CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032084	Achromobacter sp. B7 chromosome, complete genome	5 crisprs	DinG,DEDDh,PD-DExK,csa3,WYL	0	1	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032084_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032084_1

1148764-1148879

Orphan

Consensus_repeat	Method
TCCGCCGGGCCGCCCCAAGGGGAAAGCTGCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032084_1

>merge|CP032084|1|1148764-1148879|CRISPRCasFinder
TCCGCCGGGCCGCCCCAAGGGGAAAGCTGCCCCCTTTGGGGGCAGAGAGCGCACGAAGGGCGCGAAGCGTGGGGGCCCCTTTTTCCGCTGGGCCGCCCCAAGGGGAAAGCTGCCCC

>CP032084|1|1|1148764-1148879|CRISPRCasFinder
TCCGCCGGGCCGCCCCAAGGGGAAAGCTGCCCC	CTTTGGGGGCAGAGAGCGCACGAAGGGCGCGAAGCGTGGGGGCCCCTTTT
TCCGCTGGGCCGCCCCAAGGGGAAAGCTGCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP032084.1\|AYD63372.1\|1149336_1151052_+\|acetolactate-synthase-3-catalytic-subunit	unknown	unknown	gnl\|CDD\|180780
CP032084.1\|AYD63374.1\|1151630_1152647_+\|ketol-acid-reductoisomerase	unknown	unknown	gnl\|CDD\|235491
CP032084.1\|AYD63380.1\|1157988_1159206_+\|threonine-ammonia-lyase	unknown	unknown	gnl\|CDD\|235994
CP032084.1\|AYD63364.1\|1137540_1139193_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
CP032084.1\|AYD63376.1\|1153721_1154240_-\|hypothetical-protein	unknown	unknown	unknown
CP032084.1\|AYD63365.1\|1139209_1140166_+\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143588
CP032084.1\|AYD63375.1\|1152815_1153592_+\|CDP-diacylglycerol--serine-O-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|224104
CP032084.1\|AYD63381.1\|1159706_1160129_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	unknown	unknown	gnl\|CDD\|377815
CP032084.1\|AYD63379.1\|1157238_1157973_+\|hypothetical-protein	unknown	unknown	unknown
CP032084.1\|AYD63378.1\|1154895_1157058_+\|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|236995
CP032084.1\|AYD63371.1\|1146397_1148698_-\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|372320
CP032084.1\|AYD63366.1\|1140169_1140787_+\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
CP032084.1\|AYD63368.1\|1143291_1144551_+\|transporter	unknown	unknown	gnl\|CDD\|235131
CP032084.1\|AYD63370.1\|1145472_1146249_+\|peroxide-stress-protein-YaaA	unknown	unknown	gnl\|CDD\|234999
CP032084.1\|AYD63362.1\|1135473_1136457_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP032084.1\|AYD63369.1\|1144675_1145458_+\|3-hydroxybutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|187644
CP032084.1\|AYD63373.1\|1151062_1151554_+\|acetolactate-synthase-small-subunit	unknown	unknown	gnl\|CDD\|183365
CP032084.1\|AYD63377.1\|1154534_1154804_+\|30S-ribosomal-protein-S15	unknown	unknown	gnl\|CDD\|180170
CP032084.1\|AYD63363.1\|1136501_1137368_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
CP032084.1\|AYD63367.1\|1141152_1142757_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185008

Protein	Function_ID	Function_description	E-value
CP032084.1\|AYD63372.1\|1149336_1151052_+\|acetolactate-synthase-3-catalytic-subunit	gnl\|CDD\|180780	PRK06965, PRK06965, acetolactate synthase 3 catalytic subunit; Validated.	0
CP032084.1\|AYD63374.1\|1151630_1152647_+\|ketol-acid-reductoisomerase	gnl\|CDD\|235491	PRK05479, PRK05479, ketol-acid reductoisomerase; Provisional.	0
CP032084.1\|AYD63380.1\|1157988_1159206_+\|threonine-ammonia-lyase	gnl\|CDD\|235994	PRK07334, PRK07334, threonine dehydratase; Provisional.	0
CP032084.1\|AYD63364.1\|1137540_1139193_+\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.69759e-117
CP032084.1\|AYD63365.1\|1139209_1140166_+\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143588	cd07564, nitrilases_CHs, Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases). Nitrilases (nitrile aminohydrolases, EC:3.5.5.1) hydrolyze nitriles (RCN) to ammonia and the corresponding carboxylic acid. Most nitrilases prefer aromatic nitriles, some prefer arylacetonitriles and others aliphatic nitriles. This group includes the nitrilase cyanide dihydratase (CDH), which hydrolyzes inorganic cyanide (HCN) to produce formate. It also includes cyanide hydratase (CH), which hydrolyzes HCN to formamide. This group includes four Arabidopsis thaliana nitrilases (Ath)NIT1-4. AthNIT1-3 have a strong substrate preference for phenylpropionitrile (PPN) and other nitriles which may originate from the breakdown of glucosinolates. The product of PPN hydrolysis, phenylacetic acid has auxin activity. AthNIT1-3 can also convert indoacetonitrile to indole-3-acetic acid (IAA, auxin), but with a lower affinity and velocity. From their expression patterns, it has been speculated that NIT3 may produce IAA during the early stages of germination, and that NIT3 may produce IAA during embryo development and maturation. AthNIT4 has a strong substrate specificity for the nitrile, beta-cyano-L-alanine (Ala(CN)), an intermediate of cyanide detoxification. AthNIT4 has both a nitrilase activity and a nitrile hydratase (NHase) activity, which generate aspartic acid and asparagine respectively from Ala(CN). NHase catalyzes the hydration of nitriles to their corresponding amides. This subgroup belongs to a larger nitrilase superfamily comprised of belong to a larger nitrilase superfamily comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13), this subgroup corresponds to class 1.	8.23329e-159
CP032084.1\|AYD63375.1\|1152815_1153592_+\|CDP-diacylglycerol--serine-O-phosphatidyltransferase	gnl\|CDD\|224104	COG1183, PssA, Phosphatidylserine synthase [Lipid metabolism].	3.53086e-66
CP032084.1\|AYD63381.1\|1159706_1160129_+\|tripartite-tricarboxylate-transporter-TctB-family-protein	gnl\|CDD\|377815	pfam07331, TctB, Tripartite tricarboxylate transporter TctB family. This family consists of several hypothetical bacterial proteins of around 150 residues in length. This family was formerly known as DUF1468.	7.18315e-06
CP032084.1\|AYD63378.1\|1154895_1157058_+\|polyribonucleotide-nucleotidyltransferase	gnl\|CDD\|236995	PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional.	0
CP032084.1\|AYD63371.1\|1146397_1148698_-\|FUSC-family-protein	gnl\|CDD\|372320	pfam12805, FUSC-like, FUSC-like inner membrane protein yccS. This family has similarities to the fusaric acid resistance protein family. The proteins are lodged in the inner membrane.	5.57775e-71
CP032084.1\|AYD63366.1\|1140169_1140787_+\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	8.00045e-39
CP032084.1\|AYD63368.1\|1143291_1144551_+\|transporter	gnl\|CDD\|235131	PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional.	3.94356e-124
CP032084.1\|AYD63370.1\|1145472_1146249_+\|peroxide-stress-protein-YaaA	gnl\|CDD\|234999	PRK02101, PRK02101, peroxide stress protein YaaA.	4.86764e-141
CP032084.1\|AYD63362.1\|1135473_1136457_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.63165e-126
CP032084.1\|AYD63369.1\|1144675_1145458_+\|3-hydroxybutyrate-dehydrogenase	gnl\|CDD\|187644	cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs. DHBDH, an NAD+ -dependent enzyme, catalyzes the interconversion of D-3-hydroxybutyrate and acetoacetate. It is a classical SDR, with the canonical NAD-binding motif and active site tetrad. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.53213e-150
CP032084.1\|AYD63373.1\|1151062_1151554_+\|acetolactate-synthase-small-subunit	gnl\|CDD\|183365	PRK11895, ilvH, acetolactate synthase 3 regulatory subunit; Reviewed.	4.25483e-96
CP032084.1\|AYD63377.1\|1154534_1154804_+\|30S-ribosomal-protein-S15	gnl\|CDD\|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	1.97202e-52
CP032084.1\|AYD63363.1\|1136501_1137368_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	9.48296e-52
CP032084.1\|AYD63367.1\|1141152_1142757_+\|HAMP-domain-containing-protein	gnl\|CDD\|185008	PRK15048, PRK15048, methyl-accepting chemotaxis protein II; Provisional.	4.64618e-115

>CP032084.1|AYD63371.1|1146397_1148698_-|FUSC-family-protein
MDLRIASIRRFLYSHYFFGGVRQGVGMLLPVLVLGGLFGNYTTGLVATFGAQCLAIIDQPGGPQRHRTNEMLGGAALGTLTVIITGLASSNPVLIWLVVIAQCFVYSMFTVFGKRGGLIGFAGLLLMTLTMHSPLEPHQVLAHAAATLGGALFYVVFSLGFSRLFWLREEQQAMSVALFATADYVAARAAFYDETADLDEAYRALIQRQSIMTEKHQAARDMVLRALPRGKGVGDRQRVMIWNMFVDMLQLLDTLVATHTDYASLRRTLAGNDCLMFMRDALVKMSLELNRIALDVSRGRPVQYRSSAKAELRAIEYEIEQLKQQGLGEREPEMLALIIQVLRRLRNSARIVDRLADHTAASPDAKPTDVLRINKSLTRFISRQEFRFGLLTSNLRLDSPHFRYALRVTAAAAIAMTLASRWLSPEFSAHNYWIMLTIVIIMKPGFALTRQRNGWRLGGTLIGCICALLLFNLTDSPEILFAVLLGACIMGNSLVQLNYMASAIFNTLFVVLVFHFVSPGTVSMSVIGERAIDTLLGCALALICSYILPWWEARYLKPLAAAATRANREYLVAGLRYVEAMQAHGAPSNAATATATNAATTAGTPPASPAASPTATSAADTPAVIDADLAWRLARKNVHIAFSNFAEAFYRMMSEPKSHQQSVPELNNLLIQNHVLASQITAAIPILAALPKTPEAVQLAMNGMVDLLDEKRPQIATTLPTQFDTSGEQAALAYPLKQMLKASHMIRQELQALADPTHAPPLAAAA
>CP032084.1|AYD63370.1|1145472_1146249_+|peroxide-stress-protein-YaaA
MLFLLSPAKKLDYDSPLHIETHTQPLFVDQAAGLIKVLKTKSAEDIAGLMSLSPALSELNAQRYAHWKRSFTQTNSRQAVLAFNGDVYEGLDASSLSAKQLDWAQDHVAILSGLYGVLRPLDLMQPYRLEMGTRLETPKGKNLYEYWGSTIADYLNERLEGKKAPVIVNLASEEYFKSVDLKTLKARVVQCVFQDWKNGAWKIISFHAKRARGLMARYAIQHKVTKPEGLQGFDLEGYAYDASASTDDKLVFRRKLAD
>CP032084.1|AYD63369.1|1144675_1145458_+|3-hydroxybutyrate-dehydrogenase
MLKGKVALVTGSTSGIGLGIATAFAQQGADIVLNGFGEAAEIEKVRAGLADKHGVKVVYDGADLSKGDAVRGLVENTVRQLGRIDILVNNAGIQHTALIEDFPAEKWDAILALNLSAVFHGTAAALPHMKKQGFGRIINIASAHGLVGSANKSAYVAAKHGVVGFTKVTALETAGQGITANSICPGWVRTALVEKQITALAQKNGVDQEAAARELLGEKQPSLQFVTPEQLGGTAVFLASDAAAQITGTSVSVDGGWTAR
>CP032084.1|AYD63368.1|1143291_1144551_+|transporter
MDLILILLLAAVLCVPITQRLGLGAIPGYLIAGVLIGPSCLKLVTNVDTMINVSQWGVVMMLFIIGLELSPKRLWAMRSEVFLLGTLQMLVCGLLLGLVFGAALRHLAGMGWQAAVLCGLSLALSSTAVALRLLDERTLTRTPLGRSALGVLLFQDMAAIPMLVAAGLLGSDGTSAPSFKEALVAVAVVTLAYRLRLLGWAAKAQLQELFTAAALLMVVGAAQLFDYAGLSAGLGGFLVGVLMAESRYRNDLESAIEPFKGLLLGLFFLAIGMSVNLKVVADHWSFILGGVAALLVVKALVLYGFARFLGLPRYHRLLFAMVLAQGGEFSFAIFNEAWDNHLVNLEQRDVLSVVVAISMGVVPVLIKLLERVPENRGGMADLPGPVQTAPSPESEPLSGSSADTSTTPSANPADSPPRA
>CP032084.1|AYD63367.1|1141152_1142757_+|HAMP-domain-containing-protein
MKNMKLGTRLAGGFSVLLAMIIVMCIVGLVSLANINESVETVTQRSLIKERLISDWGRNIQTGVTRTTAIAKSADASLAGFFTEEAAASTRNSSALQQKIEPLIETDEEKRLWEGIRKSRGDYLRTRDAIFKAKQDGDVEAANRVFTQEFLPATRQFIDQINKLSDLQRAEIDASAADIQSAYGAANLWMIVIGSIALVTGLVLAVLLTRGITRPLADAVRVARTVAANDLTSTITVRSRDEIGQLMQALESMNANLAGTVASIRTGVDSMASASGEIAAGNTDLSSRTEQQAASLEETAASMEQLSSTVKQNADSARQANQLAAAASDTASRGGATVSEVVSTMNAISSSSVKIADIVSVIDGIAFQTNILALNAAVEAARAGEQGKGFAVVAAEVRTLAQRSAQAAKEIKTLIEDTVQKISQGSISAERAGTTMQEIVSSVQRVTDIMGEIAAASAEQADGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSMQDQAAELTRAVSAFKLPGVVAVAHASPRVAIGHALARAG
>CP032084.1|AYD63366.1|1140169_1140787_+|flavin-reductase-family-protein
MHFDFSALPSQTVYKLLTSTVTPRPIAWVTTISADGCVNAAPFSFFNVMGHQPPTVAIGLMRRANGDLKDTSANIIENGEFVVNLVPEALMQQMNQTCADYPPGVDELAKAGLTALPAAHVRPPLIQGSPVSLECVSQATIVTGPHQVVVIGRVLGAHVDDAFVQDAERGYVNTTEMGLVARMHGSGWYARSTDLFQLARPTVTD
>CP032084.1|AYD63365.1|1139209_1140166_+|carbon-nitrogen-hydrolase-family-protein
MSVQASFKAAVIQAASIPTDSVACANKAASLIRQAAEQGARVLVFPEAFLGGYPKGNSFGAPIGMRKPEGRDAFASYHRQAIALDGEEVAIVAQAAADTDSFVVMGCIEADGGTLYCTVLYFNGAKGLVGKHRKLMPTAGERLIWGFGDGSTMPVFDTPYGKIGAVICWENYMPMLRMYMYSQGVALYCAPTADDRDSWIPSMRHIALEGRCYVLTACQHLRRQAYPEDFECALGDAPDTVLMRGGSAIIDPLGEVLAGPDFSDETILYADINPNQILRGKYDFDVAGHYARPDVFQLQVDTREKRAVSALGAGGQEP
>CP032084.1|AYD63364.1|1137540_1139193_+|MFS-transporter
MEANVAMGRAAAAPTLSRKEERQVVVASTLGTLFEWYDFFIYGTLAVFMSQVLFPQDNPTVALLAALGALAVGFIIRPLGAVMFGYLGDKWGRKYTFLITVVMMGGATVLIGCLPTYESAGHLSWILLLTLRVVQGLAVGGEYGGAVIYVAEHCEPKRRGLLTGWIQITSSAGLILSLVVILCTQASMSADDFRQWGWRLPFILSIVMLAISIYVRAKLHESPVFTRMKQQNRLSKNPIKETFGQWSSLRLVILALIGVTAGQGATYFTGQFYVMIFLQQAVQLDQTSVYTLILIGFIIGAPTFVLFGWLSDRIGRKWIMMAGLFIAALGYHSMFDVLLKAGNPALAQAMQSTPVRVHADTSGGACDFGLQAAMIGSHADHKKVCVQAKKFLVGKGINFEYAAPLPGQEIAMSVGGTTVNGFDRAAYARALSTAGYPDRADPARVDRATIILILVLMTAVVAMVYGPVASYLVELFPARIRYTALSFPYHIGAGIFGGIVPFTATYLAQASGNIFGGLMYPVVVMVVVGVIGSLFLPNTRAQAIDEDPIH
>CP032084.1|AYD63363.1|1136501_1137368_-|IclR-family-transcriptional-regulator
MARPAGKVDKDTEKTPTAARRGIQSIEVGFRILDLIRKTGRPLPLKDIADACELTVPNVHYYLVSFQKVGVVQQHADTGHYGLGPYALRLGLAALEQFDVFTSARPIMAEVAAVTGHTVFLGVWGNKGPTIVYRVEGSRSRPLLELRVGTVMPLLSSALGRNFLAHLPDALTRDLLERELASSVPESHGGAPGNSYTLKDVQAIRDEVQKHHISRCRHALLPHFTSLSAPIFDMLGEMTAAITLMGPVGAIDDDLDSGTARLLREKARSISAMAGWEGSEPVGATRAG
>CP032084.1|AYD63362.1|1135473_1136457_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MQRRQFMTGAAALGAALVLPVTARAQQDMPSGPVKIVVGFPAGGGTDVLARLLGQKLGVMWNIPVIVENRAGAAGVIAAEQVARQPNDGNTLLMAHVNSHGIAPGLHPKLAYSVDRDFTPIALVGKTPTILIGGASQPAKTLPDLVKLCRAQPGKIVFGSAGAGSAQHLALEIFKARAGIDVLHVPYKGSAPLMNDLLGGHVQYCFEGMTTATPLLQSGKVIALAQTLQQRSRSQPDVPTVAEQGYPGFEASIWFGMVGPGKMPDAMVRRMNRDIDQVLAMADVQEKLAQVGAEDGGGSVQRFADFMTQEQRKYAKTIKDAKIVVES
>CP032084.1|AYD63372.1|1149336_1151052_+|acetolactate-synthase-3-catalytic-subunit
MEMNGADIVVRCLADEGVEHVFGYPGGAVLYIYDAIFKQDKFQHILVRHEQAAVHAADAYSRSSQKVGVCLVTSGPGVTNAVTGIATAYMDSIPMVIISGQVPTAAIGEDAFQECDTVGITRPCVKHNFLVRDVKDLAETMRRAFYIARTGRPGPVLVDIPKDITVAQCKYTPPKGEISMRSYAPVNKGHQGQIKKAVQMLLAAERPMIYTGGGVILSNAAPELNKLVSQLGAPCTSTLMGLGGYPASSGQFVGMPGMHGTYEANMAMQHCDVLLAIGARFDDRVIGNPKHFAQNARKIIHIDIDPSSISKRVRVDVPIVGNVKDVLADLSAQFEVAAAEHKPASITKWWEQVETWRGKECLKFANSDEVIKPQYVVEKLWEVTGGDAFVTSDVGQHQMWAAQYYKFDKPRRWINSGGLGTMGVGLPYAMGVQMANPGHDVAVITGEASIQMNIQELSTCHQYRLTPKIVCLNNRFLGMVRQWQQIDYGSRYSESYMDSLPDFVKVAEAYGHVGLRIERPADVEPALREAFGKHKERLVFLDFITDRTENVWPMVKAGRGLTEMLLGSEDL
>CP032084.1|AYD63373.1|1151062_1151554_+|acetolactate-synthase-small-subunit
MKHVISVLLENEPGALSRVVGLFSARGYNIETLTVAPTEDSTLSRMTIVTTGSDEVIEQITKHLNRLVDVVKVVDLTEGAHIERELMLVKVRAVGKEREEMKRMADIFRGRIIDVTDKSYTIELTGVQEKVQAFLEALDRSAILETVRTGVSGIGRGERILKI
>CP032084.1|AYD63374.1|1151630_1152647_+|ketol-acid-reductoisomerase
MKVFYDKDCDLSLIKGKTVAIIGYGSQGHAHAQNLHESGVKVIVGLRKDGASWNKAANAGLEVKEVADAVKAADIVMMLLPDENIASVYNKEVHGNIKAGAALAFAHGFNVHYGQVVPREDIDVIMIAPKAPGHTVRNTYKQGGGVPHLVAVYQDKSGAARDVALSYASANGGGRAGIIETNFREETETDLFGEQAVLCGGTVELIKAGFDTLVEAGYAPEMAYFECLHELKLIVDLIYEGGIANMNYSISNNAEFGEYETGPKIVTDETRKAMRQCLTDIQTGEYAKKFILENTAGAPTLTSRRRINAESQIEQVGGKLRAMMPWIAANKLVDKSKN
>CP032084.1|AYD63375.1|1152815_1153592_+|CDP-diacylglycerol--serine-O-phosphatidyltransferase
MPNFSMRDSENRHRSIYLLPNAFTTAALFAGFYAVVQAMNDRFEVAAIAIFVAMVLDGMDGRVARLTNTQSAFGEQYDSLSDMTSFGVAPALVMYEWILNDLGRWGWLAAFVYVAGAALRLARFNTNIAVVDKRYFQGLPSPAAAALVAGFVWLAVDNKLPIHDSLMAWVAFTLTMYAGITMVSNAPFFSGKSFALGRSVPFWGILLVVAVFVFVSSDPPVVLFGLFVLYGLSGWVMWAWRWNKARRLTQERRGQSSS
>CP032084.1|AYD63376.1|1153721_1154240_-|hypothetical-protein
MSKYYRTARITLASLALTGLAACANLAQVPPGTPYADVLTQFGKPNYTCPQAGGGQRVIWTQQPMGQFAWGTNVGTDGRVGPVVPLLTDAHFKVLEVGDWGPDRVRCEFGPPARIEEAGLGEKREVVWSYRYKENGVWNSLMYVYMSRDGSKLTHFHPGPDPMYDDERFMWR
>CP032084.1|AYD63377.1|1154534_1154804_+|30S-ribosomal-protein-S15
MSVADIKKSDIVAQFQRAQGDTGSPEVQVALLTARINELTGHFKEHMKDHHSRRGLLRMVSRRRKLLDYLKGRNPDSYRALIEKLGLRK
>CP032084.1|AYD63378.1|1154895_1157058_+|polyribonucleotide-nucleotidyltransferase
MFNKVTKSFQYGQHTVVLETGEIARQASGAVVVSIEDTVVLATVVASKKAKPGQTFFPLTVDYIEKTYAAGRIPGGFFKREGKPSEKETLTSRLIDRPLRPLFPEDFYNEVQVVIHTLSVNPEIDPDIAAMIGASAALAISGIPFNGPIGAARVGYIDGQYALNPTATQLKSSKLDLVVAGTENAVLMVESEAQQLSEEIMLGGVVFGHEQMQAVINAIHELVKDAGKPEWDWQAPAKDEALIAAVTAAAQEGLNAAYQIREKQARTAKLREVSADVSAKLAAAAAEKGEPAPDAVTVDNIMFSLESAIVRGQILNGEPRIDGRDTRTVRPISVRLGVLPRAHGSALFTRGETQALVVATLGTKQDEQIIDALMGEYRDRFMMHYNMPPFATGETGRIGVPKRREIGHGRLAKRSLIPLLPAPEDFQYTIRIVSEITESNGSSSMASVCGGSLAMMDAGVPVKDHVAGVAMGLILDGGKFAVLTDILGDEDHLGDMDFKVAGTENGVTALQMDIKIQGITKEIMQVALAQAREGRLHILTKMKEALDGSRGELSAFAPRMLTIKINPEKIRDVIGKGGATIRALTEETGTQIDISDDGTIVIASVDEAQAKEAQRRIVELTADVEVGQMYEGSVLRLLDFGAIVQVLPGRDGLLHISEIANYRIANINDVLKVGQQVRVKVIEADDKGRLRLSIKAIGGIEAQQPAAAPDAAPQSEPQAE
>CP032084.1|AYD63379.1|1157238_1157973_+|hypothetical-protein
MTRWPAAAGAVLCGALSAAMLTGCMSSPGPGQRGPNSEAMSADQFGQTDFNRTVTLEVRDNLTSLYSLLDKLYRRNPREWRKTGVADQKAAVNRVKHAIEVRIPPSDLAGLRDIQILAVSLDPNYSGDRVGAFIYGMADTIIAAHNGKTRLYATDALDGQRVYNAARNVEAAAWLLASRRNNQGELLLLANEMSPNATNLSFEREFGAIIGRLDLIANLLGENSRRIGINYAQGLLLFNFLPVR
>CP032084.1|AYD63380.1|1157988_1159206_+|threonine-ammonia-lyase
MIDIASIQTAREHLRGQVLKTPFTLSRTLSDIFGAEIWLKFENLQFTASFKERGALNRMLSLSDEERAKGVIAVSAGNHAQGVAYHAQRMGVPAVIVMPRFTPTVKVANTRRFGAEVVLAGDTFDDAKAHGYELAQARGLIMIHPYDDEAVISGQGTVALEMLEDQPRLDMMVIAIGGGGLISGVATAAKALKPDIEIVGVQTERFPSMYAAVKGVDMPQGQYTIAEGIAVKSPGALTQPIVAKLVDHIELVSESDIEHAIVVLLEIEKTVVEGAGAAGLAALLRAQEAGSDRYKGKRIGLVLTGGNIDPLMLGELIERGMVRAGRLARIRVDLRDLPGALAHATKLIADAQANITEVHHQRAFTSLPVRNVEVDFVLQTRGPDHILEVIDVLNAAGFAASNHDH
>CP032084.1|AYD63381.1|1159706_1160129_+|tripartite-tricarboxylate-transporter-TctB-family-protein
MFIALGGAFSAQATEYSMGSAARMGPGYFPFWLGIVLALMGAVVLISALAKNAQTTTISRYDFRILFLVVGSVVLYGFALSHLGLYLSVFLLVLISSLASHEFNWKVAVANGLFLVAFSYLAFIRGLGLIFPLWPSAFAN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP032084_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032084_2

1705367-1705496

Orphan

Consensus_repeat	Method
AGGGGGCTGGCCCGCCTTGGGGCGGCCCGGCGGCGGGCCGTTGCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032084_2

>merge|CP032084|2|1705367-1705496|CRISPRCasFinder
AGGGGGCTGGCCCGCCTTGGGGCGGCCCGGCGGCGGGCCGTTGCCCCCACGCTGCGCTCATTGCATTCGCTGGCTGCCCCCCGAGGGGGCTGGCCCGCCTTGGGGCGGCCCGGCGGTGGGCCGTTGCCCC

>CP032084|2|2|1705367-1705496|CRISPRCasFinder
AGGGGGCTGGCCCGCCTTGGGGCGGCCCGGCGGCGGGCCGTTGCCCC	CACGCTGCGCTCATTGCATTCGCTGGCTGCCCCCCG
AGGGGGCTGGCCCGCCTTGGGGCGGCCCGGCGGTGGGCCGTTGCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP032084.1\|AYD63810.1\|1692740_1693124_-\|H-NS-histone-family-protein	unknown	unknown	gnl\|CDD\|376390
CP032084.1\|AYD63816.1\|1701081_1702317_+\|glycolate-oxidase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|236890
CP032084.1\|AYD63823.1\|1708834_1709953_+\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
CP032084.1\|AYD63825.1\|1711002_1711614_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|182405
CP032084.1\|AYD63818.1\|1703834_1704158_-\|NAD(P)-transhydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|378941
CP032084.1\|AYD63828.1\|1713773_1714466_-\|cytochrome-B	unknown	unknown	gnl\|CDD\|226184
CP032084.1\|AYD63819.1\|1704160_1705279_-\|Re/Si-specific-NAD(P)(+)-transhydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|240629
CP032084.1\|AYD63826.1\|1711775_1713152_+\|adenylosuccinate-lyase	unknown	unknown	gnl\|CDD\|236452
CP032084.1\|AYD63820.1\|1705695_1706571_-\|N-formylglutamate-amidohydrolase	unknown	unknown	gnl\|CDD\|377442
CP032084.1\|AYD63821.1\|1706642_1707632_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP032084.1\|AYD63824.1\|1710059_1710881_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
CP032084.1\|AYD63829.1\|1714577_1714859_-\|hypothetical-protein	unknown	unknown	unknown
CP032084.1\|AYD63817.1\|1702398_1703838_-\|NAD(P)(+)-transhydrogenase-(Re/Si-specific)-subunit-beta	unknown	unknown	gnl\|CDD\|376743
CP032084.1\|AYD63815.1\|1699971_1701078_+\|glycolate-oxidase-subunit-GlcE	unknown	unknown	gnl\|CDD\|236893
CP032084.1\|AYD63827.1\|1713210_1713669_+\|cytochrome-c	unknown	unknown	gnl\|CDD\|376525
CP032084.1\|AYD63811.1\|1693936_1695397_+\|metalloprotease-TldD	unknown	unknown	gnl\|CDD\|182685
CP032084.1\|AYD63812.1\|1695674_1696748_+\|3-deoxy-7-phosphoheptulonate-synthase	unknown	unknown	gnl\|CDD\|236435
CP032084.1\|AYD63814.1\|1698459_1699959_+\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|183043
CP032084.1\|AYD63822.1\|1707888_1708827_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182990
CP032084.1\|AYD63813.1\|1696878_1698288_+\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|178402

Protein	Function_ID	Function_description	E-value
CP032084.1\|AYD63810.1\|1692740_1693124_-\|H-NS-histone-family-protein	gnl\|CDD\|376390	pfam00816, Histone_HNS, H-NS histone family.	1.04425e-16
CP032084.1\|AYD63816.1\|1701081_1702317_+\|glycolate-oxidase-iron-sulfur-subunit	gnl\|CDD\|236890	PRK11274, glcF, glycolate oxidase subunit GlcF.	0
CP032084.1\|AYD63823.1\|1708834_1709953_+\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
CP032084.1\|AYD63825.1\|1711002_1711614_-\|glutathione-S-transferase	gnl\|CDD\|182405	PRK10357, PRK10357, putative glutathione S-transferase; Provisional.	2.93002e-62
CP032084.1\|AYD63818.1\|1703834_1704158_-\|NAD(P)-transhydrogenase-subunit-alpha	gnl\|CDD\|378941	pfam12769, PNTB_4TM, 4TM region of pyridine nucleotide transhydrogenase, mitoch. PNTB_4TM is the region upstream of family PNTB, pfam02233, that carries four of this transporters transmembrane regions. PNTB is the beta-subunit of pyridine nucleotide transhydrogenase. This family forms part of the Proton-translocating Transhydrogenase (PTH) Family.	1.98714e-40
CP032084.1\|AYD63828.1\|1713773_1714466_-\|cytochrome-B	gnl\|CDD\|226184	COG3658, COG3658, Cytochrome b [Energy production and conversion].	2.5503e-33
CP032084.1\|AYD63819.1\|1704160_1705279_-\|Re/Si-specific-NAD(P)(+)-transhydrogenase-subunit-alpha	gnl\|CDD\|240629	cd05304, Rubrum_tdh, Rubrum transdehydrogenase NAD-binding and catalytic domains. Transhydrogenases found in bacterial and inner mitochondrial membranes link NAD(P)(H)-dependent redox reactions to proton translocation. The energy of the proton electrochemical gradient (delta-p), generated by the respiratory electron transport chain, is consumed by transhydrogenase in NAD(P)+ reduction. Transhydrogenase is likely involved in the regulation of the citric acid cycle. Rubrum transhydrogenase has 3 components, dI, dII, and dIII. dII spans the membrane while dI and dIII protrude on the cytoplasmic/matrix side. DI contains 2 domains in Rossmann-like folds, linked by a long alpha helix, and contains a NAD binding site. Two dI polypeptides (represented in this sub-family) spontaneously form a heterotrimer with dIII in the absence of dII. In the heterotrimer, both dI chains may bind NAD, but only one is well-ordered. dIII also binds a well-ordered NADP, but in a different orientation than a classical Rossmann domain.	0
CP032084.1\|AYD63826.1\|1711775_1713152_+\|adenylosuccinate-lyase	gnl\|CDD\|236452	PRK09285, PRK09285, adenylosuccinate lyase; Provisional.	0
CP032084.1\|AYD63820.1\|1705695_1706571_-\|N-formylglutamate-amidohydrolase	gnl\|CDD\|377442	pfam05013, FGase, N-formylglutamate amidohydrolase. Formylglutamate amidohydrolase (FGase) catalyzes the terminal reaction in the five-step pathway for histidine utilisation in Pseudomonas putida. By this action, N-formyl-L-glutamate (FG) is hydrolyzed to produce L-glutamate plus formate.	4.30465e-68
CP032084.1\|AYD63821.1\|1706642_1707632_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.35175e-143
CP032084.1\|AYD63824.1\|1710059_1710881_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	5.77479e-34
CP032084.1\|AYD63817.1\|1702398_1703838_-\|NAD(P)(+)-transhydrogenase-(Re/Si-specific)-subunit-beta	gnl\|CDD\|376743	pfam02233, PNTB, NAD(P) transhydrogenase beta subunit. This family corresponds to the beta subunit of NADP transhydrogenase in prokaryotes, and either the protein N- or C terminal in eukaryotes. The domain is often found in conjunction with pfam01262. Pyridine nucleotide transhydrogenase catalyzes the reduction of NAD+ to NADPH. A complete loss of activity occurs upon mutation of Gly314 in E. coli.	0
CP032084.1\|AYD63815.1\|1699971_1701078_+\|glycolate-oxidase-subunit-GlcE	gnl\|CDD\|236893	PRK11282, glcE, glycolate oxidase FAD binding subunit; Provisional.	0
CP032084.1\|AYD63827.1\|1713210_1713669_+\|cytochrome-c	gnl\|CDD\|376525	pfam01322, Cytochrom_C_2, Cytochrome C'.	1.05434e-41
CP032084.1\|AYD63811.1\|1693936_1695397_+\|metalloprotease-TldD	gnl\|CDD\|182685	PRK10735, tldD, protease TldD; Provisional.	0
CP032084.1\|AYD63812.1\|1695674_1696748_+\|3-deoxy-7-phosphoheptulonate-synthase	gnl\|CDD\|236435	PRK09261, PRK09261, phospho-2-dehydro-3-deoxyheptonate aldolase; Validated.	0
CP032084.1\|AYD63814.1\|1698459_1699959_+\|FAD-binding-protein	gnl\|CDD\|183043	PRK11230, PRK11230, glycolate oxidase subunit GlcD; Provisional.	0
CP032084.1\|AYD63822.1\|1707888_1708827_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182990	PRK11139, PRK11139, DNA-binding transcriptional activator GcvA; Provisional.	7.89134e-93
CP032084.1\|AYD63813.1\|1696878_1698288_+\|FAD-binding-protein	gnl\|CDD\|178402	PLN02805, PLN02805, D-lactate dehydrogenase [cytochrome].	1.19634e-156

>CP032084.1|AYD63819.1|1704160_1705279_-|Re/Si-specific-NAD(P)(+)-transhydrogenase-subunit-alpha
MHIGIPKETRDGETRVAATPETVKKYVGGKHTVVVERGAGVAARYLDDAYEAAGATLGSAQDALGADLVMKVRAPSADEVPHMKRGAVIIGMLDPFDAEGIEQMAAAGLTGFALEAAPRITRAQSLDVLSSQANLAGYKAVLLAAHHYGRLIPMMMTAAGTLKAARAVVLGTGVAGLQAIATAKRLGAVVEASDVRPAAREQVESLGAKFIDVPFETDEEREIAEGKGGYARAMPPGWMARQAALVSERCKQADIVITTALIPGRPAPTLVSADTVAAMRPGSVLVDLAVERGGNCPLSERGKIVEKHGVTIVGLTNLPGLVATDASALYARNVMDFLKLIINADGALAIQRDDEIVAACLVCEGGNVMQRT
>CP032084.1|AYD63818.1|1703834_1704158_-|NAD(P)-transhydrogenase-subunit-alpha
MEAINPTLMNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAISAIIIVGAMLAAALTEGGLARGMGVFAVALAAVNVFGGFLVTRRMLEMFKKKDRKPGPGKEEAK
>CP032084.1|AYD63817.1|1702398_1703838_-|NAD(P)(+)-transhydrogenase-(Re/Si-specific)-subunit-beta
MISLNLVTLLYLIASVCFIQALKGLSHPTTSRLGNAFGMAGMAIAVLTTAALIIGLAREGTATIGLGWVLLGLLVGGSIGTLMARRVEMTKMPELVAFMHSMIGLAAVAIAVAVVAEPHAFGIVPAGMLIPTGNRFELFIGTFVGAITFSGSVIAFGKLSGKYKFRLFQGAPVVFPGQHMLNLALALVMLGCGLWFMLTQEWTPFIIMTLVAFVLGVLIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNPMLIIAGSLVGSSGAILSYIMCKAMNRSFFNVILGGFGGQAGSAADAGAAQQRSVKSGSADDAAFLMTNAESVTIVPGYGLAVARAQHALKELATKLTERGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMDDINSEFAQTDVVLVLGANDVVNPAAKNDPKSPIAGMPILEAYKARTVIVNKRSMASGYAGLDNELFYMDRTMMVFGDAKKVLEDMVKAVE
>CP032084.1|AYD63816.1|1701081_1702317_+|glycolate-oxidase-iron-sulfur-subunit
MQTNLASWARDTDLGNEADAILRRCVHCGFCTATCPTYQVLGDELDSPRGRIYLIKQVLEGAEPTQSTQQHLDRCLTCRNCETTCPSGVQYGHLIDIGRKIVDERVPRSWADKTKRNLLRRAMLSPMFAPAMKAGQAMRAMLPEALKRKVPERRDAGALPVVSGHARQVLMLTGCVQPAMMPTIDAATIRVLDAVGIGARLAPGAGCCGAVSFHLDAQDAALAQMRANVDAWWPLIQGGAVEAIVMNASGCGAMVKEYAHHLKHDPAYAQKAADIVARVKDVAEIVAPHAAQLRARLPGGARAAYHPPCTLQHWQGLRPLSEQLLVDLGFDLQPFADKHLCCGSAGAYSVLHPDIALQLRDRKLTAIAAGGPDVILSANIGCIGHLQSGTDTPVRHWVEVVDEQLRQTAAA
>CP032084.1|AYD63815.1|1699971_1701078_+|glycolate-oxidase-subunit-GlcE
MDFVLSELCDQVMTARAGHKPLFVMGGGSKAFYGNYRPVTPQDGHCLLDMTPYRGIVSYHPSELVVTVRAGTPLTELEAVLAENGQMLAFEPPHFAASATVGGCVAAGLSGPRRMSAGALRDFVLGTRLLDSEGRMLSFGGEVMKNVAGYDVSRLLAGSHGIFGAILDVSMKVVPRPMEELTLVLPATQAQALASFALWRGKPLPISATSWTGDDDGGEGLMHVRLSGAPPALASARHVIGGDALLPDAALVWWRSLREQTHPFFHPGRPLWRLALPPTAAALGLGPTLIEWGGGQRWLSGQRDATELREIAARLGGHATLFRPGNSKPPVDGVFHPLAPGVAAITRRLKQELDPASLFNPGRLVLEL
>CP032084.1|AYD63814.1|1698459_1699959_+|FAD-binding-protein
MNSLVETGLAQVQAPYSLQQLIEALSAALPAHCVLFREEDTRPYECDGLSLYRALPAVVALPETEEQVQAVMRICKRLNAPLVARGAGTGLSGGAMPHSQGVLLGLSKFNRIKHIDLASATAIVQPGVRNLAISEAASPYGLYYAPDPSSQIACSIGGNVAENSGGVHCLKYGLTVHNVLRVRVVTIDGDIVELGSEAPDAPGLDLLSVFIGSEGMLGVVTEVTVKLIPKPACAQVVMASFSSVEAAGNAVTQVIAAGMIPAGLEMMDRRATHMVEPFVCAGYDLDAQAILLCESDGTPDEVAHEIARMEAVFRDAGATRCQVSTSEAERLKFWAGRKNAFPAAGRVSPDYYCMDGTIPRRHLARVLGAIEQMEDEFGLRCANVFHAGDGNLHPLILFDSNKPDEVERAEKFGAAILELCVQVGGTVTGEHGVGMEKINQMCVQFSREELDAFLAVKRAFDPPCLLNPEKVIPTLARCAEYGKMHVHAGELRFPDLARF
>CP032084.1|AYD63813.1|1696878_1698288_+|FAD-binding-protein
MNAPLHAETLRRPVPAACLDALRARFGDRLSESSAVCEHHGRDESPYPAMLPDAVVFAHSTEDVAAVAKLCNEHRVPLIPYGAGSSLEGHILAIQGGISLDLSQMNKVLAINAEDLTATVQAGVLRKQLNEEIRSTGLFFPIDPGADASLGGMAATRASGTNAVRYGTMRENVMSLTVVTADGRIIRTAGRARKSSAGYDLTRIFVGSEGTLGIITEVTVRLYPQPEAVSAAVCNFPTLDAAVQSVIEIIQMGVPIARVEFMDAASVRSVNQYSKLSLRETPLLVFEFHGSPAGVQEQAETVQAITAEHGGMDFEWAERPEDRSRLWTARHNAYFAGLQLRPGCRASTTDVCVPISRLADCVRDTVEELERASFPYTIVGHVGDGNFHVLMLLDADNPKEWEESETINHNLVRRAIAADGTCTGEHGVGLHKMQFMAEEHGDDALDLMRSLKHAFDPNNILNPGKIVSW
>CP032084.1|AYD63812.1|1695674_1696748_+|3-deoxy-7-phosphoheptulonate-synthase
MSHNTDDLRIREIKELNPPAHVMREFACTKEAGDTVFAARQGMHRILHGMDDRMIVVIGPCSIHDTRAAIEYAKRLKPVRDRLSADLEIVMRVYFEKPRTTVGWKGLINDPDLDGSFDINKGVRVARELLLDINSLGLPAGCEFLDMITPQYIADLVSWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIVSTAGNEDCHVILRGGKTPNYDAASVDAACQDVSKAGLAQRIMVDASHANSSKDPENQPRVIDDVARQMEAGDARLIGVMVESHLLGGRQDMVPGKPLVYGQSITDGCIDWDASVAVLERLAHAVRERRRVALTSGK
>CP032084.1|AYD63811.1|1693936_1695397_+|metalloprotease-TldD
MKITDPAIASLATAKSLLLDPWGLTEADMARALGEIFTHKVDYADLYFQYTRSEGWSLEEGIVKTGSFSISQGVGVRAVSGEKTAFAYSDSLSADALLSSAHAVRGIARRGAGKVKVAAQVEAEMGRSLYADIDPVATLSAPEKVALLERIERMARARDPHVIQVMAGLGAEYDVVLVAGSDGRLAADVRPLVRLSLTVIAERNGRREMGHAGGGGRLGLAYFTDEMLQGYVERAVHEAMVNLEARPAPAGEMTVVLGSGWPGILLHEAVGHGLEGDFNRKGSSVFSGRIGERVASKGVTVVDDGTLPDRRGSLNIDDEGNATQRNVLIEDGILRGYMQDTLNARLMKTAATGNGRRESFAHLPMPRMTNTYMLAGDKPAEEIVSSVKRGLYAVNFGGGQVDITSGKFVFSASEAYMIEDGKVTYPVKGATLIGNGPDAMTRVTMIGNDLQLDSGVGTCGKDGQSVPVGVGMPTVRMEGLTVGGTA
>CP032084.1|AYD63810.1|1692740_1693124_-|H-NS-histone-family-protein
MARETYAALQAKIEKEINKLQKKAEVLQTKRRKPVITSIITSMREYDITPEEIIAAYGSGKPARVAPGGRRKAGAAARPATAAKRAVAPKYRHPQTGETWSGRGKAPRWLAAEEAGGATRDSFLIKE
>CP032084.1|AYD63820.1|1705695_1706571_-|N-formylglutamate-amidohydrolase
MRITQPLSYRLDLPQQYPDSEPSAPLVLDSPHSGTAYPPDFAAAVDFGALRTAEDTWVDDLWGDALDMGVPMVAAAFPRAYIDANRAADEIDELLLDQAWPDAVNASPKVKLGKGLIWRMLDDGTPLYNRKLTVEEVRHRINACWKPYHAALGQVLDAAHKKFGKVWHINCHSMPSVAGAFATDRPGLVHPDFVLGDRDGSTSDPAFREFIAAWLRERGYNVTVNDPYKGVELVRAFGRPQEGRHSLQIEINRKLYMDEVTLRPTENYGRLKADLRDLTAALINWTRAQTA
>CP032084.1|AYD63821.1|1706642_1707632_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MQRRNVVLGLCVAAATLAMPLTSGIAHAEDAYPSKPIRLIVPFPPGGTTDIVGRLFADKLGKELGQTVVVENRGGAGGSIGSAFVASSAPDGYVLGIATVSTHGINPAIYPNLPFDGEKDFTPISNLAAVPNIMTINPKVDAKNIADFIKLAKSQPGKLTYASAGNGSVSHMMGELFKMASGTDLMHVPYRGVGPALNDALAGQVDVMYDNLPSTLPHVQSGRLIAMAVASPKRVASLPNVPTFAEAGLPAVNDASWFGLVAPAKLPEPILAKLNAAVQKVSADADVKSRLEALGAEPAANSSADFGKQIAAEIAKNKRIAKEANVKID
>CP032084.1|AYD63822.1|1707888_1708827_+|LysR-family-transcriptional-regulator
MRRFCPSLTDLQAFEVAARHSSFTRAAQELCVTQGAVSKQVKHLEEFVGVELFLRIRQGLVLTEAGRSYLTKVQAGLGQIEAATVELIAHQGQGGTLNLTCMPTFGARWLIPRLTAFMRLRPDIHVEFLPHRQGYDFSTPELDAAVRFGEGIWPGSGADYIVGRDIVPVCSPRLIPGGCPSPEALLAYPLLHHTSALEGWRDWFEQAGCDSRRSLEGARFDQYALLSQAAAAGFGVALIPRCLIEDELRDGKLAVAIKLPIRARMGYYLCYPEQKANLPTLQAFRAWLMEVSRAAEPQPNAEPAPEAASELK
>CP032084.1|AYD63823.1|1708834_1709953_+|tRNA-2-thiouridine(34)-synthase-MnmA
MSQISTKKGRVVVGMSGGVDSSVTAWLLKQQGYEVVGLFMKNWEDDDDSEYCSTRQDLLDAASVADLVGVDFEFVNFAAEYKDRVFAEFLREYSAGRTPNPDVLCNAEIKFKAFLDHAMALGAEHIATGHYARVREVPAEAGGTQFQLLKALDASKDQSYFLHRLNQAQLSRTLFPLGEIHKTEVRRIAHEIGLHNAAKKDSTGICFIGERPFREFLNRYLPTEPGPILTPEGQQVGRHEGLSFYTLGQRKGLGVGGVKGRQREDGTAEAWYVARKDLERNILYVVQGHDHPWLLSGQLQAQDASWVAGHPPALAGYGAKTRYRQADAACRLDRAEGDTFALDFTDPQWAVTPGQSAVLYDGEVCLGGGIIL
>CP032084.1|AYD63824.1|1710059_1710881_+|sulfite-exporter-TauE/SafE-family-protein
MDVSMVICLLVLGAVAGFAAGLLGIGGGMLLVPLLTMLFSWQGMPPELVVHAAIATSMTSILFTSISSVRAHQQRGTIKWNIVWAMAPGIIIGGLISGGAVFAALNTLWLSLFFALFVGYSGWSMLRNKKPKPARQMPGVVGTSAAGAGIGFLSGLVGAGGGFLSVPFMVWCNVALHNAVSTSAALGFPIALANSVGYVVSGLNEGATRPGMLGYIYWPALLALVCTSVLTAPLGARMAHRLPVQTLKRVFACLLFALAAYMLFKAWQTFAAQ
>CP032084.1|AYD63825.1|1711002_1711614_-|glutathione-S-transferase
MKLIGSLTSPYVRKVRIVMAEKKLDYRLELENVWSADTQIQTYNPLGKVPCLVMEDGGALFDSRVIVEYVDTLSPVARLIPQQGRDRAAVKCWEAIADGVLDACVAIVKENQRPEAQRSPEWIERQYGKIHASLDAMNKSLGDNAHCMGINYSLADIAVGCALGYLDLRFAALDWRANHLNLARLHDKLAQRQSFIDTAPKTA
>CP032084.1|AYD63826.1|1711775_1713152_+|adenylosuccinate-lyase
MQIADQLSQLNALSPLDGRYASRSDALRGLLSEAGFMAHRVEVEVAWLVALSDAGLPELPAFSQAARQRLQQLVQDFSEADAGRIKDIERVTNHDVKAVEYWLKEKVADDAELARAAEFIHFACTSEDINNTSHALMLSRARDQVVVPRLRELAAKLNDMAVAQADQPMLSRTHGQPASPTTLGKEFANVAARLNRAIAAVEAVEPLAKLNGATGNYNAHLSAYPEIDWPAFSQRVLAGLGLTQNRHTIQIEPHDWMSALFDAITRANIIVLDLDRDVWGYVALGYFKQRLKEGEVGSSTMPHKVNPIDFENSEGNLGLANAVLRHLADKLPISRWQRDLTDSTVLRNLGVGLGYCLVAWDACMRGLGKLEVNTAAIDADIDACWEVLAEPVQTVMRRYGLPQPYEQLKALTRGKGITEEALREFIQGLALPEEPKARLLAMTPRSYIGLAAELARAV
>CP032084.1|AYD63827.1|1713210_1713669_+|cytochrome-c
MQKLSTLVALACMTVAPLLATTASAQFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWTAFGPGTEGGDARPEIWSDAAGFKQKQQAFQDNIVKLSAAADSGDLDKLRAAFGDVGASCKACHDSYRKKK
>CP032084.1|AYD63828.1|1713773_1714466_-|cytochrome-B
MQNNRLAVRIWDLPTRLFHWALVVCIVGAFVSVKLGGLYMDWHVRFGCTALGLIIFRLLWGIVGPRYARFATFVRGPGAVAKYLKGAAAPAGHNPLGALSVLALLLVIGFQAVSGLFTTDDIMMQGPLFGYVSADTASTLTSWHKLNEWVIIGLIALHLVAVAWYALVRRKRLVRSIITGDVDAKDLPAGTPPAQDGFAVWLRALLLGACVTGLVLWIRSLEIMADMSFS
>CP032084.1|AYD63829.1|1714577_1714859_-|hypothetical-protein
MNTRFTTSDLIRRPAHTTLDNTPIHIGDIVHLQPANGPAIRATVIFNAPINGTTTYTTEVVACGNTTQKAPGQRIRFRHEHVHRIESVRNASY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP032084_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032084_3

2606926-2607022

Orphan

Consensus_repeat	Method
CAGCCCGCGTGGCATTCGTCGTAACGTCCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032084_3

>merge|CP032084|3|2606926-2607022|CRISPRCasFinder
CAGCCCGCGTGGCATTCGTCGTAACGTCCGGCCAGCCAGCCAGCCACCAGCCACCAGCCAGCCATCCAGCCCGCGTGGCATTCGTCGTAACGCCGGG

>CP032084|3|3|2606926-2607022|CRISPRCasFinder
CAGCCCGCGTGGCATTCGTCGTAACGTCCGG	CCAGCCAGCCAGCCACCAGCCACCAGCCAGCCATC
CAGCCCGCGTGGCATTCGTCGTAACGCCGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP032084.1\|AYD64526.1\|2619320_2619953_+\|glutamine-cyclotransferase	unknown	unknown	gnl\|CDD\|226344
CP032084.1\|AYD64525.1\|2616821_2617688_-\|DUF3348-domain-containing-protein	unknown	unknown	gnl\|CDD\|378731
CP032084.1\|AYD67594.1\|2603930_2605175_+\|DUF445-domain-containing-protein	unknown	unknown	gnl\|CDD\|225347
CP032084.1\|AYD64524.1\|2613187_2616874_-\|DUF802-domain-containing-protein	unknown	unknown	gnl\|CDD\|274008
CP032084.1\|AYD64512.1\|2593502_2595434_-\|acyl-CoA-synthetase	unknown	unknown	gnl\|CDD\|236043
CP032084.1\|AYD64514.1\|2596594_2597791_-\|pimeloyl-CoA-dehydrogenase-large-subunit	unknown	unknown	gnl\|CDD\|132248
CP032084.1\|AYD64519.1\|2608493_2609285_-\|type-I-methionyl-aminopeptidase	unknown	unknown	gnl\|CDD\|235576
CP032084.1\|AYD64518.1\|2605320_2605845_+\|superoxide-dismutase-[Cu-Zn]-SodC2	unknown	unknown	gnl\|CDD\|182357
CP032084.1\|AYD64520.1\|2609285_2609528_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|314732
CP032084.1\|AYD64515.1\|2597809_2598994_-\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|180843
CP032084.1\|AYD64513.1\|2595451_2596585_-\|pimeloyl-CoA-dehydrogenase-small-subunit	unknown	unknown	gnl\|CDD\|132247
CP032084.1\|AYD67596.1\|2618058_2619288_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	unknown
CP032084.1\|AYD67595.1\|2607056_2608322_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
CP032084.1\|AYD64522.1\|2611720_2612569_-\|DUF2894-domain-containing-protein	unknown	unknown	gnl\|CDD\|378663
CP032084.1\|AYD64516.1\|2599118_2601242_-\|3-hydroxyacyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|236864
CP032084.1\|AYD64521.1\|2609694_2611608_-\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275272
CP032084.1\|AYD67593.1\|2602600_2603806_+\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
CP032084.1\|AYD64517.1\|2601436_2602366_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP032084.1\|AYD64523.1\|2612540_2613191_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|181620
CP032084.1\|AYD64511.1\|2592434_2593421_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234

Protein	Function_ID	Function_description	E-value
CP032084.1\|AYD64526.1\|2619320_2619953_+\|glutamine-cyclotransferase	gnl\|CDD\|226344	COG3823, COG3823, Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones].	1.74632e-05
CP032084.1\|AYD64525.1\|2616821_2617688_-\|DUF3348-domain-containing-protein	gnl\|CDD\|378731	pfam11828, DUF3348, Protein of unknown function (DUF3348). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 244 to 323 amino acids in length.	2.46824e-92
CP032084.1\|AYD67594.1\|2603930_2605175_+\|DUF445-domain-containing-protein	gnl\|CDD\|225347	COG2733, COG2733, Predicted membrane protein [Function unknown].	6.35355e-129
CP032084.1\|AYD64524.1\|2613187_2616874_-\|DUF802-domain-containing-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	9.47645e-09
CP032084.1\|AYD64512.1\|2593502_2595434_-\|acyl-CoA-synthetase	gnl\|CDD\|236043	PRK07529, PRK07529, AMP-binding domain protein; Validated.	0
CP032084.1\|AYD64514.1\|2596594_2597791_-\|pimeloyl-CoA-dehydrogenase-large-subunit	gnl\|CDD\|132248	TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit. Members of this protein family are the PimC proteins of species such as Rhodopseudomonas palustris and Bradyrhizobium japonicum. The pimFABCDE operon encodes proteins for the metabolism of straight chain dicarboxylates of seven to fourteen carbons. Especially relevant is pimeloyl-CoA, basis of the gene symbol, as it is a catabolite of benzoyl-CoA degradation, which occurs in Rhodopseudomonas palustris.	9.10144e-160
CP032084.1\|AYD64519.1\|2608493_2609285_-\|type-I-methionyl-aminopeptidase	gnl\|CDD\|235576	PRK05716, PRK05716, methionine aminopeptidase; Validated.	1.10548e-155
CP032084.1\|AYD64518.1\|2605320_2605845_+\|superoxide-dismutase-[Cu-Zn]-SodC2	gnl\|CDD\|182357	PRK10290, PRK10290, superoxide dismutase [Cu-Zn] SodC2.	9.46995e-55
CP032084.1\|AYD64520.1\|2609285_2609528_-\|hypothetical-protein	gnl\|CDD\|314732	pfam11903, ParD_like, ParD-like antitoxin of type II bacterial toxin-antitoxin system. ParD-like antitoxin is a family of archaeal and bacterial proteins of a type II bacterial toxin-antitoxin system. Many of the cognate toxins for these molecules fall into family ParE-like_toxin, pfam15781. Gene-pairs are expressed from the same operon, the toxin of the pair being expressed first, eg, for UniProtKB:Q3AQ93 and UniProtKB:Q3AQ94.	2.12209e-23
CP032084.1\|AYD64515.1\|2597809_2598994_-\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|180843	PRK07108, PRK07108, acetyl-CoA C-acyltransferase.	0
CP032084.1\|AYD64513.1\|2595451_2596585_-\|pimeloyl-CoA-dehydrogenase-small-subunit	gnl\|CDD\|132247	TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, small subunit. Members of this protein family are the PimD proteins of species such as Rhodopseudomonas palustris, Bradyrhizobium japonicum. The pimFABCDE operon encodes proteins for the metabolism of straight chain dicarboxylates of seven to fourteen carbons. Especially relevant is pimeloyl-CoA, basis of the gene symbol, as it is a catabolite of benzoyl-CoA degradation, which occurs in Rhodopseudomonas palustris.	1.48655e-109
CP032084.1\|AYD67595.1\|2607056_2608322_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.51345e-44
CP032084.1\|AYD64522.1\|2611720_2612569_-\|DUF2894-domain-containing-protein	gnl\|CDD\|378663	pfam11445, DUF2894, Protein of unknown function (DUF2894). This is a bacterial family of uncharacterized proteins.	5.91443e-55
CP032084.1\|AYD64516.1\|2599118_2601242_-\|3-hydroxyacyl-CoA-dehydrogenase	gnl\|CDD\|236864	PRK11154, fadJ, fatty acid oxidation complex subunit alpha FadJ.	2.68097e-156
CP032084.1\|AYD64521.1\|2609694_2611608_-\|radical-SAM-protein	gnl\|CDD\|275272	TIGR04479, bcpD_PhpK_rSAM, radical SAM P-methyltransferase, PhpK family. Characterized members of this family are B12-binding domain/radical SAM domain enzymes that use methylcobalamin as a methyl donor to methylate a phosphorous atom during the biosynthesis of natural products such as bialaphos and phosalacine. These syntheses create an extremely rare C-P-C bond. All members of the seed alignment derive from genomic regions that include a non-ribosomal peptide synthase. Note that a single organism, Pelosinus fermentans JBW45 from Cr(VI)-contaminated groundwater, has eight additional homologs of unknown function that score between trusted and noise cutoffs of this model. [Cellular processes, Toxin production and resistance].	6.27389e-24
CP032084.1\|AYD67593.1\|2602600_2603806_+\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.31989e-40
CP032084.1\|AYD64517.1\|2601436_2602366_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.02261e-55
CP032084.1\|AYD64523.1\|2612540_2613191_-\|hypothetical-protein	gnl\|CDD\|181620	PRK09040, PRK09040, hypothetical protein; Provisional.	5.46312e-148
CP032084.1\|AYD64511.1\|2592434_2593421_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	1.03245e-109

>CP032084.1|AYD64518.1|2605320_2605845_+|superoxide-dismutase-[Cu-Zn]-SodC2
MKKISMLVAGLTLAGASSAALAEDVTMSFLTADGLGKSAGTISLKDTKGGLQITPHLKGLPPGEHGFQVHEKGSCMPGMVNDKMAPGGAAGGHLDPKGTKAHKGPMATDGHQGDLPFIVVAADGTAKKAVVAPHLKLADVKKHAVMVHVGGDNYSDTPAPLGGGGGRLVCGVVK
>CP032084.1|AYD67594.1|2603930_2605175_+|DUF445-domain-containing-protein
MKIAALALLVAMVCGFITSHVMGGQGAWAWVRAFCEAATVGALADWFAVVALFRRPLGLPIPHTAIIPSNKDRIGDNLAVFVRDHFLDPDTLMEKLRVFDPAARLSRWLVRPRQAQALSDGARRVALQTLDMLDDHAVRGVIQEFVVKNLRRWDAAGTVGEVLGLLTRDGRHQELLDAAMERLGGYLGQDEVKDRASTLLVKFARKEWPRIIAAVNAVKSVDGIADNLADRLAMALMDELRDVLSEPDHPVRRDYEAWVLNYIERLKADPALSAQVEELKQRAIDHPKVQEYVQGLWDDIHAALRRDLSDEGSALAAHLESALLALGRKLAEDPGLREAINSHVLGSARRLTGRLRIGVTEHISRTVKNWDERHLVDELELSVGRDLQYIRFNGTLVGGLIGVALHALVLLLNR
>CP032084.1|AYD67593.1|2602600_2603806_+|AI-2E-family-transporter
MAVAAGAAEPKSPEERAAEKSGPDDRASDEKATVQDAGIVPEPAPDVTHVWARGACLTTLTVLAVLFSLKMAQEFIVPVVMAIVVSYALDPAVALMERVRVPRPIGIVILMAVIAFGLAGLVYATQSQVTSIVDALPEISGKISRTLGGFASGDGSIIERIKGAASVLQETGGIPPGRQVVVTKSDAGFSEFLLWGSKGLATFLGQATMSVFLVFFLLLSGNAFKRKFVKVAGKTLSQKKISVHMLDQINSSIHMYMAMMLVTNVALGVLSWGAFRLLGLENAATWAVVAGALHIVPYFGPLLTAVGTGVAALIQFGEIGPALQVAGSSVVIALLIGVLVTTWMSGRIARMNSVAVFMMLLLFTWLWGIWGTLLSVPIAFIAKVVADHIEGLEAVSEFLGE
>CP032084.1|AYD64517.1|2601436_2602366_+|LysR-family-transcriptional-regulator
MDTKSLTLLVDILDAGNLSEAARRLKMTRANVSYHLNQLERSVGMQLVRRTTRHVEATEIGLKLYQHGRSIQDELVAAREAVDTLGKTPQGKVRLSVPSGYGQFVMTPWLLEFKAAYPDIVLDVLFENSVDDLLRDEVDIAVRIMSEPPQNLVARELGLVRYVACASQTYADARGLPERPEDLAQLPVISAAVIGRPLRLSAYYDGQPRQHVVLEPTVISRNYAFLRDAIRAGLGVGVVPDYVVHDDIARGELLPVLTPWRLSIFGRGMYMLYMPNRHHPRAISMLIEFILERAQRSHEGQAGLLAVKG
>CP032084.1|AYD64516.1|2599118_2601242_-|3-hydroxyacyl-CoA-dehydrogenase
MTDSSTAGAAHARRDEDILVITLDHPPVNALSADVRRDLSDAIQAGQADTSVRAILLVGAGKNFIAGADIREFGKPPRPPALPDVCNHIEASTKPVVAVLHGAALGGGLEVALAAHYRVALASAKLGLPEVNLGLLPGAGGTQRTPRLIGAAAALDLMLSGKHLSADAALRAGLVDTLADGDDALAAGLAYTRQLLAQGAGPRRSRDATAALADKAAALAQAAAAGERVAQTLRGLYSPAKIVEAVRAAIEQPFDEGLRTERALFLQCRDSPQRAGLVHAFFAERETTKIPELKEAKPRRLDKIGVVGGGTMGAGIAVSVLDAGLPVVMVEQDDAALERGRARVAQVYDRLVKNGRISAQERDARLARLTGATTYDALDDADLIIEAVFEDMDVKLAVFAQLDRVAKLGAVLATNTSYLDINRIASATRGPADVLGLHFFSPANIMKLLEIVVGEHTAPDTVATGFELARRLRKTPVRAGVCDGFIGNRILAVYRQAADMMMEDGASPYDIDAAAREFGYPMGPYQMADLAGGDIGWATRKRRAATRDPALRYVQIPDRLCERGWFGQKTGRGFYQYLDGARVGTPDPEVLAIIDEERRRAGVTPRAFTHEDILRRYLAAMVNEAANVLHEGIALRPSDVDVVFLSGYGFPRHRGGPMHYADSVGAAQVLADIRAFAKEDPAFWKPSPLLVRLAESGGTFASLNQGA
>CP032084.1|AYD64515.1|2597809_2598994_-|acetyl-CoA-C-acyltransferase
MREAVIVSTARTPITKAGRGEFNQIAGPTLAAHAVRAAVERAGIDPAMIEDAFIGCGYPEGATGRNIGRQAVIRAGLPVSVGGATINRYCASGLQAIASAAGRIVMDGAPAVIAGGVELVSQIRTRDDGVSGMDPWILANKPELYLPMIETADIVAARYGISREAQDRFAAQSQARTEAAQAAGRYREEIIAVTTTMSVTDRATGVVSEREVTVDQDTCNRPGTTYEALAGLAPVRGEGQFVTAGNASQLSDGAAACVLMEAAEAQRAGIRPLGAFRGLAIAGCEPDEMGIGPVYAVPKLLARHGLKVQDIDLWELNEAFASQALYCQEKLGIPMDRLNVDGGSIALGHPFGVTGARLAGHVLIEGRRRGARYAVVTMCIGGGMGAAGLFEIYA
>CP032084.1|AYD64514.1|2596594_2597791_-|pimeloyl-CoA-dehydrogenase-large-subunit
MDLEFTPEENAFRDDVRAFLAAKLPRRLSDKVNLGKLLTKDDMVQWHAILNEQGWLATHWPVQYGGTGWSATQKYIFDNECALAAAPRIVPFGLSMLGPVLIKYGNDAQRQYWLPRILDGSDWWCQGYSEPGAGSDLASVKTTAVRDGDHYIVNGQKTWTTLGQYANMIFCLVRTSQEGRRQEGISFLLIDMNSPGIEVRPIITLDGEHEVNEVFFSDVRVPVANLVGEENRGWTCAKYLLTYERTNIAGVGQSTAALERLKAVAAKQKKNGRPLAEDPDFAARLARVEIELANMRTTNLRVVAAVAGGGAPGAESSMLKIRGTQIRQEITALNRRAMGPYARPFVPEALHDGYEAAPIGPEGADSAAAQYFNNRKLSIFGGSNEIQKNIISKMILGL
>CP032084.1|AYD64513.1|2595451_2596585_-|pimeloyl-CoA-dehydrogenase-small-subunit
MNFEHTEDRRMLSDMLRRFVTEQYDFATRERNAQSPQGYSEQFWRRYAELGAIGALFTEADGGLGGAGFDISVVFEALGRGLVVEPFLDALMVGSAIAAAGTPAQREAVDGLIAGSITAALAQAEPDSGYELSRVSTRAERSGEGWVLNGAKAVVTAGEHADLFLVSARTSGAQDDEAGISLFLVSAGTAGLGVRGYGLIDGGRAAEVTLDNVKLGPEALLGDVDAGHAVLERAVGRGILALCAEAVGAMDCARDATLEYLRTRRQFGTPIGSFQALQHRMADVLLEIEQARSAVINAAAALDHPDRATRERALSAAKFTIGRIGTLVAEESIQLHGGIGMTWELPLAHYAKRLVMIDHQLGDEDHHLRRYIALAQA
>CP032084.1|AYD64512.1|2593502_2595434_-|acyl-CoA-synthetase
MTQVHAAPPLSPPFSAPFPVRSAADVQRLQARPLAETLTVQSTYEIFRNSAAAFGDKTALTFLRSADPDDEAIRWSYRDLLAGIHQTANLLHDLGVRADDAVAVMLPGCLEYHLALWGGEAAGIVQPLNPMLTEDKLASLMTAARAKVLIAYGAEAECEMWTKALRLRDRVPTLQTILRVAPHTEALSDRPALPDYALDFNANRSAQPASRLLSERVIRASDVAAYFHTGGTTGAPKLAIHTHANQVFTAWAAVQLQNAGPTDVVINGYPLFHVAGVLPASLAALSAGVETVIPTPMLLRNREVLRNYWRLVEKHRATSLQGVPTILAALADIPLAGADISSLRYCRTGAAPLPAELAARFKRLFGLQVNESLGMTEMAGISSITPPGSVFPVNCVGYPLPYVQVRIVGLDVPSGQAARDLPPGTPGMVLFKAPNVIPGFLDPEDTARAFTEDGWLISGDVGFMDDEGRLHLQGRAKDLIIRGGHNIDPKTIEDALATHPGVHLCAAVGAPDAYAGELPVAFVTLMDGMQVTEAELVAYAAAHVDEGPARPKRVIVLDAMPMTNVGKIYKPDLRRLATAVSVEAVVARTLQAAGLTEDSKIFRVLADAQPDVAVQADADAPTPLKEQLREALARLPVKVALRD
>CP032084.1|AYD64511.1|2592434_2593421_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MLKMPLRRACLGALLLAAVGAAVPLAASAQAAFPTKPITLIVPFPAGGSTDRHLRIVAQDASKYLGQPVIVENRPGAGGTLGTATMARTAKPDGYTIALYTLAMLRMPYMQKSSWDPINDFSFIIGLSGYTFGFTVRSDSPYKTFNEYIEAARKAPGTIDYGSTGIGSSPHLLIEEIAINAKVKLNHVPFKGNADMQQALLGGHVMAQSDATGWDQFVDSGKMRLLVTFGEKRTTRWPDVPTAQELGYKVVSTSPYGLAGPKGMDPAVVKTLHDAFKKALFDQASMDVMKQLNQEPAYRNSEDYKAWAQATYVKEKGLIEYLGLMAKD
>CP032084.1|AYD67595.1|2607056_2608322_-|MFS-transporter
MSSLPAAFRRLAASNLAAQFSEQMALAAAPLVAVLTLGATAAQTGALQAAQTLPFLLLSLPAGVLADRMSRKALMTGAECVRAASLLVLLALLWMGALNLTWLAALGFLGAVGTVAYNVSAPALVPRLVPARDLANANRWLELARSCAFSAGPAAGGALVGWMGAPIAYVLATTLSLLAAVCLAGLPQEAGSDAGAPARDAPPVAAPLRPGILAQLREGAAFVTAHALLRPVLITAVFFNTAWFILQAVYVAYAIDRLGLSATGVGITLGVYGAGMLAGALAAPWLARRLSFGAMIAAGPLTALVASGILLTTLAYPSGVWAALGFFLFGAGPILWTITTTTLRQAVTPNALLGRVSAVILTATFGARPVGALIGAGLAARVGVEACLWASTAGFVIQFLVLFASPVLRLRSQPESVGAGA
>CP032084.1|AYD64519.1|2608493_2609285_-|type-I-methionyl-aminopeptidase
MARKVSIKSAADIAMARKAGAMAAEVLHMIGEHVRPGVTTDELDRICNEYIVNVLKAIPANVGYHGFPKTICASVNHVICHGIPSAKVLKNGDILNIDVAVIKDGWFGDTSRMYYVGQPSPLARRLVNTTYEATRAGIMAVKPGATLGDIGHAIQTVAHREHFSIVREYCGHGIGQIYHDEPQVLHYGRPGEGLVLQPGMMFTIEPMINAGKPATKQLPDGWTVVTKDRSLSAQWEHMVVVTDTGYEVLTPWPDGYGDYPPIP
>CP032084.1|AYD64520.1|2609285_2609528_-|hypothetical-protein
MGLVKISEQMHENLRVASSALSRSINSQAEHWMRIGMLSELYPEMCHADICQLLIRIEQSEGFTIASLSRRTPDAAQEVA
>CP032084.1|AYD64521.1|2609694_2611608_-|radical-SAM-protein
MSTLPIRVLSIIPPMTQLNTPYPSTAYLTGFLRSRGVTAYQEDLALALVLRLLSGDGLRAVADRIATLPLEKHTPAIQAFVAMQPRYLATIGPTIAFLQGRDSTLAHRIVGRNFLPEGPRFSTLDVYMDEDGGDPLGWAFGALGLQDRAKHLATLYLNDLADVLRDAVDSRFEFVRYAESLAGSQPTFDPLANALAGAPTLVDDTLHGLTIDALARHQPTMVLLSVPFPGAVYAAFRIAQTIKAQDPGIITVLGGGFVNTELRELKDPRVFDYFDFVSLDAGERPLLALLEHVQGKRSRQRLVRTFLRDKDSGAVQYVNLVEPDVAFAEVGTPTWDGLPLDRYLSLLDMLNPMHRLWSDGRWNKLTVAHGCYWKKCSFCDVSLDYIGRYEGASASVLADRIEAIVQETGQTGFHFVDEAAPPKSLKALATELIDRNAGISWWGNIRFEKTFSPELCELLADSGCIAVSGGLEVASDRLLNLMKKGVSVDQVARVTRAFSDAGILVHAYLMYGFPTQTVQDTVDALEYVRQLFANDCIQSGFFHRFACTVHSPVGKNPEEYGVTLQPLPPVTFAKNDIGFHDPTGVDHDALGRALKKAIYNFMHGIGLDEDVRTWFPFKVPKTTVSKNRIARALSQQG
>CP032084.1|AYD64522.1|2611720_2612569_-|DUF2894-domain-containing-protein
MSRESRVNSNDDIGGAVDAVNGVDGVDAADAVDSVDAVQAAHAVDTAGAADAADAAGVDVPTLAAQATLDAWGDSGADRLDPVRFRFLQAMARRTAPLQGLARQQLEDKLDTHLRAYAQLLEAVEPDASTMDSAEASPAASATPQTAPAALTELLAYLTYPDAPDNDPTWDRDALGLREAYPDVQMLEYFRGVWSRVSADRQVRQSQEQVHKNAGPLNSNQLVHRALSLMRELSPGYLQQFLSYTDALMWMEQIHAATAPAPKESTRSGAAKKTSRAKARQG
>CP032084.1|AYD64523.1|2612540_2613191_-|hypothetical-protein
MSEDIDGGVEASAPAWAVFGDLMSVLLGAFVLILVSVIGVQLQLSTQLEEEVKQRQEETQRRETLEQALAGPLAAGRVTLINGRIGISGSVLFALNSDQLQPEGREVLKTLIEPLAAYLKTHDEILMVSGYTDDQQVREGNRRFADNWDLSAQRALTVTRALIDEGVPSATVFAAAFGSEQPVASNADEAGRAKNRRVEITPIPKPSNEPGKPREQ
>CP032084.1|AYD64524.1|2613187_2616874_-|DUF802-domain-containing-protein
MFDYNRSKGCLPPFAPANQDTMSKTLINFVVFVAGLAVVGWIGAGYAGTNPLALAVTLLIGVCYLAGAWELLRYQQATSGLARASTSLNEPPASLASWLDQLPASLRNAVRLRVEGERVGLPGPALAPYLVGLLVLLGMLGTFLGMVVTLRGTGMALESATDLGAIRASLAAPVKGLGFAFGTSIAGVATSAMLGLLAALCRRERVQAAQLLDAKIATTLRVYSQSYQREESFKLLQRQAEVMQRQAEAMPTLVDRLQAMMQGMEQQTRSLNERQLASQDAFQGKAEAAYARLAAVMEQSMKEGVAESARSAGVALQPVVQATMESLSRETASLQDTVAQAVQQQLSSLTSGFQASTSNVADIWNQALAGQQRASETLAQDLRASLDRFAETFEQRSAALLDGVSARLEASSGNLSEAWTAALSRQEHVSEKLAGDNLQALTAAAASFEKHSASLLRTLNDSHSLLQSELASRDQQRLAAWTETLGAMGATLRQEWEQAGTQAATRQQAISDTLAQTVRDINAQAAAQASVLEAVSARMEAAANNVSDRWNTALDRQSEVAEKLAADNQQALTTAAAAFEQHSASLLRTLDQSHAELQAALASKDEARLAAWTESLAATAATLRAEWEQAGAQTATRQEAISAALAGTARDIGAQAQAQAQLLQNVSTRLESAANSVSDRWNTALDRHSEVAEKLAADNQQALTTAAAAFEQHSASLLQKLDQSHADLQTALAVKDHERLAAWTGTLTAMAATLGQEWKAAGDHTVARQQEISDALALTALDVTGQTEAQARLLESVSARLETAASSVTQAWTEAQARQEQVSAKLAADNQQALTSAAATFEQHGASLLQKLDQSHADLQAALASKDEARLAAWTGKLAALADALGQEWELAGAQAATRQQELAQALAHTTQTLTAQAEAQASVLETASTRLETAASQVTQAWTDAQTRQEQVNQQLADGNQQALEAAAATFEQHSASLLQTLDQSHADLQAALAAKDEERLAAWTGKLAAVADTLAQTANDITAQTQAHASETITEIGRLVQAASEAPKAAADVIGELRQKLSDSMVRDNDMLQERNRLLETLDTLLNAVNHTAAEQRTAVDALVASSAELLERVGTQFTDRVQAETGKLTDVAAAVTSSAVEVASLGESFGAAVQLFGESNDKLVAHLQRIEAALDKSIARGDEQLSYYVAQAREVVDLSLMSQKQIIENLQQLATQRATAGEQIA
>CP032084.1|AYD64525.1|2616821_2617688_-|DUF3348-domain-containing-protein
MLQAPQRTGLSGPTLIRLLTRLTDVDVPESRQSLSDHLSQWLGWTDAIALSAALNTSPPVIAPGARMFGSAEERECARVRTTLADAIASDTAATSAKRIVPGQAPAKKSAAVEQAEADYSNFRQRYLSLQHTMETSVGNLRSRLRGMVAAKNGEMTRLAVVDAIMDRALLPKERALFGAIPKLLQGHFERLRLAEAAALAPVDAPVDASVDAPVDAPAAEADAAPPTDGAAKLEDGNGKAPAPATATPPVTPGAWLDVFRKDMRSVLLAELDVRLQPVEGLLAALRAS
>CP032084.1|AYD67596.1|2618058_2619288_+|helix-turn-helix-domain-containing-protein
MDLPITRAARALAAGDPLTALNQVSLRDDAPALALRGIAMAQLGDFARANALLRKAARAFGPANPAARARCIVAEAEVALASRDLAWPