmonella enterica subsp. enterica strain CFSA1007 plasmid pCFSA1007-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

31. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041177 (Salmonella enterica subsp. enterica serovar Enteritidis strain SJTUF12367v2 plasmid p12367A, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

32. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP034761 (Klebsiella pneumoniae strain NB5306 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

33. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050707 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE124 plasmid pSE124-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

34. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP047339 (Klebsiella pneumoniae strain 2019036D plasmid p2019036D-35kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

35. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_010860 (Salmonella enterica subsp. enterica serovar Enteritidis plasmid pSE34, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

36. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP022453 (Salmonella enterica subsp. enterica serovar Indiana strain D90 plasmid pD90-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

37. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP024153 (Escherichia coli strain 14EC033 plasmid p14EC033f, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

38. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP030208 (Salmonella enterica strain SA19992307 plasmid pSA19992307.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

39. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP005994 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002064 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

40. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032450 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

41. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP010155 (Escherichia coli strain D9 plasmid C, complete genome) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

42. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050174 (Escherichia coli strain STB20-1 plasmid pSTB20-1T, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

43. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP029061 (Escherichia coli strain FORC_081 plasmid pFORC_081_4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

44. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP042589 (Escherichia coli strain PK6 plasmid pRHEcCUB-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

45. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP025677 (Escherichia albertii strain ChinaSP140150 plasmid pEA-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

46. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041453 (Escherichia coli strain YPE3 plasmid pYPE3-92k-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

47. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MN816373 (Escherichia coli strain A127 plasmid pA127-X1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

48. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP052879 (Escherichia coli strain C21 plasmid pC21-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

49. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP033379 (Escherichia coli strain L73 plasmid pL73-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

50. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP033632 (Escherichia coli isolate ECCNB12-2 plasmid pTB-nb1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

51. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050724 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE74 plasmid pSE74-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

52. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP047573 (Escherichia coli strain 2EC1 plasmid p2EC1-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

53. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_019106 (Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_77, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

54. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP010127 (Escherichia coli strain C8 plasmid B, complete genome) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

55. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP027138 (Escherichia coli strain AR_0369 plasmid unnamed2) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

56. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP022072 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

57. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

58. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP043935 (Klebsiella pneumoniae strain 555 plasmid pSCKLB555-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

59. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP045998 (Escherichia coli strain 1916D18 plasmid p1916D18-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

60. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032394 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

61. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_019256 (Shigella sp. LN126 plasmid pLN126_33, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

62. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MH884649 (Salmonella sp. strain Sa21 plasmid pSa21-IncX1-28K, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

63. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MH884651 (Salmonella sp. strain Sa21 plasmid pSa21-TC-CIP, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

64. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MH229869 (Escherichia coli plasmid pKANJ7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

65. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050713 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE104 plasmid pSE104-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

66. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041439 (Escherichia coli strain YPE12 plasmid pYPE12-106k, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

67. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041443 (Escherichia coli strain YPE12 plasmid pYPE12-101k-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

68. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MK461931 (Escherichia coli strain F2_14D plasmid pF2_14D_HI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

69. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MK656937 (Escherichia coli strain T3 plasmid pT3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

70. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MK731977 (Escherichia coli strain ENV103 plasmid pSGMCR103, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

71. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MK673546 (Salmonella enterica subsp. enterica serovar Typhimurium strain GDD27-24 plasmid pGDD27-24, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

72. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032447 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU1-USMARC-69840, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

73. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

74. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MH179305 (Salmonella enterica subsp. enterica serovar Indiana strain JT01 plasmid pJT01, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

75. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MH287085 (Escherichia coli strain F2_12B plasmid pSDC-F2_12BHI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

76. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MH287084 (Escherichia coli O157 strain SvETEC plasmid pSDE-SvHI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

77. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP025558 (Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532 plasmid p2PIR00532, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

78. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219825 (Escherichia coli strain RW7-1 plasmid pRW7-1_235k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

79. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219826 (Escherichia coli strain RW8-1 plasmid pRW8-1_122k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

80. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG904998 (Escherichia coli strain 15OD0495 plasmid p15ODTXV, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

81. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG197491 (Escherichia coli strain FKU92 plasmid pHNFKU92, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

82. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG197498 (Escherichia coli strain HZMCC14 plasmid pHNMCC14, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

83. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG197503 (Escherichia coli strain ZYTM118 plasmid pHNZY118, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

84. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG197495 (Escherichia coli strain AHC24 plasmid pHNAH24, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

85. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MF589339 (Escherichia coli strain 2271 plasmid pCTXM-2271, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

86. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG197502 (Escherichia coli strain ZYTF32 plasmid pHNZY32, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

87. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219818 (Escherichia coli strain RF148-1 plasmid pRF148-1_119k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

88. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219820 (Escherichia coli strain RF108-2 plasmid pRF108-2_97k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

89. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219822 (Escherichia coli strain RF14-1 plasmid pRF14-1_50k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

90. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219823 (Escherichia coli strain RF10-1 plasmid pRF10-1_119k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

91. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_023323 (Escherichia coli ACN001 plasmid pACN001-A, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

92. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MF554637 (uncultured bacterium clone AA-100 plasmid pPIMMR, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

93. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP016575 (Salmonella enterica subsp. enterica serovar Heidelberg strain AMR588-04-00435 plasmid pAMR588-04-00435_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

94. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP020060 (Escherichia coli strain AR_0061 plasmid unitig_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

95. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032994 (Escherichia coli strain W5-6 plasmid p2_W5-6, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

96. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MN783746 (Escherichia coli plasmid pIncX1_p1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

97. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

98. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_KU254580 (Escherichia coli strain YD786 plasmid pYD786-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

99. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP042633 (Escherichia coli strain NCYU-25-82 plasmid pNCYU-25-82-6, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

100. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032392 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

101. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP019272 (Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

102. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP053728 (Escherichia coli strain CP61_Sichuan plasmid pCP61-IncN, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

103. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP037995 (Salmonella enterica subsp. enterica serovar Brancaster strain sg_ww281 plasmid psg_ww281) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

104. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP053740 (Escherichia coli strain CP8-3_Sichuan plasmid pCP8-3-IncX1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

105. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP016580 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH13-006 plasmid pSH13-006_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

106. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP046001 (Escherichia coli strain 1916D6 plasmid p1916D6-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

107. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP021103 (Escherichia coli strain 13P477T plasmid p13P477T-7, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

108. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP029182 (Escherichia coli strain H9Ecoli plasmid p3-H9, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

109. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MN086778 (Escherichia coli plasmid p16EC-IncN, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

110. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP053047 (Escherichia fergusonii strain HNCF11W plasmid pHNCF11W-tetX4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

111. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP014974 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY3-1898, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

112. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

113. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP035774 (Klebsiella pneumoniae strain R46 plasmid pR46-27, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

114. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP044182 (Salmonella enterica subsp. enterica serovar Heidelberg strain AR-0404 plasmid pAR-0404-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

115. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP042608 (Escherichia coli strain NCYU-29-19 plasmid pNCYU-29-19-2_MCR3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

116. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MK461930 (Escherichia coli strain 2009_36 plasmid p2009_36_HI2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

117. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_019046 (Escherichia coli plasmid pNMEC31_31, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

118. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP047460 (Escherichia coli strain ZF31 plasmid pZF31-tetX-119kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

119. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP047466 (Escherichia coli strain ZF34 plasmid pZF34-tetX-114kb, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

120. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP035315 (Escherichia coli strain D72 plasmid pD72-IncX1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

121. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050748 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

122. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_024961 (Escherichia coli plasmid pIS15_43, strain ISI5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

123. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_021842 (Salmonella enterica subsp. enterica serovar Heidelberg str. CFSAN002069 plasmid pCFSAN002069_02, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

124. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_LT985261 (Escherichia coli strain 657 plasmid RCS50_p, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

125. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_AP019678 (Escherichia coli strain GSH8M-2 plasmid pGSH8M-2-3, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

126. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP009074 (Escherichia coli ATCC 25922 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

127. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP010168 (Escherichia coli strain H3 plasmid A, complete genome) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

128. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_010378 (Escherichia coli plasmid pOLA52, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

129. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to CP016512 (Salmonella enterica subsp. enterica serovar Heidelberg strain SH14-028 plasmid pSH14-028_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

130. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP016529 (Salmonella enterica subsp. enterica serovar Heidelberg strain 09-036813-1A plasmid p09-036813-1A_42, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

131. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP016518 (Salmonella enterica subsp. enterica serovar Heidelberg strain CE-R2-11-0435 plasmid pCE-R2-11-0435_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

132. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032988 (Escherichia coli strain BE2-5 plasmid p2_BE2-5, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

133. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP017633 (Escherichia coli strain SLK172 plasmid pSLK172-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

134. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP012922 (Salmonella enterica subsp. enterica serovar Heidelberg strain SA02DT10168701 plasmid pSA02DT10168701_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

135. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP033093 (Escherichia coli strain CP53 plasmid pCP53-38k, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

136. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP012926 (Salmonella enterica subsp. enterica serovar Heidelberg strain 12-4374 plasmid p12-4374_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

137. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP023360 (Escherichia coli strain 1943 plasmid p54, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

138. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to CP043734 (Escherichia coli strain CVM N17EC1164 plasmid pN17EC1164-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

139. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP039600 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014867 plasmid p12-6334.1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

140. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP030283 (Escherichia coli strain E308 plasmid pLKSZ02, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

141. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_011204 (Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 plasmid pCT02021853_74, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

142. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_017624 (Salmonella enterica subsp. enterica serovar Heidelberg str. B182 plasmid pB182_37, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

143. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050710 (Salmonella enterica subsp. enterica serovar Enteritidis strain SE109 plasmid pSE109-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

144. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP024290 (Escherichia coli O178:H19 strain 2012C-4431 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

145. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP048777 (Salmonella enterica subsp. enterica serovar Agona strain SG17-135 plasmid pSG17-135-X, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

146. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041631 (Escherichia coli strain PE15 plasmid pPE15-27K, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

147. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050773 (Salmonella enterica subsp. enterica serovar Indiana strain SI102 plasmid pSI102-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

148. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP041444 (Escherichia coli strain YPE10 plasmid pYPE10-78k, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

149. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP019180 (Salmonella enterica subsp. enterica serovar Dublin str. ATCC 39184 plasmid pATCC39184, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

150. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050765 (Salmonella enterica subsp. enterica serovar Indiana strain SI111 plasmid pSI111-1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

151. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_010422 (Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1115, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

152. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050759 (Salmonella enterica subsp. enterica serovar Indiana strain SI173 plasmid pSI173-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

153. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_AP022652 (Escherichia coli strain 09-02E plasmid p2-09-02E, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

154. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP024136 (Escherichia coli strain 14EC017 plasmid p14EC017b, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

155. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_LT985315 (Escherichia coli strain ECOR 70 plasmid RCS99_p, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

156. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MN436006 (Escherichia coli strain JS1-EC05 plasmid pEC05-X4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

157. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MN436007 (Escherichia coli strain JS3-EC12 plasmid pEC12-X4, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

158. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MK360096 (Salmonella enterica strain 13-SA02717 plasmid pSE13-SA02717, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

159. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP045839 (Citrobacter sp. H12-3-2 plasmid pH12-2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

160. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP032381 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU2-USMARC-69807, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

161. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG825381 (Escherichia coli strain 1108 plasmid p1108-NDM, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

162. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT197111 (Escherichia coli strain RB3-1 plasmid pRB3-1_31K_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

163. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219817 (Escherichia coli strain RF148-2 plasmid pRF148-2_101k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

164. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219819 (Escherichia coli strain RF52-1 plasmid pRF52-1_119k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

165. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to MT219821 (Escherichia coli strain RF45-1 plasmid pRF45-1_31k_tetX, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

166. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MG288677 (Klebsiella pneumoniae strain F160070 plasmid p160070-CTXM, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaattacag	Protospacer
**********************************

167. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP030195 (Salmonella enterica strain SA20080453 plasmid pSA20080453.1, complete sequence) position: , mismatch: 1, identity: 0.971

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgcagccatccacctttcatgaaaatcacag	Protospacer
*****************************.****

168. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP033353 (Salmonella enterica subsp. enterica strain CFSA664 plasmid pCFSA664-1, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gcccgcagccatccacctttcatgaaaattacag	Protospacer
*. *******************************

169. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP050780 (Salmonella enterica subsp. enterica serovar Indiana strain SI85 plasmid pSI85-1, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gcccgcagccatccacctttcatgaaaattacag	Protospacer
*. *******************************

170. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP022061 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

171. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to CP048927 (Salmonella enterica subsp. enterica serovar Saintpaul strain NY-N14748 plasmid pN14748, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

172. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP029841 (Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

173. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP028313 (Salmonella enterica subsp. enterica serovar Heidelberg strain CFSAN067218 plasmid pSH-04-2, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

174. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP018662 (Salmonella enterica subsp. enterica serovar Enteritidis strain 95-0621 plasmid pSE95-0621-1, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

175. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to CP049987 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N16S133 plasmid pN16S133, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

176. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to CP049982 (Salmonella enterica subsp. enterica serovar Saintpaul strain CVM N52030 plasmid pN52030, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

177. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NC_010421 (Salmonella enterica subsp. enterica serovar Dublin plasmid pOU1114, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

178. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_MK625201 (Salmonella enterica subsp. enterica serovar Pullorum strain S9804 plasmid pSPUR, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

179. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP023476 (Salmonella enterica subsp. enterica serovar Enteritidis strain FORC_075 plasmid pFORC75_2, complete sequence) position: , mismatch: 2, identity: 0.941

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
gtgcgtacccatccacctttcatgaaaattacag	Protospacer
*****.* **************************

180. spacer 1.1|29110|34|CP032450|CRISPRCasFinder matches to NZ_CP044292 (Escherichia coli strain P43A plasmid pP43A-1, complete sequence) position: , mismatch: 4, identity: 0.882

gtgcgcagccatccacctttcatgaaaattacag	CRISPR spacer
tcgaacagccatccacctttcatgaaaattacag	Protospacer
 .* .*****************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP032449

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032449_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032449_1

975097-975367

TypeI-E

I-E

Consensus_repeat	Method
GTGTTCCCCGCGCCAGCGGGGATAAAC	PILER-CR
GTGTTCCCCGCGCCAGCGGGGATAAAC	CRISPRCasFinder
GTGTTCCCCGCGCCAGCGGGGATAAAC	CRT

4 spacers

cas8e

The CRISPR arrays of CP032449_1

>merge|CP032449|1|975097-975367|PILER-CR,CRISPRCasFinder,CRT
GTGTTCCCCGCGCCAGCGGGGATAAACTGCCGTGCCTGTCCAGGACAAATTGCCGATTATTGTGTTCCCCGCGCCAGCGGGGATAAACTGCTGCCGGTCTGTGCTGTTGTCGTCAATAATCAGTGTTCCCCGCGCCAGCGGGGATAAACCGAGTTACTGATGCAGACTGCGGATCTTAATCGGGTGTTCCCCGCGCCAGCGGGGATAAACCGTGCGCCAACGACTGGAATTTTTGCGTGTAGCCGTGTTCCCCGCGCCAACAAGGATAGCC

>CP032449|1|1|975097-975306|PILER-CR
GTGTTCCCCGCGCCAGCGGGGATAAAC	TGCCGTGCCTGTCCAGGACAAATTGCCGATTATT
GTGTTCCCCGCGCCAGCGGGGATAAAC	TGCTGCCGGTCTGTGCTGTTGTCGTCAATAATCA
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGAGTTACTGATGCAGACTGCGGATCTTAATCGG
GTGTTCCCCGCGCCAGCGGGGATAAAC

>CP032449|1|1|975097-975367|CRISPRCasFinder
GTGTTCCCCGCGCCAGCGGGGATAAAC	TGCCGTGCCTGTCCAGGACAAATTGCCGATTATT
GTGTTCCCCGCGCCAGCGGGGATAAAC	TGCTGCCGGTCTGTGCTGTTGTCGTCAATAATCA
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGAGTTACTGATGCAGACTGCGGATCTTAATCGG
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGTGCGCCAACGACTGGAATTTTTGCGTGTAGCC
GTGTTCCCCGCGCCAACAAGGATAGCC

>CP032449|1|1|975097-975367|CRT
GTGTTCCCCGCGCCAGCGGGGATAAAC	TGCCGTGCCTGTCCAGGACAAATTGCCGATTATT
GTGTTCCCCGCGCCAGCGGGGATAAAC	TGCTGCCGGTCTGTGCTGTTGTCGTCAATAATCA
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGAGTTACTGATGCAGACTGCGGATCTTAATCGG
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGTGCGCCAACGACTGGAATTTTTGCGTGTAGCC
GTGTTCCCCGCGCCAACAAGGATAGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP032449.1\|AYB77534.1\|972694_973993_+\|enolase	unknown	unknown	gnl\|CDD\|234617
CP032449.1\|AYB77541.1\|985645_987202_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
CP032449.1\|AYB77539.1\|978937_980650_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	unknown	unknown	gnl\|CDD\|237402
CP032449.1\|AYB77531.1\|968753_969341_-\|fimbrial-protein-SteA	unknown	unknown	gnl\|CDD\|185169
CP032449.1\|AYB77532.1\|969946_970747_+\|nucleoside-triphosphate-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|236569
CP032449.1\|AYB81166.1\|982642_982849_-\|hypothetical-protein	unknown	unknown	unknown
CP032449.1\|AYB77535.1\|974128_974800_+\|7-carboxy-7-deazaguanine-synthase-QueE	unknown	unknown	gnl\|CDD\|275126
CP032449.1\|AYB81165.1\|981573_982527_-\|SPI-1-type-III-secretion-system-effector-SopD	unknown	unknown	gnl\|CDD\|185277
CP032449.1\|AYB77537.1\|976352_976715_-\|6-carboxytetrahydropterin-synthase-QueD	unknown	unknown	gnl\|CDD\|238264
CP032449.1\|AYB77538.1\|977138_978938_+\|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|182862
CP032449.1\|AYB77530.1\|965974_968674_-\|fimbrial-biogenesis-outer-membrane-usher-protein	unknown	unknown	gnl\|CDD\|185176
CP032449.1\|AYB77527.1\|964177_964648_-\|fimbrial-protein	unknown	unknown	gnl\|CDD\|185179
CP032449.1\|AYB77528.1\|964662_965169_-\|fimbrial-protein	unknown	unknown	gnl\|CDD\|185178
CP032449.1\|AYB77533.1\|970974_972612_+\|CTP-synthetase	unknown	unknown	gnl\|CDD\|235437
CP032449.1\|AYB81164.1\|980606_980825_-\|hypothetical-protein	unknown	unknown	unknown
CP032449.1\|AYB77540.1\|980751_981486_+\|phosphoadenosine-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997
CP032449.1\|AYB77536.1\|975467_976265_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|224158
CP032449.1\|AYB77526.1\|963644_964181_-\|fimbrial-protein-SteF	unknown	unknown	gnl\|CDD\|185168
CP032449.1\|AYB81163.1\|976643_976814_+\|6-pyruvoyl-tetrahydrobiopterin-synthase	unknown	unknown	unknown
CP032449.1\|AYB77529.1\|965188_965962_-\|fimbrial-protein	unknown	unknown	gnl\|CDD\|185177

Protein	Function_ID	Function_description	E-value
CP032449.1\|AYB77534.1\|972694_973993_+\|enolase	gnl\|CDD\|234617	PRK00077, eno, enolase; Provisional.	0
CP032449.1\|AYB77541.1\|985645_987202_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	0
CP032449.1\|AYB77539.1\|978937_980650_+\|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit	gnl\|CDD\|237402	PRK13504, PRK13504, NADPH-dependent assimilatory sulfite reductase hemoprotein subunit.	0
CP032449.1\|AYB77531.1\|968753_969341_-\|fimbrial-protein-SteA	gnl\|CDD\|185169	PRK15261, PRK15261, fimbrial protein SteA; Provisional.	5.36845e-100
CP032449.1\|AYB77532.1\|969946_970747_+\|nucleoside-triphosphate-pyrophosphohydrolase	gnl\|CDD\|236569	PRK09562, mazG, nucleoside triphosphate pyrophosphohydrolase; Reviewed.	3.42454e-158
CP032449.1\|AYB77535.1\|974128_974800_+\|7-carboxy-7-deazaguanine-synthase-QueE	gnl\|CDD\|275126	TIGR04322, organic_radical_activating_enzyme, putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. Members of this radical SAM domain protein family appear to be the E. coli form of the queuosine biosynthesis protein QueE. QueE is involved in making preQ0 (7-cyano-7-deazaquanine), a precursor of both the bacterial/eukaryotic modified tRNA base queuosine and the archaeal modified base archaeosine. Members occur in species that lack known forms of QueE but usually are not found in queuosine biosynthesis operons. Members of this family tend to form bi-directional best hit matches to members of known (TIGR03365) and putative (TIGR03963) QueE families from other lineages.	1.43874e-155
CP032449.1\|AYB81165.1\|981573_982527_-\|SPI-1-type-III-secretion-system-effector-SopD	gnl\|CDD\|185277	PRK15379, PRK15379, type III secretion system effector SopD.	0
CP032449.1\|AYB77537.1\|976352_976715_-\|6-carboxytetrahydropterin-synthase-QueD	gnl\|CDD\|238264	cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PTPS). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids, as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after uptake by a carrier-mediated active transport system. Most microbes and plants lack this system and must synthesize folates de novo from guanosine triphosphate. One enzyme from this pathway is PTPS which catalyzes the conversion of dihydroneopterin triphosphate to 6-pyruvoyl tetrahydropterin. The functional enzyme is a hexamer of identical subunits.	2.78454e-58
CP032449.1\|AYB77538.1\|977138_978938_+\|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit	gnl\|CDD\|182862	PRK10953, cysJ, NADPH-dependent assimilatory sulfite reductase flavoprotein subunit.	0
CP032449.1\|AYB77530.1\|965974_968674_-\|fimbrial-biogenesis-outer-membrane-usher-protein	gnl\|CDD\|185176	PRK15273, PRK15273, fimbrial biogenesis outer membrane usher protein.	0
CP032449.1\|AYB77527.1\|964177_964648_-\|fimbrial-protein	gnl\|CDD\|185179	PRK15276, PRK15276, putative fimbrial subunit SteE; Provisional.	2.10162e-98
CP032449.1\|AYB77528.1\|964662_965169_-\|fimbrial-protein	gnl\|CDD\|185178	PRK15275, PRK15275, putative fimbrial protein SteD; Provisional.	4.31975e-105
CP032449.1\|AYB77533.1\|970974_972612_+\|CTP-synthetase	gnl\|CDD\|235437	PRK05380, pyrG, CTP synthetase; Validated.	0
CP032449.1\|AYB77540.1\|980751_981486_+\|phosphoadenosine-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	7.73232e-139
CP032449.1\|AYB77536.1\|975467_976265_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|224158	COG1237, COG1237, Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only].	1.00381e-102
CP032449.1\|AYB77526.1\|963644_964181_-\|fimbrial-protein-SteF	gnl\|CDD\|185168	PRK15260, PRK15260, fimbrial protein SteF; Provisional.	7.785e-121
CP032449.1\|AYB77529.1\|965188_965962_-\|fimbrial-protein	gnl\|CDD\|185177	PRK15274, PRK15274, putative periplasmic fimbrial chaperone protein SteC; Provisional.	0

>CP032449.1|AYB77535.1|974128_974800_+|7-carboxy-7-deazaguanine-synthase-QueE
MQYPINEMFQTLQGEGYFTGVPAIFIRLQGCPVGCAWCDTKHTWDKLSDREVSLFSILAKTKESDKWGAASSEDLLAVINRQGYTARHVVITGGEPCIHDLMPLTDLLEKSGFSCQIETSGTHEVRCTPNTWVTVSPKVNMRGGYDVLSQALERANEIKHPVGRVRDIEALDELLATLSDDKPRVIALQPISQKEDATRLCIETCIARNWRLSMQTHKYLNIA
>CP032449.1|AYB77534.1|972694_973993_+|enolase
MSKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLGKGVTKAVGAVNGPIAQAILGKDAKDQAGIDKIMIDLDGTENKSNFGANAILAVSLANAKAAAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQPVGAKTVKEAIRMGSEVFHHLAKVLKGKGMNTAVGDEGGYAPNLGSNAEALAVIAEAVKAAGYELGKNITLAMDCAASEFYKDGKYVLAGEGNKAFTSEEFTHFLEELTKQYPIVSIEDGLDESDWDGFAYQTKVLGDKIQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRVAKYNQLIRIEEALGEKAPYNGRKEIKGQA
>CP032449.1|AYB77533.1|970974_972612_+|CTP-synthetase
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEVFVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHITNAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQLAVDIGREHALFMHLTLVPYLAAAGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISMKDVDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIYEEANPAGEVTIGMVGKYIELPDAYKSVIEALKHGGLKNRVTVNIKLIDSQDVETRGVEILKDLDAILIPGGFGYRGVEGKIATARYARENNIPYLGICLGMQVALIEFARNVAGMDNANSTEFVPDCKYPVVALITEWRDEDGNVEVRSEKSDLGGTMRLGAQQCQLSDDSLVRQLYGASTIVERHRHRYEVNNMLLKQIEAAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAANEHQKRQAK
>CP032449.1|AYB77532.1|969946_970747_+|nucleoside-triphosphate-pyrophosphohydrolase
MTTNHQIDRLLTLMQRLRDPENGCPWDKEQTFASIAPYTLEETYEVLDAIAREDFDDLRGELGDLLFQVVFYAQMAQEEGRFDFNDICAAISDKLERRHPHVFGELSADNSEEALVRWEQIKTEERAQKAQHSALDDIPRSLPALMRAQKIQKRCSNVGFDWTTLGPVVDKVYEEIDEVMFEARQAVVDQAKLEEEMGDLLFATVNMARHLGTKAELALQKANDKFERRFREVERIVAARGLEMTGVDLETMEEVWQEVKRQEIDL
>CP032449.1|AYB77531.1|968753_969341_-|fimbrial-protein-SteA
MKSSHFCKLAVTASLVMGIVSGAQAAGSNTAKVTFLGNIVDSPCSVTLDTEDQTVNMGSSIGNGTLSNGKTTINNARTFHIDLEGCTWATEKNMNVVFTTGSGTTAATGATDNLALMKTDGTGAISNVSLAIGDAGKNNIKLGDTYTQAIADLDGDTILDEKQSLNFTAWLVGAATGTVGTGEFSSAANVTISYL
>CP032449.1|AYB77530.1|965974_968674_-|fimbrial-biogenesis-outer-membrane-usher-protein
MMNNTWKSVLCPIACGVGMLLSLSPYSASGKDIEFNTDFLDVKNRDNVNIAQFSRKGFILPGVYLLQIKINGQTLPQEFPVNWVIPEHDPQGSEVCAEPELVTQLGIKPELAEKLVWITHGERQCLAPDSLKGMDFQADLGHSTLLVNLPQAYMEYSDVDWDPPARWDNGIPGIILDYNINNQLRHDQESGSEEQSISGNGTLGANLGAWRLRADWQASYDHRDDDENTSTLHDQSWSRYYAYRALPTLGAKLTLGESYLQSDVFDSFNYIGASVVSDDQMLPPKLRGYAPEIVGIARSNAKVKVSWQGRVLYETQVPAGPFRIQDLNQSVSGTLHVTVEEQNGQTQEFDVNTASVPFLTRPGMVRYKMALGRPQDWDHHPITGTFASAEASWGVTNGWSLYGGAIGESNYQAVALGSGKDLGVVGAVAVDITHSIAHMPQDDGFDGETLQGNSYRISYSRDFDEIDSRLTFAGYRFSEKNFMSMSDYLDAKTYHHLNAGHEKERYTVTYNQNFREQGMSAYFSYSRSTFWDSPDQSNYNLSLSWYFDLGSIKNLSASLNGYRSEYNGDKDDGVYISLSVPWGNDSISYNGTFNGSQHRNQLGYSGHSQNGDNWQLHVGQDEQGAQADGYYSYQGALTDIDLSADYEEGSYRSLGMSLRGGMTLTTQGGALHRGSLAGSTRLLVDTDGIADVPVSGNGSPTSTNIFGKAVIADVGSYSRSLARIDLNKLPEKAEATKSVVQITLTEGAIGYRHFDVVSGEKMMAVFRLADGDFPPFGAEVKNERQQQLSLVADDGNAWLAGVKAGETLKVFWDGAAQCEASLPSTFTPELLANALLLPCKMLEGQPPTAPQKSSPLPAQPLIQEHTQTDGQPAAPVATTTQTPPIPLADNHAVNRKDME
>CP032449.1|AYB77529.1|965188_965962_-|fimbrial-protein
MNKTNHFKRQALIASVLLAAPLVSHSAIVPDRTRVIFNGNENSITVTLKNGNATLPYLAQAWLEDDKFAKDTRYFTALPPLQRIEPKSDGQVKVQPLPAAASLPQDRESLFYFNVREIPPKSDKPNTLQLALQTRIKFFYRPVAVARQVDKTHPWQTKLTLTYQGDGVIFDNPTPFYLVISNAGSKENETASGFKNLLIAPREKVTSPIKGASLGSSPVVGYVDDYGGHRLLVFTCSGNTCKVNEEKTRDAEKKANK
>CP032449.1|AYB77528.1|964662_965169_-|fimbrial-protein
MTMLTRWKMLVLLCGGFVTGTEAAGTKTVQLELHLVVTQPPPCTVGGASVEFGDVLTTKVGDASQTKPVGYSLNCDGRASDYLKLQIQGTTTTISGEQVLQTSVQGLGIRIQQAGNKQLVPVGITDWLNFTLSGSNGPELEAVPVKEPTTQLAGGDFNASATLVVDYQ
>CP032449.1|AYB77527.1|964177_964648_-|fimbrial-protein
MKRVLILTLLITQFACADNLTFHGKLINPPACTINNGEMLEVSFGSVIIDNIDGVNYLTEIPWTLTCDSSFRDDALTFTLSYLGTATPYSAKALTTSVPELGIELQQNGTVFPPGTSLTINESSLPTLKAVPVKQPGKEPAEGDFEAFATLQVDYQ
>CP032449.1|AYB77526.1|963644_964181_-|fimbrial-protein-SteF
MNRIFQTAGHLIGGVMLWAVCNTLPAATPNVHYSGKLVAGACNLVVDNDTMATVDFHTIGSDNFDASGQTTPVPFTLSLQDCKTALANGVLVTFQGVEDSTLPGLLALEPSSEASGFAIGVETAAQQPVSINATVGTAFVLKEGITTINLQARLQKYAGEEVMPGEFSGSATVSFEYQ
>CP032449.1|AYB77536.1|975467_976265_+|MBL-fold-metallo-hydrolase
MALRIRVLLENHKGAGADKSLKARPGLSLLVEDESTSILFDTGPDGSFMQNALAMGIDLSDVSAVVLSHGHYDHCGGVPWLPDNSRIICHPDIARERYAAMTFLGITRKIKKLSCEVDYSRYRMMYTRDPLPIGKNFIWSGEIPVVAPEAYGIFGGHDAEPDSILDEGVLIYQSTKGLVIITGCGHRGIANIVRHCQNITGIKRIYALVGGFHLRCASPFTLWRVRRFLQEQKPEKLCGCHCTGAWGRLWLPEITAPATGDVLRF
>CP032449.1|AYB77537.1|976352_976715_-|6-carboxytetrahydropterin-synthase-QueD
MSTTLYKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIMDFADLKAAFKPTYDRLDHYYLNDIPGLSNPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCVYRGE
>CP032449.1|AYB81163.1|976643_976814_+|6-pyruvoyl-tetrahydrobiopterin-synthase
MPFRHVRQAVSGFKGEIFIQRGGHDELSGNKKTAVGYRKAHFLSLTKTILRLVTGN
>CP032449.1|AYB77538.1|977138_978938_+|NADPH-dependent-assimilatory-sulfite-reductase-flavoprotein-subunit
MTTPAPLTGLLPLNPEQLARLQAATTDLTPEQLAWVSGYFWGVLNPRSGVVAVTPVPERKMPGVTLISASQTGNARRVAEALRDDLLAANLNVTLVNAGDYKFKQIASEKLLVIVTSTQGEGEPPEEAVALHKFLFSKKAPKLENTAFAVFSLGDTSYEFFCQSGKDFDSKLAELGGERLLDRVDADVEYQAAASEWRARVVDVLKSRAPVAAPSQSVATGAVNDIHTSPYTKDAPLIATLSVNQKITGRNSEKDVRHIEIDLGDSGLRYQPGDALGVWYQNDPALVKELVELLWLKGDEPVTVDGKTLPLAEALEWHFELTVNTANIVENYATLTRSESLLPLVGDKAQLQHYAATTPIVDMVRFSPAQLDAEALIGLLRPLTPRLYSIASAQAEVESEVHVTVGVVRYDIEGRARAGGASSFLADRVEEEGEVRVFIEHNDNFRLPANPQTPVIMIGPGTGIAPFRAFMQQRAADGAEGKNWLFFGNPHFTEDFLYQVEWQRYVKEGVLNRIDLAWSRDQKEKIYVQDKLREQGAELWRWINDGAHIYVCGDARRMAADVEKALLEVIAEFGGMDLESADEYLSELRVERRYQRDVY
>CP032449.1|AYB77539.1|978937_980650_+|assimilatory-sulfite-reductase-(NADPH)-hemoprotein-subunit
MSEKHPGPLVVEGKLSDAERMKLESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTTQWQAIDKFAADNTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGLETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGIDNNWHLTLFIENGRILDYPGRPLKTGLLEIAKIHQGEFRITANQNLIIASVPESQKAKIETLARDHGLMNAVSAQRENSMACVSFPTCPLAMAEAERFLPSFTDKVEAILEKHGIPDEHIVMRVTGCPNGCGRAMLAEIGLVGKAPGRYNLHLGGNRIGTRIPRMYQENITEPDILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDFWE
>CP032449.1|AYB81164.1|980606_980825_-|hypothetical-protein
MVSANASTRSTFGSSFRAFRSSLDISSSRYTLPDGASLIRPTRAVGRIRHLCRHPAIQVIPRNHARDRAPGE
>CP032449.1|AYB77540.1|980751_981486_+|phosphoadenosine-phosphosulfate-reductase
MSKLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRAGESPAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELKAQTWFAGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
>CP032449.1|AYB81165.1|981573_982527_-|SPI-1-type-III-secretion-system-effector-SopD
MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMGGWDKVQDHFRAEKKDHALEVLHSIIHGQGRGEPGEMEVNVEDINKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIESMSREERQLFLQICEVIGAKMTWHPELLQESISTLRKEVTGNAQIKAAVYEMMRPAEAPDHPLVEWQDSLTEDEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHTYSPFAEFKPTNSGFLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILLT
>CP032449.1|AYB81166.1|982642_982849_-|hypothetical-protein
MFFRNIYPTNNYYKFFRLFLLEEALKEASSNAFCINQNLKKTTICGESSTFCLNYRHHKGLPTINVLY
>CP032449.1|AYB77541.1|985645_987202_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDNFSLLTTPWLPVRFKDGSTGKLAPVDLADENVVDIAATRADLQGAAWQFLLGLLQCSIAPKRYKNWEDIWFDGLHADVLHKALAPLEHAFQFGAESPSFMQDFEPLSGEKVSIASLLPEIPGAQTTKFNKDHFVKRGVTERFCPHCAALALFSLQLNAPAGGKGYRTGLRGGGPLTTLVELQEYQGERQTPIWRKLWLNVMPQDTADLPLPDQCDATVFPWLAATRTSEQANAVTTPEQVNKLQAYWGMPRRIRLDFATLQSGCCDICGAESDELLGFMTVKNYGVNYDGWRHPLTPYRAPVKDQNAFFSVKPQPGGLIWRDWLGLSQNNQTEANYESPAQVVKVFNARSLTDVKAGIRGFGADFDNMKIRCWYEHHFPLLMTEGLIPDLRKAVQTAARLLSLLRSALKEAWFTNAKDARGDFSFIDIDFWNLTQGRFLNLIHDLENGHKPDERLNKWQRELWLFTRCYFDDHVFTNPYESSDLERIMKARKKYFTSSAEKQSAKAAKAKKQEAAE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP032449_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032449_2

991527-991675

TypeI-E

I-E

Consensus_repeat	Method
GTGTTCCCCGCGCCAGCGGGGATAAAC	CRISPRCasFinder

2 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e

The CRISPR arrays of CP032449_2

>merge|CP032449|2|991527-991675|CRISPRCasFinder
GTGTTCCCCGCGCCAGCGGGGATAAACCGGCGTATCCCGAAATCACGTTCAAGAAAAATCCGTGTTCCCCGCGCCAGCGGGGATAAACCGGTTGGGTTGCATAGATGACACGCTTATAAATAGTGTTCCCCGCGTCAGCGGGGATAAAC

>CP032449|2|2|991527-991675|CRISPRCasFinder
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGGCGTATCCCGAAATCACGTTCAAGAAAAATCC
GTGTTCCCCGCGCCAGCGGGGATAAAC	CGGTTGGGTTGCATAGATGACACGCTTATAAATA
GTGTTCCCCGCGTCAGCGGGGATAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP032449.1\|AYB77547.1\|991136_991430_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
CP032449.1\|AYB77557.1\|999048_999810_+\|5'/3'-nucleotidase-SurE	unknown	unknown	gnl\|CDD\|234732
CP032449.1\|AYB77556.1\|998018_999068_+\|tRNA-pseudouridine(13)-synthase-TruD	unknown	unknown	gnl\|CDD\|234884
CP032449.1\|AYB77550.1\|993906_995346_+\|sulfate-adenylyltransferase	unknown	unknown	gnl\|CDD\|235349
CP032449.1\|AYB77544.1\|988841_989588_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
CP032449.1\|AYB77553.1\|996502_996814_+\|cell-division-protein-FtsB	unknown	unknown	gnl\|CDD\|179156
CP032449.1\|AYB81165.1\|981573_982527_-\|SPI-1-type-III-secretion-system-effector-SopD	unknown	unknown	gnl\|CDD\|185277
CP032449.1\|AYB81166.1\|982642_982849_-\|hypothetical-protein	unknown	unknown	unknown
CP032449.1\|AYB77548.1\|991691_992738_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|182299
CP032449.1\|AYB77552.1\|995955_996312_+\|DUF3561-family-protein	unknown	unknown	gnl\|CDD\|371891
CP032449.1\|AYB77554.1\|996832_997543_+\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|234670
CP032449.1\|AYB77545.1\|989569_990220_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|273869
CP032449.1\|AYB77541.1\|985645_987202_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09669_cas8e_CAS-I-E	gnl\|CDD\|274192
CP032449.1\|AYB77542.1\|987198_987759_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|187862
CP032449.1\|AYB77549.1\|992988_993897_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
CP032449.1\|AYB77551.1\|995332_995938_+\|adenylyl-sulfate-kinase	unknown	unknown	gnl\|CDD\|179661
CP032449.1\|AYB77555.1\|997542_998022_+\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	unknown	unknown	gnl\|CDD\|178851
CP032449.1\|AYB77546.1\|990216_991137_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
CP032449.1\|AYB77543.1\|987772_988831_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|273843
CP032449.1\|AYB77540.1\|980751_981486_+\|phosphoadenosine-phosphosulfate-reductase	unknown	unknown	gnl\|CDD\|234997

Protein	Function_ID	Function_description	E-value
CP032449.1\|AYB77547.1\|991136_991430_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	1.1867e-62
CP032449.1\|AYB77557.1\|999048_999810_+\|5'/3'-nucleotidase-SurE	gnl\|CDD\|234732	PRK00346, surE, 5'(3')-nucleotidase/polyphosphatase; Provisional.	1.7078e-146
CP032449.1\|AYB77556.1\|998018_999068_+\|tRNA-pseudouridine(13)-synthase-TruD	gnl\|CDD\|234884	PRK00984, truD, tRNA pseudouridine synthase D; Reviewed.	0
CP032449.1\|AYB77550.1\|993906_995346_+\|sulfate-adenylyltransferase	gnl\|CDD\|235349	PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional.	0
CP032449.1\|AYB77544.1\|988841_989588_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.80035e-48
CP032449.1\|AYB77553.1\|996502_996814_+\|cell-division-protein-FtsB	gnl\|CDD\|179156	PRK00888, ftsB, cell division protein FtsB; Reviewed.	1.08865e-64
CP032449.1\|AYB81165.1\|981573_982527_-\|SPI-1-type-III-secretion-system-effector-SopD	gnl\|CDD\|185277	PRK15379, PRK15379, type III secretion system effector SopD.	0
CP032449.1\|AYB77548.1\|991691_992738_-\|aminopeptidase	gnl\|CDD\|182299	PRK10199, PRK10199, alkaline phosphatase isozyme conversion aminopeptidase; Provisional.	0
CP032449.1\|AYB77552.1\|995955_996312_+\|DUF3561-family-protein	gnl\|CDD\|371891	pfam12084, DUF3561, Protein of unknown function (DUF3561). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are about 110 amino acids in length.	4.85353e-49
CP032449.1\|AYB77554.1\|996832_997543_+\|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase	gnl\|CDD\|234670	PRK00155, ispD, D-ribitol-5-phosphate cytidylyltransferase.	4.09575e-119
CP032449.1\|AYB77545.1\|989569_990220_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|273869	TIGR01907, CRISPR_system_Cascade_subunit_CasE, CRISPR-associated protein Cas6/Cse3/CasE, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1974 from Chlorobium tepidum, is found in the Ecoli subtype of CRISPR/Cas regions and is designated Cse3 (CRISPR/Cas Subtype Ecoli protein 3). The representative of this family from Thermus thermophilus HB8 (TTHB192) has been crystallized and found to have a structure consisting of two domains with opposing parallel beta-sheets known as a beta-sheet platform. This structure is similar to those found in the Sex-lethal protein and poly(A)-binding protein. This structure is consistent with an RNA-binding function.	4.46702e-75
CP032449.1\|AYB77541.1\|985645_987202_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	0
CP032449.1\|AYB77542.1\|987198_987759_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	9.5399e-34
CP032449.1\|AYB77549.1\|992988_993897_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP032449.1\|AYB77551.1\|995332_995938_+\|adenylyl-sulfate-kinase	gnl\|CDD\|179661	PRK03846, PRK03846, adenylylsulfate kinase; Provisional.	4.61291e-146
CP032449.1\|AYB77555.1\|997542_998022_+\|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase	gnl\|CDD\|178851	PRK00084, ispF, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; Reviewed.	3.84083e-103
CP032449.1\|AYB77546.1\|990216_991137_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	3.64033e-157
CP032449.1\|AYB77543.1\|987772_988831_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|273843	TIGR01869, CRISPR_system_Cascade_subunit_CasC, CRISPR-associated protein Cas7/Cse4/CasC, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum and is part of the Ecoli subtype of CRISPR/Cas locis. It is designated Cse4, for CRISPR/Cas Subtype Ecoli protein 4.	5.52672e-140
CP032449.1\|AYB77540.1\|980751_981486_+\|phosphoadenosine-phosphosulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	7.73232e-139

>CP032449.1|AYB77547.1|991136_991430_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSMVVVVTENVPPRLRGRLAVWLLEVRAGVYVGDTSKRIREMIWQQITQLGGVGNVVMAWATNTESGFEFQTWGENRRIPVDLDGLRLVSFLPVENQ
>CP032449.1|AYB77546.1|990216_991137_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MTFVPLNPIPLKDRTSMIFLQYGQIDVLDGAFVLIDKTGVRTHIPVGSVACIMLEPGTRVSHAAVHLASTVGTLLVWVGEAGVRVYSSGQPGGARADKLLYQAKLALDDDLRLKVVRKMYELRFREPPPARRSVEQLRGIEGSRVRATYALLAKQYGVKWHGRNYDPKDWEKGDVVNRCISAATSCLYGISEAAILAAGYAPAIGFIHSGKPLSFVYDIADIIKFESVVPKAFEIAARHPAEPDKEVRLACRDIFRSSKLTGKLIPLIEEVLAAGEIEPPQPAPDMLPPAIPEPESLGDSGHRGHG
>CP032449.1|AYB77545.1|989569_990220_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYLSRITLHTSELSPAQLLHLVERGEYVMHQWLWDLFPGSKERQFLYRREELQGAFRFFVLSQEQPAASAIFDVQTRPFAPTLSAGQTLRFNLRANPTVCKNGKRHDLLMEAKRQRKTQGDSQDIWSYQQQAALTWLARQGEQNGFTLRETSVDAYRQQQIRREKSRQMIQFSSVDYTGVLVLNDPVLFLQRLAQGYGKSRAFGCGMMMIKPGDDA
>CP032449.1|AYB77544.1|988841_989588_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MSQYLVFQLHGPMASWGVDAPGEVRHSHDLPSRSALLGLLAAALGIRRDEEERLNAFNRHYQFLLCASGNPRWARDYHTVQMPKEVRKARYFSRREELQDPELLSALISRRDYYTDAWWMIAVSATPDAPYSLAQLQASLQHPVFPLYLGRKSHPLALPLAPQLLDGRAPDVLREAYRWYQDQFNTLKLTLPRLQNECWWEGEHDGLTANKILRRRDMPLSRQQWLFGERSVNQGPWLRKEDACISQE
>CP032449.1|AYB77543.1|987772_988831_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTFIQLHLLTAYPAANLNRDDTGAPKTVVLGGATRLRISSQSLKRAWRTSELFEQALAGHIGIRTGRIAREAAQILVDSGIDAKKAVEYVEKIANCFGKVKAEKKPKDELTNAETEQLVHISPAEFEGVKALAHRLAEEKRAPKEEELALLRKDRMAVDIAMFGRMLANKPDFNVEAACQVAHAFGVSETIVEDDFFTAVDDLRQASAEDAGAGHLGETGFGSALFYTYICIDKDLLVKNLNGNEELANKTLRAFTEAALKVSPTGKQNSFASRAYASWALAEKGTDQPRSLAAAFYEPINGTDQLNVAVKRITALRENMNAVYAQETAFKDFNVMNQQGSMKDVLDFICA
>CP032449.1|AYB77542.1|987198_987759_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MSVVTKDDKATLRQWHDELQEKRGLRASLRRSKTVNDACLAEGLHSLLMQTHSLWKNKAPWNVTALAITAALAAHIKFIDEQKSFAAQLGQKKGGDTPVMSKLRFSHLLAVKTPDELLRQLRRAVKLLDGSVNLFSLADDIFCWCQEQNDLLNHHRRQQRPTEFLRIRWALEYYQAGDGDTDNEQD
>CP032449.1|AYB77541.1|985645_987202_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDNFSLLTTPWLPVRFKDGSTGKLAPVDLADENVVDIAATRADLQGAAWQFLLGLLQCSIAPKRYKNWEDIWFDGLHADVLHKALAPLEHAFQFGAESPSFMQDFEPLSGEKVSIASLLPEIPGAQTTKFNKDHFVKRGVTERFCPHCAALALFSLQLNAPAGGKGYRTGLRGGGPLTTLVELQEYQGERQTPIWRKLWLNVMPQDTADLPLPDQCDATVFPWLAATRTSEQANAVTTPEQVNKLQAYWGMPRRIRLDFATLQSGCCDICGAESDELLGFMTVKNYGVNYDGWRHPLTPYRAPVKDQNAFFSVKPQPGGLIWRDWLGLSQNNQTEANYESPAQVVKVFNARSLTDVKAGIRGFGADFDNMKIRCWYEHHFPLLMTEGLIPDLRKAVQTAARLLSLLRSALKEAWFTNAKDARGDFSFIDIDFWNLTQGRFLNLIHDLENGHKPDERLNKWQRELWLFTRCYFDDHVFTNPYESSDLERIMKARKKYFTSSAEKQSAKAAKAKKQEAAE
>CP032449.1|AYB81166.1|982642_982849_-|hypothetical-protein
MFFRNIYPTNNYYKFFRLFLLEEALKEASSNAFCINQNLKKTTICGESSTFCLNYRHHKGLPTINVLY
>CP032449.1|AYB81165.1|981573_982527_-|SPI-1-type-III-secretion-system-effector-SopD
MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMGGWDKVQDHFRAEKKDHALEVLHSIIHGQGRGEPGEMEVNVEDINKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIESMSREERQLFLQICEVIGAKMTWHPELLQESISTLRKEVTGNAQIKAAVYEMMRPAEAPDHPLVEWQDSLTEDEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHTYSPFAEFKPTNSGFLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILLT
>CP032449.1|AYB77540.1|980751_981486_+|phosphoadenosine-phosphosulfate-reductase
MSKLDLNALNELPKVDRVLALAETNAQLETLTAEERVAWALENLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYQFIDELTDKLKLNLKVYRAGESPAWQEARYGKLWEQGVEGIEKYNEINKVEPMNRALKELKAQTWFAGLRREQSGSRAHLPVLAIQRGVFKVLPIIDWDNRTVYQYLQKHGLKYHPLWDQGYLSVGDTHTTRKWEPGMAEEETRFFGLKRECGLHEG
>CP032449.1|AYB77548.1|991691_992738_-|aminopeptidase
MFSATRRFAVILALGVGFILPAQAASPGPGEIANTQARHIATFFPGRMTGSPAEMLSADYLRQQFTQMGYQSDIRTFNSRFIYTTKDNRKNWHNVTGSTVIAAHEGRVPQQIIIMAHLDTYAPQSDADVDANLGGLTLQGMDDNAAGLGVMLELAARLKDIPTHYGIRFIATSGEEEGKLGAENLLKRMSDAEKKNTLLVINLDNLIVGDKLYFNSGKNTPEAVRTLTRDRALAIARRYGIAANTNPGRNPSYPKGTGCCNDAEVFDKAGISVLSVEATNWNLGKKDGYQQRVKNASFPNGNSWHDVRLDNQQHIDKALPGRIERRSRDVVRIMLPLVKELAKAEKTS
>CP032449.1|AYB77549.1|992988_993897_+|sulfate-adenylyltransferase-subunit-CysD
MDQKRLTHLRQLEAESIHIIREVAAEFANPVMLYSIGKDSSVMLHLERKAFYPGTLPFPLLHVDTGWKFREMYAFRDRTANAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLKQALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWRNYNGQINKGESIRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMVDDDRIDLQPGEVIKKRMVRFRTLGCWPLTGAVESHAQTLPEIIEEMLVSTTSERQGRMIDRDQAGSMELKKRQGYF
>CP032449.1|AYB77550.1|993906_995346_+|sulfate-adenylyltransferase
MNTILAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTLQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYREETFARIREDYLTFAEQLPGDLDIRFVPLSALEGDNVAAQSANMRWYSGPTLLEVLETVDIQRAVDRQPMRFPVQYVNRPNLDFRGYAGTLASGSVKVGERIKVLPSGVESSVARIVTFDGDKEEACAGEAITLVLNDDIDISRGDLLLAANETLAPARHAAIDVVWMAEQPLAPGQSYDVKLAGKKTRARIEAIRYQIDINNLTQRDVESLPLNGIGLVEMTFDEPLALDIYQQNPVTGGLIFIDRLSNVTVGAGMVRELDERGATPPVEYSAFELELNALVRRHFPHWDARDLLGDKHGAA
>CP032449.1|AYB77551.1|995332_995938_+|adenylyl-sulfate-kinase
MALHDENVVWHSHPVTVAAREQLHGHRGVVLWFTGLSGSGKSTVAGALEEALHQRGVSTYLLDGDNVRHGLCRDLGFSDADRQENIRRVGEVASLMADAGLIVLTAFISPHRAERQLVKERVGHDRFIEIYVNTPLAICEQRDPKGLYKKARAGELRNFTGIDAIYEAPDSPQVHLNGEQLVTNLVSQLLDLLRRRDIIRS
>CP032449.1|AYB77552.1|995955_996312_+|DUF3561-family-protein
MPGMVKVTGFNMRNSHNITFTRSDAFMVDDDATSAFPGAVVGFVSWLLALGIPFLLYGPNTLFFFLYTWPFFLALMPVSVIIGIALHLLVKGKILFSIMFTLLAVGALFGALFIWLLG
>CP032449.1|AYB77553.1|996502_996814_+|cell-division-protein-FtsB
MGKLTLLLLALLVWLQYSLWFGKNGIHDYSRVNDDVVAQQATNAKLKARNDQLFAEIDDLNGGQEAIEERARNELSMTKPGETFYRLVPDASKRAATAGQTHR
>CP032449.1|AYB77554.1|996832_997543_+|2-C-methyl-D-erythritol-4-phosphate-cytidylyltransferase
MAATLLDVCAVVPAAGFGRRMQTECPKQYLSIGNKTILEHSVHALLAHPRVTRVVIAISPGDHRFAQLPLANHPQITVVDGGNERADSVLAGLQAVAKAQWVLVHDAARPCLHQDDLARLLTISENSRVGGILASPVRDTMKRGEPGKNAIAHTVERADLWHALTPQFFPRELLHDCLTRALNEGATITDEASALEYCGFHPALVEGRADNIKVTRPEDLALAEFYLTRTIHQEKA
>CP032449.1|AYB77555.1|997542_998022_+|2-C-methyl-D-erythritol-2,4-cyclodiphosphate-synthase
MRIGHGFDVHAFGGEGPIIIGGVRISYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK
>CP032449.1|AYB77556.1|998018_999068_+|tRNA-pseudouridine(13)-synthase-TruD
MTEFDNLTWLHGKPQGSGLLKANPEDFVVVEDLGFTPDGEGEHILLRILKNGCNTRFVADALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDFSAFQLEGCKVLEYARHKRKLRLGALKGNAFTLVLREISDRRDVETRLQAIRDGGVPNYFGAQRFGIGGSNLQGALRWAQSNAPVRDRNKRSFWLSAARSALFNQIVHQRLKKPDFNQVVDGDALQLAGRGSWFVATSEELPELQRRVDEKELMITASLPGSGEWGTQRAALAFEQDAIAQETVLQSLLLREKVEASRRAMLLYPQQLSWNWWDDVTVELRFWLPAGSFATSVVRELINTMGDYAHIAE
>CP032449.1|AYB77557.1|999048_999810_+|5'/3'-nucleotidase-SurE
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGDIAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPALAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTRCGSRHPADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVVSDWLDSVGVGTQW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1152815 : 1218588

Salmonella_phage(87.8%)

tail,capsid,plate,portal,integrase,transposase,head,tRNA,lysis

attL 1155852:1155867|attR 1169119:1169134

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB77711.1\|1152815_1153926_+\|transposase	IS3-like element IS1351 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	7.6e-07	25.6
AYB77712.1\|1154722_1155526_-	DUF3800 domain-containing protein	Q19UP3	Mannheimia_phage	1.2e-62	44.7
1155852:1155867	attL	NA	NA	NA	NA
AYB77713.1\|1155924_1156518_-	hypothetical protein	NA	NA	NA	NA
AYB77714.1\|1156777_1157803_-\|integrase	site-specific integrase	A0A1S6L016	Salmonella_phage	9.2e-201	99.1
AYB77715.1\|1157806_1158439_-	phage repressor protein	A0A1S6KZZ7	Salmonella_phage	1.1e-66	58.6
AYB77716.1\|1158555_1158795_+	Rha family transcriptional regulator	A0A1S6KZZ6	Salmonella_phage	8.8e-38	98.7
AYB77717.1\|1159348_1159582_+	DUF2724 domain-containing protein	E5G6L4	Salmonella_phage	3.6e-12	59.1
AYB77718.1\|1159529_1159988_-	hypothetical protein	NA	NA	NA	NA
AYB77719.1\|1160207_1160549_+	hypothetical protein	E5G6L5	Salmonella_phage	4.2e-49	85.0
AYB77720.1\|1160616_1160850_+	DUF2732 domain-containing protein	A0A1S6L021	Salmonella_phage	2.0e-26	84.4
AYB77721.1\|1160849_1161077_+	TraR/DksA family transcriptional regulator	A0A1S6L007	Salmonella_phage	1.3e-35	93.3
AYB77722.1\|1161073_1161931_+	DNA adenine methylase	E5G6L8	Salmonella_phage	1.5e-164	99.6
AYB77723.1\|1161927_1164324_+	replication endonuclease	E5G6L9	Salmonella_phage	0.0e+00	93.9
AYB77724.1\|1164479_1164668_+	hypothetical protein	A0A1S6L006	Salmonella_phage	2.7e-26	100.0
AYB77725.1\|1164736_1165036_-	hypothetical protein	NA	NA	NA	NA
AYB77726.1\|1165146_1165953_-	hypothetical protein	A0A2H4J8D6	uncultured_Caudovirales_phage	6.2e-51	49.8
AYB77727.1\|1166445_1167600_+	DUF262 domain-containing protein	NA	NA	NA	NA
AYB77728.1\|1168379_1169411_-\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	5.0e-170	87.0
1169119:1169134	attR	NA	NA	NA	NA
AYB77729.1\|1169410_1171177_-	oxidoreductase	A0A1S6KZW3	Salmonella_phage	0.0e+00	99.3
AYB77730.1\|1171319_1172153_+\|capsid	capsid protein	A0A1S6KZW9	Salmonella_phage	5.9e-121	84.5
AYB77731.1\|1172169_1173228_+\|capsid	phage major capsid protein, P2 family	E5G6M6	Salmonella_phage	4.9e-181	93.1
AYB77732.1\|1173231_1173882_+	hypothetical protein	E5G6M7	Salmonella_phage	8.7e-112	96.3
AYB77733.1\|1173977_1174442_+\|head	head completion/stabilization protein	A0A1S6KZW8	Salmonella_phage	4.2e-76	89.0
AYB77734.1\|1174441_1174645_+\|tail	phage tail protein	E5G6M9	Salmonella_phage	1.4e-31	92.5
AYB77735.1\|1174648_1174864_+	hypothetical protein	E5G6N0	Salmonella_phage	1.8e-26	80.3
AYB81170.1\|1174883_1175357_+	lysozyme	E5G6N1	Salmonella_phage	3.7e-80	91.0
AYB77736.1\|1175358_1175736_+	hypothetical protein	A0A1S6KZZ2	Salmonella_phage	5.1e-16	39.2
AYB77737.1\|1175732_1176161_+\|lysis	LysB family phage lysis regulatory protein	E5G6N2	Salmonella_phage	1.3e-47	76.1
AYB77738.1\|1176090_1176294_+	hypothetical protein	A0A1S6KZX6	Salmonella_phage	8.9e-23	73.1
AYB77739.1\|1176256_1176688_+\|tail	phage tail protein	E5G6N3	Salmonella_phage	1.3e-71	93.7
AYB77740.1\|1176680_1177127_+	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	3.1e-60	81.1
AYB77741.1\|1177153_1178020_-	hypothetical protein	NA	NA	NA	NA
AYB77742.1\|1178115_1178694_+\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	1.8e-92	86.5
AYB77743.1\|1178690_1179050_+\|plate	baseplate assembly protein	A0A1S6KZZ4	Salmonella_phage	3.5e-54	91.5
AYB77744.1\|1179036_1179945_+\|plate	baseplate assembly protein	A0A1S6KZY6	Salmonella_phage	7.2e-157	98.0
AYB77745.1\|1179937_1180543_+\|tail	phage tail protein I	E5G6N9	Salmonella_phage	1.3e-117	100.0
AYB77746.1\|1180539_1182225_+\|tail	phage tail protein	A0A1S6KZZ8	Salmonella_phage	3.5e-128	50.6
AYB77747.1\|1182227_1182755_+\|tail	tail fiber assembly protein	NA	NA	NA	NA
AYB77748.1\|1182885_1184058_+\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	1.3e-222	99.5
AYB77749.1\|1184067_1184583_+\|tail	phage major tail tube protein	E5G6P8	Salmonella_phage	2.7e-92	99.4
AYB77750.1\|1184637_1184940_+\|tail	phage tail assembly protein	A0A1S6KZZ9	Salmonella_phage	9.4e-45	99.0
AYB77751.1\|1184954_1185074_+\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	8.8e-15	97.4
AYB77752.1\|1185066_1187874_+\|tail	phage tail tape measure protein	E5G6Q1	Salmonella_phage	0.0e+00	99.0
AYB77753.1\|1187870_1188356_+\|tail	phage tail protein	E5G6Q2	Salmonella_phage	8.3e-67	99.2
AYB77754.1\|1188352_1189453_+	phage late control D family protein	A0A1S6KZZ5	Salmonella_phage	9.0e-194	98.6
AYB81171.1\|1189521_1189740_+	levansucrase regulator	Q53ZE7	Salmonella_virus	2.1e-38	100.0
AYB81172.1\|1190291_1191455_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
AYB77755.1\|1193634_1195044_-	type I secretion protein TolC	NA	NA	NA	NA
AYB77756.1\|1195108_1206328_-	biofilm-associated protein BapA	NA	NA	NA	NA
AYB81173.1\|1206942_1207425_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.2e-29	47.4
AYB77757.1\|1207574_1208051_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
AYB77758.1\|1208040_1208331_+	RnfH family protein	NA	NA	NA	NA
AYB77759.1\|1208496_1208835_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
AYB77760.1\|1208983_1210645_-	DNA repair protein RecN	NA	NA	NA	NA
AYB81175.1\|1210730_1211609_-	NAD(+) kinase	NA	NA	NA	NA
AYB81174.1\|1211732_1212323_+	nucleotide exchange factor GrpE	NA	NA	NA	NA
AYB77761.1\|1212357_1212963_-	cytoplasmic protein	NA	NA	NA	NA
AYB77762.1\|1213083_1214325_-	DUF21 domain-containing protein	NA	NA	NA	NA
AYB77763.1\|1214389_1215181_-	inner membrane protein YpjD	NA	NA	NA	NA
AYB77764.1\|1215126_1215423_-	hypothetical protein	NA	NA	NA	NA
AYB77765.1\|1215346_1216708_+	signal recognition particle protein	NA	NA	NA	NA
AYB77766.1\|1216960_1217209_+	30S ribosomal protein S16	NA	NA	NA	NA
AYB77767.1\|1217227_1217776_+	ribosome maturation factor RimM	NA	NA	NA	NA
AYB77768.1\|1217820_1218588_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA

DBSCAN-SWA_2

1455983 : 1555035

103

Salmonella_phage(20.83%)

tail,protease,integrase,transposase,head,tRNA

attL 1500752:1500766|attR 1508366:1508380

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB77962.1\|1455983_1457399_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AYB77963.1\|1457452_1457845_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AYB77964.1\|1457846_1458209_-	hypothetical protein	NA	NA	NA	NA
AYB77965.1\|1458228_1458429_+	hypothetical protein	NA	NA	NA	NA
AYB77966.1\|1458814_1461004_+	sensor domain-containing phosphodiesterase	NA	NA	NA	NA
AYB77967.1\|1461056_1462259_-	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AYB77968.1\|1462601_1463843_+	divalent metal cation transporter	NA	NA	NA	NA
AYB77969.1\|1463903_1464230_-	DUF2502 domain-containing protein	NA	NA	NA	NA
AYB77970.1\|1464343_1465342_-	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
AYB77971.1\|1467194_1468430_-	ion channel protein	NA	NA	NA	NA
AYB77972.1\|1468633_1469599_+	glucokinase	NA	NA	NA	NA
AYB77973.1\|1470321_1471560_+	alanine transaminase	NA	NA	NA	NA
AYB81182.1\|1471609_1471681_-	membrane protein YpdK	NA	NA	NA	NA
AYB77974.1\|1472083_1473004_-	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	1.1e-75	53.5
AYB77975.1\|1473525_1473768_+	DUF2545 family protein	NA	NA	NA	NA
AYB77976.1\|1474042_1475434_-	phosphoglycerate transporter PgtP	NA	NA	NA	NA
AYB77977.1\|1475607_1475826_+	hypothetical protein	NA	NA	NA	NA
AYB77978.1\|1475869_1477063_+	phosphoglycerate transport regulator PgtC	NA	NA	NA	NA
AYB77979.1\|1477059_1479066_+	two-component system sensor histidine kinase PgtB	NA	NA	NA	NA
AYB77980.1\|1479055_1480303_+	two-component system response regulator PgtA	NA	NA	NA	NA
AYB77981.1\|1480570_1481509_+\|protease	omptin family outer membrane protease PgtE	NA	NA	NA	NA
AYB77982.1\|1481694_1481925_+	hypothetical protein	A0A1R3Y5S2	Salmonella_virus	5.4e-08	68.6
AYB77983.1\|1481863_1482007_+	hypothetical protein	A0A1R3Y5S2	Salmonella_virus	1.7e-12	82.9
AYB77984.1\|1482996_1484919_-	acyltransferase	A0A1R3Y5Q6	Salmonella_virus	8.1e-299	76.9
AYB77985.1\|1484936_1485191_-	glycosyltransferase	A8CG95	Salmonella_phage	3.1e-25	79.5
AYB81183.1\|1485159_1485549_-	GtrA family protein	A0A192Y6N5	Salmonella_phage	1.1e-50	85.6
AYB81184.1\|1486377_1486956_+	hypothetical protein	NA	NA	NA	NA
AYB77986.1\|1487594_1488035_-	hypothetical protein	NA	NA	NA	NA
AYB77987.1\|1488006_1492260_-	RHS repeat protein	A0A2H4JHK7	uncultured_Caudovirales_phage	1.1e-18	47.6
AYB81185.1\|1492214_1492418_+	hypothetical protein	NA	NA	NA	NA
AYB77988.1\|1492392_1493118_-	hypothetical protein	NA	NA	NA	NA
AYB77989.1\|1493231_1493633_-	hypothetical protein	NA	NA	NA	NA
AYB77990.1\|1494248_1495253_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AYB77991.1\|1495352_1495787_-	mercuric resistance operon regulatory protein	NA	NA	NA	NA
AYB77992.1\|1495858_1496209_+	mercuric transporter	NA	NA	NA	NA
AYB77993.1\|1496224_1496500_+	mercuric transporter periplasmic component	NA	NA	NA	NA
AYB77994.1\|1496571_1498257_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.1e-38	27.9
AYB77995.1\|1498271_1498910_+	organomercurial lyase MerB	NA	NA	NA	NA
AYB77996.1\|1499021_1499387_+	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
AYB77997.1\|1499383_1499620_+	mercury resistance protein	NA	NA	NA	NA
AYB77998.1\|1499616_1500606_+	DUF3330 domain-containing protein	NA	NA	NA	NA
1500752:1500766	attL	NA	NA	NA	NA
AYB77999.1\|1500815_1501520_+\|transposase	IS6 family transposase IS15DI	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AYB78000.1\|1501559_1502396_+	TEM family class A beta-lactamase	Q1MVP3	Enterobacteria_phage	9.0e-154	100.0
AYB78001.1\|1503071_1503434_+	transcriptional regulator	NA	NA	NA	NA
AYB78002.1\|1503430_1503667_+	mercury resistance protein	NA	NA	NA	NA
AYB78003.1\|1503663_1504371_+	EAL domain-containing protein	NA	NA	NA	NA
AYB78004.1\|1504409_1505714_+\|integrase	integrase	NA	NA	NA	NA
AYB78005.1\|1505760_1506465_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AYB78006.1\|1506654_1507470_-	aminoglycoside O-phosphotransferase APH(3')-Ia	A0A193DTG4	Autographa_californica_nuclear_polyhedrosis_virus	6.1e-163	100.0
AYB78007.1\|1507622_1508327_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AYB78008.1\|1508947_1510093_-	class C beta-lactamase CMY-2	NA	NA	NA	NA
1508366:1508380	attR	NA	NA	NA	NA
AYB78009.1\|1510416_1511679_-\|transposase	IS1380 family transposase ISEc9	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
AYB78010.1\|1511963_1512356_-	conjugal transfer protein TraA	NA	NA	NA	NA
AYB78011.1\|1512359_1512938_-	type IV conjugative transfer system protein TraV	NA	NA	NA	NA
AYB78012.1\|1512934_1514251_-	conjugal transfer protein TraB	NA	NA	NA	NA
AYB78013.1\|1514247_1515165_-	conjugal transfer protein TraK	NA	NA	NA	NA
AYB78014.1\|1515148_1515775_-	pilus assembly protein	NA	NA	NA	NA
AYB78015.1\|1515771_1516053_-	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
AYB78016.1\|1516197_1516575_-	hypothetical protein	NA	NA	NA	NA
AYB78017.1\|1516898_1517561_-	hypothetical protein	NA	NA	NA	NA
AYB78018.1\|1517560_1517938_-	hypothetical protein	NA	NA	NA	NA
AYB78019.1\|1517947_1518394_-	hypothetical protein	NA	NA	NA	NA
AYB78020.1\|1518403_1519033_-	DUF4400 domain-containing protein	NA	NA	NA	NA
AYB78021.1\|1518989_1519574_-	hypothetical protein	NA	NA	NA	NA
AYB78022.1\|1519584_1521450_-	DUF87 domain-containing protein	NA	NA	NA	NA
AYB78023.1\|1521446_1524419_-	conjugal transfer protein TraI	NA	NA	NA	NA
AYB78024.1\|1524586_1525204_+	hypothetical protein	NA	NA	NA	NA
AYB78025.1\|1525185_1525419_+	hypothetical protein	NA	NA	NA	NA
AYB78026.1\|1525418_1527611_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	9.9e-43	29.4
AYB78027.1\|1527625_1528114_+	hypothetical protein	NA	NA	NA	NA
AYB78028.1\|1528204_1528504_-	ASCH domain-containing protein	A0A0K1LLW2	Caulobacter_phage	3.6e-20	55.4
AYB78029.1\|1528508_1528715_-	hypothetical protein	NA	NA	NA	NA
AYB78030.1\|1528715_1529333_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
AYB78031.1\|1529388_1530045_-	hypothetical protein	NA	NA	NA	NA
AYB78032.1\|1530044_1531472_-	DNA cytosine methyltransferase	NA	NA	NA	NA
AYB78033.1\|1531475_1531976_-	hypothetical protein	I3UMJ0	Colwellia_phage	9.5e-18	38.4
AYB78034.1\|1531984_1532317_-	hypothetical protein	NA	NA	NA	NA
AYB81186.1\|1532301_1532733_-	hypothetical protein	NA	NA	NA	NA
AYB78035.1\|1532800_1533475_-	thymidylate kinase	NA	NA	NA	NA
AYB78036.1\|1533449_1533731_-	hypothetical protein	NA	NA	NA	NA
AYB78037.1\|1533723_1534101_-	hypothetical protein	A0A2H4P7P5	Pseudomonas_phage	1.7e-22	49.6
AYB78038.1\|1534662_1535298_+	restriction endonuclease subunit M	NA	NA	NA	NA
AYB78039.1\|1535350_1535623_-	hypothetical protein	NA	NA	NA	NA
AYB78040.1\|1535671_1536853_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
AYB78041.1\|1536856_1537642_-	ParA family protein	A0A1X9IGI7	Lactococcus_phage	6.1e-11	26.4
AYB78042.1\|1537815_1538127_-	hypothetical protein	NA	NA	NA	NA
AYB78043.1\|1538433_1539249_+	sulfonamide-resistant dihydropteroate synthase Sul2	NA	NA	NA	NA
AYB78044.1\|1539309_1540113_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	Q75ZG1	Hepacivirus	4.9e-24	34.3
AYB78045.1\|1540112_1540949_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AYB78046.1\|1541254_1541497_+	relaxase	NA	NA	NA	NA
AYB78047.1\|1541528_1542206_-	TetR family transcriptional regulator	NA	NA	NA	NA
AYB78048.1\|1542284_1543484_+	tetracycline efflux MFS transporter Tet(A)	NA	NA	NA	NA
AYB78049.1\|1543750_1544056_-	LysR family transcriptional regulator	NA	NA	NA	NA
AYB78050.1\|1544083_1545298_-	chloramphenicol/florfenicol efflux MFS transporter FloR	S4TR35	Salmonella_phage	5.5e-19	28.7
AYB78051.1\|1545514_1546399_-	DUF3363 domain-containing protein	NA	NA	NA	NA
AYB78052.1\|1546429_1547923_-\|transposase	IS91 family transposase	NA	NA	NA	NA
AYB78053.1\|1548133_1548358_-	hypothetical protein	NA	NA	NA	NA
AYB78054.1\|1548354_1549092_-	resolvase	NA	NA	NA	NA
AYB78055.1\|1549198_1549690_+	hypothetical protein	NA	NA	NA	NA
AYB78056.1\|1549723_1550428_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AYB78057.1\|1550978_1551683_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AYB78058.1\|1552303_1553449_-	class C beta-lactamase CMY-2	NA	NA	NA	NA
AYB78059.1\|1553772_1555035_-\|transposase	IS1380 family transposase ISEc9	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0

DBSCAN-SWA_3

1792805 : 1801976

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB78275.1\|1792805_1793753_+	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	3.7e-10	27.8
AYB78276.1\|1793736_1794468_+	ABC transporter permease	NA	NA	NA	NA
AYB78277.1\|1794448_1794556_-	protein YohO	NA	NA	NA	NA
AYB78278.1\|1794615_1795347_-	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	2.2e-100	87.4
AYB78279.1\|1795569_1797255_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.4e-278	91.1
AYB78280.1\|1797251_1797971_+	DNA-binding response regulator	NA	NA	NA	NA
AYB78281.1\|1798017_1798485_+	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	8.8e-74	89.7
AYB78282.1\|1798541_1799072_-	DUF1307 domain-containing protein	NA	NA	NA	NA
AYB78283.1\|1799243_1799702_-	DUF1307 domain-containing protein	Q9EYF5	Enterobacteria_phage	7.1e-52	71.2
AYB78284.1\|1799942_1801976_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	2.1e-55	26.9

DBSCAN-SWA_4

1869172 : 1879679

Enterobacteria_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB78335.1\|1869172_1870576_+	colanic acid biosynthesis protein WcaM	A0A291LBB9	Klebsiella_phage	4.0e-21	26.5
AYB78336.1\|1870753_1871647_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	4.8e-44	42.2
AYB78337.1\|1872023_1873109_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-102	53.9
AYB78338.1\|1873108_1874008_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	5.1e-30	36.0
AYB81197.1\|1874055_1874934_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.1e-108	65.5
AYB78339.1\|1874934_1875486_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.3e-52	58.0
AYB78340.1\|1875491_1876466_+	CDP-6-deoxy-delta-3,4-glucoseen reductase	NA	NA	NA	NA
AYB78341.1\|1876481_1877255_+	glucose-1-phosphate cytidylyltransferase	NA	NA	NA	NA
AYB78342.1\|1877259_1878339_+	CDP-glucose 4,6-dehydratase	A0A222YY99	Synechococcus_phage	1.3e-16	24.5
AYB78343.1\|1878365_1879679_+	LPS biosynthesis protein	H8ZJ36	Ostreococcus_tauri_virus	7.0e-52	35.1

DBSCAN-SWA_5

1992606 : 2038816

Salmonella_phage(84.91%)

tail,capsid,plate,holin,integrase,transposase,head,terminase

attL 1990578:1990592|attR 2010898:2010912

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1990578:1990592	attL	NA	NA	NA	NA
AYB81204.1\|1992606_1993881_-	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	8.2e-74	40.1
AYB78453.1\|1994236_1995034_-	protein MtfA	NA	NA	NA	NA
AYB78454.1\|1995325_1996315_-\|integrase	integrase	A0A192Y7M7	Salmonella_phage	8.6e-196	100.0
AYB78455.1\|1996316_1996559_-	DUF4224 domain-containing protein	Q8HAA9	Salmonella_phage	2.1e-39	98.8
AYB78456.1\|1996583_1997153_-	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	5.8e-104	91.0
AYB78457.1\|1997149_1997899_-	hypothetical protein	H6WRY2	Salmonella_phage	1.1e-46	83.6
AYB78458.1\|1997902_1998376_-	class I SAM-dependent methyltransferase	H9C170	Pectobacterium_phage	5.0e-69	80.3
AYB78459.1\|1998375_1999113_-	ead/Ea22-like family protein	A0A0M5M1J9	Salmonella_phage	1.8e-52	86.3
AYB78460.1\|1999183_1999723_-	HD family hydrolase	A0A192Y8M4	Salmonella_phage	2.6e-98	100.0
AYB78461.1\|1999859_2000687_-	DUF2303 family protein	Q8HAA2	Salmonella_phage	1.0e-149	97.5
AYB78462.1\|2000744_2001116_-	hypothetical protein	Q8HAA1	Salmonella_phage	1.1e-63	100.0
AYB78463.1\|2001652_2001898_+	hypothetical protein	NA	NA	NA	NA
AYB78464.1\|2001815_2002112_-	hypothetical protein	Q8SBF7	Shigella_phage	1.1e-50	98.0
AYB78465.1\|2002092_2002344_-	hypothetical protein	NA	NA	NA	NA
AYB78466.1\|2002271_2002457_-	hypothetical protein	A0A1C9II97	Salmonella_phage	1.2e-13	73.3
AYB78467.1\|2002661_2003357_-	helix-turn-helix transcriptional regulator	Q8HAA0	Salmonella_phage	4.6e-127	99.6
AYB78468.1\|2003330_2003516_+	amino acid permease	NA	NA	NA	NA
AYB78469.1\|2003454_2003679_+	XRE family transcriptional regulator	A0A1C9IHV8	Salmonella_phage	1.9e-34	100.0
AYB78470.1\|2003707_2004262_+	hypothetical protein	A0A1C9II13	Salmonella_phage	5.9e-101	99.5
AYB78471.1\|2004258_2005401_+	peptidase	A0A1C9IHV9	Salmonella_phage	1.6e-182	87.6
AYB78472.1\|2005397_2005622_+	hypothetical protein	A0A1C9II64	Salmonella_phage	3.3e-39	100.0
AYB78473.1\|2005618_2006593_+	hypothetical protein	A0A1C9IHW0	Salmonella_phage	1.2e-165	98.1
AYB78474.1\|2006589_2007063_+	PerC family transcriptional regulator	A0A1C9IHW0	Salmonella_phage	6.6e-53	93.8
AYB78475.1\|2007059_2007941_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	1.1e-170	99.3
AYB78476.1\|2007949_2008339_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	4.9e-70	100.0
AYB78477.1\|2008310_2009216_+	KilA-N domain-containing protein	Q8HA92	Salmonella_phage	2.8e-161	99.0
AYB81205.1\|2009223_2010213_+	DUF968 domain-containing protein	A0A1C9IHZ5	Salmonella_phage	3.0e-188	97.0
AYB78478.1\|2010226_2010979_+	antitermination protein	A0A192Y5X6	Salmonella_phage	2.4e-134	92.0
2010898:2010912	attR	NA	NA	NA	NA
AYB78479.1\|2011010_2011199_+	hypothetical protein	NA	NA	NA	NA
AYB78480.1\|2011267_2011510_+	hypothetical protein	NA	NA	NA	NA
AYB78481.1\|2011641_2011995_+\|holin	phage holin, lambda family	Q8SBE1	Shigella_phage	1.0e-50	88.7
AYB78482.1\|2011998_2012475_+	lysozyme	Q8SBE0	Shigella_phage	1.7e-85	96.8
AYB78483.1\|2012458_2012851_+	DUF2570 domain-containing protein	Q8SBD9	Shigella_phage	1.6e-57	92.3
AYB78484.1\|2012735_2013008_+	peptidase	Q8SBD8	Shigella_phage	3.8e-29	77.6
AYB78485.1\|2013376_2013811_+	hypothetical protein	NA	NA	NA	NA
AYB78486.1\|2013938_2014289_+	HNH endonuclease	M1FQV2	Enterobacteria_phage	8.0e-64	97.4
AYB78487.1\|2014406_2014910_+\|terminase	phage terminase small subunit P27 family	Q8HAD7	Salmonella_phage	3.6e-89	100.0
AYB78488.1\|2014906_2016640_+\|terminase	terminase large subunit	Q8HAD6	Salmonella_phage	0.0e+00	99.8
AYB78489.1\|2016651_2016834_+	hypothetical protein	Q8HAD5	Salmonella_phage	1.0e-25	100.0
AYB78490.1\|2018716_2019922_+\|capsid	phage major capsid protein	Q8HAD2	Salmonella_phage	1.6e-223	100.0
AYB78491.1\|2019972_2020173_+	hypothetical protein	Q8HAD1	Salmonella_phage	1.4e-28	100.0
AYB78492.1\|2020175_2020499_+\|head,tail	phage gp6-like head-tail connector protein	A0A192Y8J4	Salmonella_phage	6.3e-55	100.0
AYB78493.1\|2020495_2020900_+\|head,tail	head-tail adaptor protein	A0A192Y6C2	Salmonella_phage	5.4e-72	99.3
AYB78494.1\|2020871_2021384_+	hypothetical protein	Q8HAC8	Salmonella_phage	4.6e-92	100.0
AYB78495.1\|2021380_2021941_+	hypothetical protein	Q8HAC7	Salmonella_phage	8.8e-105	99.5
AYB78496.1\|2021944_2022109_+	DUF2635 domain-containing protein	Q8HAC6	Salmonella_phage	1.0e-24	100.0
AYB78497.1\|2022098_2023595_+\|tail	phage tail protein	Q8HAC5	Salmonella_phage	6.1e-278	99.8
AYB78498.1\|2023594_2023951_+\|tail	phage tail protein	A0A192Y8K0	Salmonella_phage	2.6e-62	100.0
AYB78499.1\|2023947_2024274_+\|tail	phage tail assembly protein	Q8HAC3	Salmonella_phage	2.3e-52	99.1
AYB78500.1\|2024358_2026287_+\|tail	phage tail tape measure protein	Q8HAC2	Salmonella_phage	0.0e+00	99.7
AYB78501.1\|2026320_2027661_+	DNA circularization protein	A0A192Y5U9	Salmonella_phage	5.7e-251	99.6
AYB78502.1\|2027657_2028722_+\|plate	baseplate protein	Q8HAC0	Salmonella_phage	4.2e-188	95.1
AYB78503.1\|2028714_2029248_+\|plate	phage baseplate assembly protein V	Q8HAB9	Salmonella_phage	1.4e-96	100.0
AYB78504.1\|2029252_2029666_+	hypothetical protein	Q8HAB8	Salmonella_phage	1.1e-75	100.0
AYB78505.1\|2029658_2030738_+\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	2.5e-204	99.7
AYB78506.1\|2030740_2031328_+	DUF2313 domain-containing protein	A0A192Y5V3	Salmonella_phage	2.9e-114	100.0
AYB78507.1\|2031314_2032877_+\|tail	phage tail protein	Q8HAB4	Salmonella_phage	2.6e-287	100.0
AYB78508.1\|2032876_2033446_+\|tail	tail fiber assembly protein	Q8HAB3	Salmonella_phage	7.3e-107	100.0
AYB78509.1\|2033730_2034738_-	type III secretion system effector arginine glycosyltransferase	Q8HAB2	Salmonella_phage	7.9e-197	100.0
AYB78510.1\|2034949_2035171_+	DNA-binding protein	Q8HAB1	Salmonella_phage	1.2e-36	100.0
AYB78511.1\|2035534_2035717_+	hypothetical protein	NA	NA	NA	NA
AYB78512.1\|2036109_2036487_+	hypothetical protein	NA	NA	NA	NA
AYB78513.1\|2036513_2037332_+	hypothetical protein	NA	NA	NA	NA
AYB78514.1\|2037793_2038816_+\|transposase	IS110-like element ISSaen1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2731009 : 2829543

108

Enterobacteria_phage(24.0%)

tail,protease,holin,portal,integrase,terminase,tRNA,lysis

attL 2760792:2760807|attR 2829544:2829708

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB79179.1\|2731009_2731705_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AYB79180.1\|2731762_2733673_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	4.5e-92	32.7
AYB79181.1\|2733803_2734148_+	RidA family protein	NA	NA	NA	NA
AYB79182.1\|2734153_2734333_-	YoaH family protein	NA	NA	NA	NA
AYB79183.1\|2734413_2735778_+	aminodeoxychorismate synthase component 1	A0A0B5J984	Pandoravirus	3.6e-43	34.5
AYB79184.1\|2735781_2736360_+	coenzyme A pyrophosphatase	NA	NA	NA	NA
AYB79185.1\|2736623_2737988_+	L-serine ammonia-lyase	NA	NA	NA	NA
AYB79186.1\|2738125_2739727_+	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
AYB79187.1\|2739748_2741308_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	9.5e-40	44.4
AYB79188.1\|2741295_2741631_-	hypothetical protein	NA	NA	NA	NA
AYB79189.1\|2741780_2742749_+	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
AYB79190.1\|2742801_2743602_+	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
AYB79191.1\|2743614_2744466_+	PTS mannose transporter subunit IID	NA	NA	NA	NA
AYB79192.1\|2744524_2744983_+	DUF986 domain-containing protein	NA	NA	NA	NA
AYB81236.1\|2745338_2745959_+	manganese efflux pump MntP	NA	NA	NA	NA
AYB79193.1\|2745955_2746765_-	23S rRNA (guanine(745)-N(1))-methyltransferase	NA	NA	NA	NA
AYB79194.1\|2746830_2748576_-	peptidoglycan glycosyltransferase FtsI	NA	NA	NA	NA
AYB79195.1\|2748795_2749005_-	cold-shock protein CspC	A0A1W6JNX5	Morganella_phage	1.6e-22	78.1
AYB79196.1\|2749017_2749161_-	DUF2627 domain-containing protein	NA	NA	NA	NA
AYB79197.1\|2749809_2750097_-	hypothetical protein	NA	NA	NA	NA
AYB79198.1\|2750167_2750311_-	PhoP/PhoQ regulator MgrB	NA	NA	NA	NA
AYB79199.1\|2750468_2750708_+	hypothetical protein	NA	NA	NA	NA
AYB79200.1\|2750919_2751711_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
AYB79201.1\|2751886_2753260_+	MFS transporter	NA	NA	NA	NA
AYB79202.1\|2753307_2754189_-\|protease	protease HtpX	NA	NA	NA	NA
AYB79203.1\|2754381_2756430_-\|tail,protease	tail-specific protease	A0A0R6PIZ1	Moraxella_phage	8.0e-87	33.5
AYB79204.1\|2756449_2757136_-	RNA chaperone ProQ	NA	NA	NA	NA
AYB79205.1\|2757233_2757818_-	GAF domain-containing protein	NA	NA	NA	NA
AYB79206.1\|2757859_2759143_+	paraquat-inducible protein A	NA	NA	NA	NA
AYB79207.1\|2759105_2761745_+	PqiB family protein	NA	NA	NA	NA
2760792:2760807	attL	NA	NA	NA	NA
AYB81237.1\|2761822_2763262_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
2760792:2760807	attL	NA	NA	NA	NA
AYB79208.1\|2763376_2763616_+	DUF1480 family protein	NA	NA	NA	NA
AYB79209.1\|2763726_2763918_+	DUF1482 family protein	NA	NA	NA	NA
AYB79210.1\|2763936_2764587_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	7.2e-58	50.9
AYB79211.1\|2764810_2764975_-	hypothetical protein	NA	NA	NA	NA
AYB79212.1\|2765259_2765982_-	SPI-1 type III secretion system guanine nucleotide exchange factor SopE2	NA	NA	NA	NA
AYB79213.1\|2766665_2767007_+	DUF1398 domain-containing protein	NA	NA	NA	NA
AYB79214.1\|2767388_2767865_+	hypothetical protein	NA	NA	NA	NA
AYB79215.1\|2768237_2768657_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYB79216.1\|2768785_2768980_-	hypothetical protein	NA	NA	NA	NA
AYB79217.1\|2769026_2769296_+	hypothetical protein	Q6UAV5	Klebsiella_phage	1.5e-06	39.0
AYB79218.1\|2769461_2769602_+	hypothetical protein	NA	NA	NA	NA
AYB81238.1\|2771910_2772111_-	hypothetical protein	NA	NA	NA	NA
AYB79219.1\|2773777_2773936_+	hypothetical protein	NA	NA	NA	NA
AYB79220.1\|2773945_2774560_+	disulfide bond formation protein B	NA	NA	NA	NA
AYB79221.1\|2775312_2775579_-	hypothetical protein	NA	NA	NA	NA
AYB79222.1\|2775707_2775833_-	arsenic transporter	NA	NA	NA	NA
AYB79223.1\|2776094_2776199_+\|tail	phage tail protein	NA	NA	NA	NA
AYB79224.1\|2776400_2776601_+	phage virulence factor	NA	NA	NA	NA
AYB79225.1\|2778059_2778251_+	hypothetical protein	NA	NA	NA	NA
AYB79226.1\|2778315_2778483_+	lytic enzyme	NA	NA	NA	NA
AYB79227.1\|2778739_2779273_-	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	3.2e-11	43.0
AYB79228.1\|2779269_2779557_-	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	1.6e-38	93.9
AYB79229.1\|2780690_2781770_+\|integrase	integrase	A0A2H4IYC8	uncultured_Caudovirales_phage	1.1e-98	52.0
AYB79230.1\|2782723_2783524_+	hypothetical protein	NA	NA	NA	NA
AYB79231.1\|2784003_2784726_+	guanine nucleotide exchange factor SopE	NA	NA	NA	NA
AYB79232.1\|2784927_2785497_-\|tail	tail fiber assembly protein	A0A0M4RTP2	Salmonella_phage	3.4e-96	90.5
AYB79233.1\|2785496_2787914_-\|tail	phage tail protein	A0A0K2FIZ6	Escherichia_phage	4.7e-86	62.8
2786396:2786411	attR	NA	NA	NA	NA
AYB79234.1\|2787967_2788210_-	hypothetical protein	NA	NA	NA	NA
2786396:2786411	attR	NA	NA	NA	NA
AYB79235.1\|2788248_2789112_-	DUF1983 domain-containing protein	K7PKJ2	Enterobacteria_phage	9.0e-48	78.9
AYB79236.1\|2791672_2792377_-\|tail	tail assembly protein	A5LH42	Enterobacteria_phage	2.4e-67	63.1
AYB79237.1\|2792280_2793012_-\|tail	phage tail protein	A0A0P0ZE89	Stx2-converting_phage	1.0e-113	75.6
AYB79238.1\|2793021_2793717_-\|tail	phage minor tail protein L	A0A0K2FJ01	Enterobacteria_phage	1.0e-89	66.7
AYB79239.1\|2793806_2794340_+	superoxide dismutase [Cu-Zn] SodC1	Q9MC02	Salmonella_phage	1.8e-46	54.0
AYB79240.1\|2794456_2794954_-	Ail/OmpX	A0A1B0VBR9	Salmonella_phage	1.4e-16	35.9
AYB79241.1\|2795052_2795385_-\|tail	phage tail protein	A5LH39	Enterobacteria_phage	2.6e-35	61.5
AYB81239.1\|2795381_2798369_-\|tail	phage tail tape measure protein	A0A291AWX1	Escherichia_phage	2.8e-266	62.1
AYB79242.1\|2798448_2798778_-\|tail	phage tail assembly protein T	A5LH37	Enterobacteria_phage	5.0e-23	50.9
AYB79243.1\|2798774_2799173_-\|tail	phage minor tail protein G	K7PLV8	Enterobacteria_phage	8.6e-30	56.8
AYB79244.1\|2799218_2799968_-\|tail	phage tail protein	A0A291AWU6	Escherichia_phage	4.8e-90	68.6
AYB79245.1\|2799979_2800381_-\|tail	phage tail protein	K7PHM6	Enterobacterial_phage	2.0e-42	60.9
AYB79246.1\|2800377_2800944_-\|tail	phage tail protein	Q9G063	Phage_Gifsy-2	2.1e-13	95.7
AYB79247.1\|2800924_2801224_-	ATP-binding protein	K7PH43	Enterobacteria_phage	4.5e-15	45.1
AYB79248.1\|2801216_2801540_-	DUF2190 family protein	K7PLV6	Enterobacteria_phage	7.7e-29	61.3
AYB81241.1\|2801630_2803712_-\|protease	Clp protease ClpP	A0A291AWT6	Escherichia_phage	4.8e-265	69.5
AYB81240.1\|2803635_2805153_-\|portal	phage portal protein	A0A291AWU2	Escherichia_phage	4.9e-174	64.7
AYB79249.1\|2805179_2805386_-	primosomal replication protein PriB/PriC domain protein	A0A1W6JT66	Pseudomonas_phage	2.9e-05	53.3
AYB79250.1\|2805382_2807521_-\|terminase	phage terminase large subunit family protein	A5LH27	Enterobacteria_phage	3.4e-290	72.6
AYB79251.1\|2807477_2808011_-	DUF1441 family protein	A0A291AWV8	Escherichia_phage	7.8e-34	48.1
AYB81243.1\|2808218_2808698_-\|lysis	lysis protein	Q56118	Enterobacteria_phage	1.4e-55	77.0
AYB79252.1\|2808715_2809168_-	lysozyme	A0A0M4R365	Salmonella_phage	2.3e-79	97.3
AYB81242.1\|2809151_2809481_-\|holin	phage holin, lambda family	A0A0M3ULK9	Salmonella_phage	5.8e-56	100.0
AYB79253.1\|2809756_2810443_+\|protease	type III secretion system effector protease GtgA	Q9MBM0	Phage_Gifsy-2	1.8e-131	99.6
AYB79254.1\|2810803_2811253_+	hypothetical protein	NA	NA	NA	NA
AYB81244.1\|2811626_2812151_-	hypothetical protein	NA	NA	NA	NA
AYB79255.1\|2812247_2812937_-	antiterminator	I6PDF8	Cronobacter_phage	2.1e-60	54.9
AYB79256.1\|2813066_2813294_-	DNA breaking-rejoining protein	A0A0M4RU10	Salmonella_phage	2.2e-14	66.7
AYB79257.1\|2813290_2813890_-	DUF1367 family protein	A0A0U2RT94	Escherichia_phage	4.7e-96	82.9
AYB79258.1\|2813953_2814259_-	hypothetical protein	NA	NA	NA	NA
AYB79259.1\|2814681_2814873_+	hypothetical protein	NA	NA	NA	NA
AYB79260.1\|2814890_2816870_-	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	1.9e-162	46.3
AYB79261.1\|2817266_2818397_+	GGDEF domain-containing protein	NA	NA	NA	NA
AYB79262.1\|2818683_2819079_-	DUF977 family protein	A0A088CBK9	Shigella_phage	9.8e-18	38.8
AYB79263.1\|2819091_2819553_-	replication protein	A0A0U2JGJ0	Escherichia_phage	3.5e-67	75.5
AYB79264.1\|2819545_2820544_-	DUF1376 domain-containing protein	A0A0U2RT81	Escherichia_phage	4.1e-121	67.3
AYB79265.1\|2820590_2821085_-	hypothetical protein	NA	NA	NA	NA
AYB79266.1\|2821071_2821326_-	XRE family transcriptional regulator	K7PKH4	Enterobacteria_phage	5.3e-17	60.9
AYB79267.1\|2821424_2821823_+	helix-turn-helix domain-containing protein	K7PH19	Enterobacteria_phage	1.2e-18	56.0
AYB79268.1\|2822225_2822492_+	hypothetical protein	NA	NA	NA	NA
AYB79269.1\|2822840_2823116_+	hypothetical protein	NA	NA	NA	NA
AYB79270.1\|2823119_2823326_+	cell division inhibitor protein	I6PBM9	Cronobacter_phage	3.0e-10	45.6
AYB79271.1\|2823401_2823737_+	hypothetical protein	NA	NA	NA	NA
AYB79272.1\|2823877_2826568_+	exodeoxyribonuclease VIII	Q9QF34	Lambdoid_phage	4.0e-118	72.8
AYB79273.1\|2826560_2827391_+	recombination protein RecT	A0A1P8DTF2	Proteus_phage	2.5e-103	71.6
AYB79274.1\|2827437_2827623_+	DUF1187 family protein	NA	NA	NA	NA
AYB81245.1\|2827913_2828150_+	hypothetical protein	NA	NA	NA	NA
AYB79275.1\|2828210_2828489_+	excisionase	A0A2H4J5E1	uncultured_Caudovirales_phage	1.8e-10	37.5
AYB79276.1\|2828463_2829543_+\|integrase	integrase	A0A2H4IYC8	uncultured_Caudovirales_phage	1.5e-100	52.5
2829544:2829708	attR	NA	NA	NA	NA

DBSCAN-SWA_7

2931642 : 2941350

Burkholderia_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB79384.1\|2931642_2933355_-	cellulose synthesis regulatory protein	A0A127AWB9	Bacillus_phage	1.6e-19	37.4
AYB79385.1\|2933519_2933765_-	DUF2158 domain-containing protein	NA	NA	NA	NA
AYB79386.1\|2933781_2934699_-	DUF808 domain-containing protein	NA	NA	NA	NA
AYB79387.1\|2934868_2935789_+	drug/metabolite exporter YedA	NA	NA	NA	NA
AYB79388.1\|2935777_2936248_-	very short patch repair endonuclease	E5E3X5	Burkholderia_phage	1.2e-30	46.9
AYB79389.1\|2936228_2937659_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.8e-105	57.4
AYB79390.1\|2937732_2938428_-	phosphohydrolase	A0A1D6Y7U0	Golden_Marseillevirus	2.8e-07	27.1
AYB79391.1\|2938507_2938819_-	hypothetical protein	NA	NA	NA	NA
AYB79392.1\|2939468_2940026_+	porin	Q1MVN1	Enterobacteria_phage	2.0e-64	68.4
AYB79393.1\|2940281_2940680_+	hypothetical protein	Q1MVN1	Enterobacteria_phage	2.7e-31	55.0
AYB81251.1\|2940938_2941127_-	cold-shock protein	NA	NA	NA	NA
AYB79394.1\|2941137_2941350_-	cold-shock protein CspJ	A0A1W6JNX5	Morganella_phage	3.9e-21	70.0

DBSCAN-SWA_8

3026270 : 3070233

Escherichia_phage(33.33%)

protease,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB79475.1\|3026270_3026951_+\|protease	type III secretion system effector protease PipA	Q9MBM0	Phage_Gifsy-2	1.6e-84	72.4
AYB79476.1\|3027589_3028249_+\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	2.7e-44	52.4
AYB79477.1\|3028335_3028665_+	sulfurtransferase TusE	NA	NA	NA	NA
AYB79478.1\|3028661_3028943_-	acylphosphatase	NA	NA	NA	NA
AYB79479.1\|3028991_3029771_-	AraC family transcriptional regulator	NA	NA	NA	NA
AYB79480.1\|3029796_3030345_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
AYB79481.1\|3030559_3031771_+	ribosomal RNA large subunit methyltransferase I	NA	NA	NA	NA
AYB79482.1\|3031828_3032146_+	heat-shock protein HspQ	NA	NA	NA	NA
AYB79483.1\|3032190_3032607_-	CoA-binding protein	NA	NA	NA	NA
AYB79484.1\|3032777_3033440_+	DUF2057 family protein	NA	NA	NA	NA
AYB79485.1\|3033534_3033993_+	methylglyoxal synthase	NA	NA	NA	NA
AYB79486.1\|3034028_3036083_-	DNA helicase IV	A7KV33	Bacillus_phage	6.5e-20	27.6
AYB79487.1\|3036206_3036653_+	YccF domain-containing protein	NA	NA	NA	NA
AYB79488.1\|3036671_3038825_+	TIGR01666 family membrane protein	NA	NA	NA	NA
AYB79489.1\|3038811_3039417_-	DNA transformation protein	NA	NA	NA	NA
AYB79490.1\|3039633_3040143_+	cell division inhibitor SulA	NA	NA	NA	NA
AYB81254.1\|3040499_3041552_+	outer membrane protein A	NA	NA	NA	NA
AYB79491.1\|3041623_3042076_-	macrodomain Ter protein	NA	NA	NA	NA
AYB79492.1\|3042261_3044022_+\|protease	Lon protease family protein	NA	NA	NA	NA
AYB79493.1\|3044090_3044609_+	beta-hydroxydecanoyl-ACP dehydratase	NA	NA	NA	NA
AYB79494.1\|3044708_3044876_-	ribosome modulation factor	NA	NA	NA	NA
AYB79495.1\|3045131_3045695_-	membrane integrity-associated transporter subunit PqiC	NA	NA	NA	NA
AYB79496.1\|3045691_3047332_-	intermembrane transport protein PqiB	NA	NA	NA	NA
AYB79497.1\|3047336_3048590_-	membrane integrity-associated transporter subunit PqiA	NA	NA	NA	NA
AYB79498.1\|3048604_3050512_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.4e-53	29.8
AYB79499.1\|3050524_3052633_-	ribosomal RNA large subunit methyltransferase K/L	NA	NA	NA	NA
AYB79500.1\|3052731_3053841_+	MOSC domain-containing protein	NA	NA	NA	NA
AYB79501.1\|3053837_3054380_-	cell division protein ZapC	NA	NA	NA	NA
AYB79502.1\|3054545_3055556_-	dihydroorotate dehydrogenase (quinone)	NA	NA	NA	NA
AYB79503.1\|3055763_3058376_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	6.3e-20	22.8
AYB79504.1\|3058802_3058994_+	DinI family protein	S4TNM0	Salmonella_phage	1.8e-25	93.7
AYB79505.1\|3059264_3059951_+	virulence protein	NA	NA	NA	NA
AYB79506.1\|3060310_3060937_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.4e-66	63.2
AYB79507.1\|3061584_3062553_-	SPI-2 type III secretion system effector SseI	Q9MBL9	Phage_Gifsy-2	3.3e-192	99.1
AYB79508.1\|3062778_3063027_+\|tail	phage tail protein	A0A1B0VCD0	Salmonella_phage	2.1e-18	66.2
AYB79509.1\|3063030_3063612_-\|tail	tail fiber assembly protein	A0A0M4RTP2	Salmonella_phage	1.7e-95	89.5
AYB79510.1\|3063611_3065321_-\|tail	tail fiber protein	A0A0U2SAV1	Escherichia_phage	1.5e-91	66.0
AYB79511.1\|3065317_3065944_-	hypothetical protein	A0A0U2RK03	Escherichia_phage	3.3e-92	71.6
AYB79512.1\|3065927_3067154_-	hypothetical protein	A0A0U2RJZ0	Escherichia_phage	3.2e-147	63.6
AYB79513.1\|3067150_3067483_-	hypothetical protein	NA	NA	NA	NA
AYB79514.1\|3067479_3068196_-	hypothetical protein	NA	NA	NA	NA
AYB79515.1\|3068192_3069245_-	hypothetical protein	NA	NA	NA	NA
AYB79516.1\|3069244_3069520_-	hypothetical protein	A0A0U2JGJ3	Escherichia_phage	1.6e-06	33.3
AYB79517.1\|3069735_3070233_-	hypothetical protein	A0A0U2JGI7	Escherichia_phage	8.9e-24	38.0

DBSCAN-SWA_9

3077175 : 3102809

Salmonella_phage(72.41%)

terminase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYB79525.1\|3077175_3078207_-	DUF2184 domain-containing protein	A0A0U2QQI2	Escherichia_phage	2.5e-73	45.2
AYB79526.1\|3078224_3079097_-	hypothetical protein	NA	NA	NA	NA
AYB79527.1\|3079117_3080692_-	NUDIX hydrolase	Q6UJ14	Burkholderia_virus	2.2e-20	48.6
AYB79528.1\|3080692_3081568_-	hypothetical protein	A0A0U2I1R8	Escherichia_phage	1.5e-55	45.5
AYB79529.1\|3081539_3082970_-	DUF1073 domain-containing protein	A0A0U2S5X9	Escherichia_phage	2.6e-92	37.9
AYB79530.1\|3082969_3084241_-	hypothetical protein	A0A0U2JTW9	Escherichia_phage	1.1e-83	38.3
AYB79531.1\|3084230_3085205_-\|terminase	terminase small subunit	C5IHM0	Burkholderia_virus	1.6e-29	37.3
AYB79532.1\|3085266_3085680_-	hypothetical protein	NA	NA	NA	NA
AYB79533.1\|3085669_3086221_-	DUF2514 domain-containing protein	NA	NA	NA	NA
AYB79534.1\|3086217_3086832_-	glycoside hydrolase family 19 protein	Q8HA86	Salmonella_phage	1.2e-107	94.1
AYB79535.1\|3086834_3087182_-\|holin	phage holin, lambda family	Q8SBE1	Shigella_phage	1.3e-45	80.4
AYB79536.1\|3087580_3088378_-	antitermination protein	A0A0M4S661	Salmonella_phage	4.4e-150	99.2
AYB79537.1\|3088367_3088514_-	YlcG family protein	A0A0M5M7B2	Salmonella_phage	4.3e-19	97.9
AYB79538.1\|3088510_3089122_-	recombination protein NinG	A0A0M4RU10	Salmonella_phage	1.2e-91	99.0
AYB79539.1\|3089124_3089331_-	hypothetical protein	S4TNP0	Salmonella_phage	3.5e-35	100.0
AYB79540.1\|3089330_3089933_-	DUF1367 family protein	S4TTI0	Salmonella_phage	2.8e-109	99.0
AYB79541.1\|3089972_3090278_-	hypothetical protein	H6WRY6	Salmonella_phage	9.8e-42	100.0
AYB79542.1\|3090267_3090507_-	DinI family protein	H6WRY5	Salmonella_phage	3.9e-38	100.0
AYB79543.1\|3090662_3090929_-	hypothetical protein	S4TNF2	Salmonella_phage	1.5e-46	100.0
AYB79544.1\|3091022_3091595_-	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	1.3e-66	68.0
AYB79545.1\|3091598_3092072_-	class I SAM-dependent methyltransferase	H9C170	Pectobacterium_phage	4.7e-67	79.5
AYB79546.1\|3092071_3092596_-	ead/Ea22-like family protein	A0A220NQV2	Salmonella_phage	1.8e-91	99.4
AYB79547.1\|3092592_3092940_-	DUF977 family protein	H6WRX9	Salmonella_phage	4.8e-53	90.4
AYB79548.1\|3092950_3093700_-	DNA replication protein DnaC	S4TNF5	Salmonella_phage	3.6e-138	99.6
AYB79549.1\|3093702_3094686_-	hypothetical protein	H6WRX7	Salmonella_phage	1.9e-163	100.0
AYB79550.1\|3094770_3095145_-	hypothetical protein	S4TTD7	Salmonella_phage	3.9e-64	99.2
AYB79551.1\|3095110_3095347_-	Cro/Cl family transcriptional regulator	H6WRX5	Salmonella_phage	1.8e-38	100.0
AYB79552.1\|3095476_3095881_+	transcriptional regulator	H6WRX4	Salmonella_phage	7.1e-72	99.3
AYB79553.1\|3096590_3099779_+	DNA breaking-rejoining protein	S4TNL0	Salmonella_phage	0.0e+00	74.0
AYB79554.1\|3100943_3101183_+	DUF4060 family protein	S4TR31	Salmonella_phage	2.0e-37	100.0
AYB79555.1\|3101223_3101472_+	excisionase	S4TND0	Salmonella_phage	4.7e-42	100.0
AYB79556.1\|3101516_3102809_+	DUF3596 domain-containing protein	S4TSP2	Salmonella_phage	1.3e-252	99.8

DBSCAN-SWA_10

3173778 : 3181091

Ralstonia_phage(16.67%)

integrase,protease

attL 3168834:3168848|attR 3179827:3179841

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3168834:3168848	attL	NA	NA	NA	NA
AYB79609.1\|3173778_3174156_+\|integrase	integrase	A0A077KET4	Ralstonia_phage	1.2e-20	41.0
AYB79610.1\|3174317_3174515_+	hypothetical protein	NA	NA	NA	NA
AYB79611.1\|3174727_3177004_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	6.2e-165	42.3
AYB79612.1\|3177034_3177355_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	45.7
AYB79613.1\|3177678_3177900_+	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	9.3e-18	64.2
AYB79614.1\|3178029_3179976_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.0e-39	41.9
3179827:3179841	attR	NA	NA	NA	NA
AYB79615.1\|3179972_3181091_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	8.1e-09	38.9

DBSCAN-SWA_11

3518546 : 3564182

Salmonella_phage(71.21%)

tail,protease,holin,portal,integrase,coat,terminase,lysis

attL 3518213:3518253|attR 3564200:3564240

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3518213:3518253	attL	NA	NA	NA	NA
AYB79909.1\|3518546_3518909_+	GtrA family protein	I1TED9	Salmonella_phage	3.9e-61	100.0
AYB79910.1\|3518905_3519832_+	glycosyltransferase	I1TED8	Salmonella_phage	1.4e-168	96.7
AYB79911.1\|3519812_3521465_+	hypothetical protein	B9UDL6	Salmonella_phage	1.5e-83	38.0
AYB79912.1\|3522948_3523311_+	GtrA family protein	A0A192Y6N5	Salmonella_phage	5.0e-61	100.0
AYB79913.1\|3523307_3524240_+	glycosyltransferase	A8CG95	Salmonella_phage	5.5e-176	100.0
AYB79914.1\|3524229_3525687_+	hypothetical protein	E7C9N7	Salmonella_phage	1.7e-240	99.8
AYB79915.1\|3527883_3528135_+	Arc family DNA-binding protein	E7C9U8	Salmonella_phage	1.4e-38	100.0
AYB81275.1\|3528234_3528414_+	hypothetical protein	B8K1I9	Salmonella_phage	2.1e-28	100.0
AYB79916.1\|3528427_3528793_-	hypothetical protein	E7C9U7	Salmonella_phage	8.1e-67	100.0
AYB79917.1\|3528823_3529153_+	hypothetical protein	NA	NA	NA	NA
AYB79918.1\|3529170_3531084_-	DNA transfer protein	E7C9U6	Salmonella_phage	0.0e+00	100.0
AYB79919.1\|3531083_3532388_-	acyltransferase	E7C9U5	Salmonella_phage	7.8e-213	96.3
AYB79920.1\|3532398_3533088_-	DNA transfer protein	E7C9U4	Salmonella_phage	1.2e-108	99.6
AYB79921.1\|3533090_3533546_-	DUF2824 family protein	B8K1I4	Salmonella_phage	1.4e-87	100.0
AYB79922.1\|3533545_3534247_-\|tail	phage tail protein	B8K1I3	Salmonella_phage	8.8e-70	98.3
AYB79923.1\|3534250_3535669_-	hypothetical protein	I1TEJ1	Salmonella_phage	3.3e-273	98.3
AYB79924.1\|3535628_3536129_-	hypothetical protein	I1TEJ0	Salmonella_phage	5.5e-90	98.8
AYB79925.1\|3536112_3536673_-	hypothetical protein	C6ZR11	Salmonella_phage	1.4e-102	98.9
AYB79926.1\|3536713_3538006_-\|coat	coat protein	C6ZR10	Salmonella_phage	1.1e-243	99.8
AYB79927.1\|3538005_3538917_-	scaffolding protein	A0A1R3Y5R6	Salmonella_virus	4.9e-161	100.0
AYB79928.1\|3538930_3541108_-\|portal	portal protein	I6R968	Salmonella_phage	0.0e+00	98.3
AYB79929.1\|3541107_3542607_-\|terminase	terminase	A8CGE0	Salmonella_phage	6.9e-306	99.8
AYB79930.1\|3542584_3543073_-	DNA-packaging protein	A8CGG1	Salmonella_phage	2.9e-88	100.0
AYB79931.1\|3543076_3543481_-	Decoration protein	C6ZR73	Salmonella_phage	5.3e-67	100.0
AYB79932.1\|3543480_3543870_-	hypothetical protein	C6ZR72	Salmonella_phage	1.5e-74	99.2
AYB79933.1\|3543873_3544116_-	DUF2560 family protein	A5VW77	Enterobacteria_phage	1.3e-36	100.0
AYB79934.1\|3544374_3544905_-	KilA-N domain-containing protein	A0A2H4FQV0	Salmonella_phage	4.0e-91	96.6
AYB79935.1\|3544858_3545083_-	hypothetical protein	A0A1V0E5I0	Salmonella_phage	7.2e-26	90.3
AYB79936.1\|3545117_3545588_-\|lysis	lysis protein	H6WRZ5	Salmonella_phage	1.2e-62	87.2
AYB79937.1\|3545584_3546022_-	lysozyme	Q5G8R3	Enterobacteria_phage	6.3e-74	97.9
AYB79938.1\|3546005_3546332_-\|holin	phage holin, lambda family	Q5G8R5	Enterobacteria_phage	1.7e-52	100.0
AYB79939.1\|3546467_3546665_-	hypothetical protein	C6ZR63	Salmonella_phage	5.0e-23	96.2
AYB79940.1\|3546711_3547200_-	DUF1133 family protein	I6S672	Salmonella_phage	3.0e-77	87.0
AYB79941.1\|3547269_3547473_-	protein ninH	A0A075B8J4	Enterobacteria_phage	5.7e-30	94.0
AYB79942.1\|3547469_3547865_-	RusA family crossover junction endodeoxyribonuclease	A0A0M4REJ2	Salmonella_phage	2.9e-70	96.9
AYB79943.1\|3547861_3548158_-	hypothetical protein	A0A0M3ULJ7	Salmonella_phage	7.5e-47	98.9
AYB79944.1\|3548120_3548297_-	NinF family protein	A0A0M4S6T3	Salmonella_phage	1.8e-27	96.6
AYB79945.1\|3548293_3548476_-	NinE family protein	Q716C5	Shigella_phage	1.8e-27	96.7
AYB79946.1\|3548442_3548616_-	protein ninD	C6ZR56	Salmonella_phage	7.0e-29	93.0
AYB79947.1\|3548612_3549485_-	hypothetical protein	I6R0S6	Salmonella_phage	6.1e-169	93.4
AYB79948.1\|3549481_3549940_-	recombination protein NinB	K7PKW7	Enterobacterial_phage	3.0e-79	98.6
AYB79949.1\|3549995_3551372_-	replicative DNA helicase	A0A192Y673	Salmonella_phage	4.8e-253	99.3
AYB79950.1\|3552180_3552327_-	DUF2740 domain-containing protein	A0A075B8K7	Enterobacteria_phage	1.5e-19	100.0
AYB79951.1\|3552361_3552643_-	hypothetical protein	Q76H54	Enterobacteria_phage	4.3e-44	100.0
AYB79952.1\|3552753_3552969_-	transcriptional regulator	Q76H55	Enterobacteria_phage	1.3e-32	100.0
AYB79953.1\|3553079_3553769_+	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	1.3e-126	100.0
AYB79954.1\|3553857_3554781_+	hypothetical protein	A0A1R3Y6Z6	Salmonella_virus	1.5e-181	100.0
AYB79955.1\|3554816_3555026_-	fumarate hydratase FumD	I6R0R9	Salmonella_phage	5.5e-28	91.3
AYB79956.1\|3555389_3555722_+	hypothetical protein	A0A1R3Y5R1	Salmonella_virus	2.2e-55	100.0
AYB79957.1\|3555800_3556001_+	restriction endonuclease	A0A1R3Y5S4	Salmonella_virus	1.0e-31	100.0
AYB79958.1\|3556040_3556340_+	hypothetical protein	A0A1R3Y5U4	Salmonella_virus	3.3e-50	99.0
AYB79959.1\|3556663_3556804_+\|protease	protease FtsH-inhibitory lysogeny factor CIII	Q776Q5	Enterobacteria_phage	2.0e-18	84.8
AYB79960.1\|3556796_3556910_+	host cell division inhibitory peptide Kil	C6ZR39	Salmonella_phage	7.8e-13	100.0
AYB79961.1\|3556906_3557095_+	hypothetical protein	C6ZR38	Salmonella_phage	1.3e-28	100.0
AYB79962.1\|3557103_3557811_+	recombinase	E7C9Q0	Salmonella_phage	9.7e-125	89.8
AYB79963.1\|3557811_3558318_+	single-stranded DNA-binding protein	C6ZR36	Salmonella_phage	3.8e-91	98.8
AYB79964.1\|3558326_3558875_+	3'-5' exoribonuclease	C6ZR35	Salmonella_phage	2.1e-106	100.0
AYB79965.1\|3558890_3559184_+	DUF2856 family protein	A0A1V0E5L7	Salmonella_phage	5.5e-50	100.0
AYB79966.1\|3559194_3559365_+	DUF2737 family protein	I6S642	Salmonella_phage	6.1e-25	100.0
AYB79967.1\|3559361_3559943_+	Eae-like protein	A0A0N6WGF1	Salmonella_phage	5.2e-68	71.5
AYB79968.1\|3560327_3560621_+	hypothetical protein	A0A1V0E5L2	Salmonella_phage	4.2e-50	99.0
AYB79969.1\|3560617_3561700_+	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	6.5e-80	75.2
AYB79970.1\|3561644_3561974_+	ASCH domain-containing protein	Q9XJG9	Enterobacteria_phage	1.0e-52	94.2
AYB79971.1\|3562055_3562367_+	hypothetical protein	A0A1I9LJL8	Stx_converting_phage	7.9e-55	99.0
AYB81276.1\|3562444_3562789_+	hypothetical protein	A0A0P0ZB93	Stx2-converting_phage	1.1e-57	97.4
AYB79972.1\|3562791_3563163_+	DNA-binding protein	B9UDM0	Salmonella_phage	2.1e-46	80.5
AYB79973.1\|3563018_3564182_+\|integrase	site-specific integrase	A0A0M4R586	Salmonella_phage	1.0e-219	97.1
3564200:3564240	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP032450

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP032449

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection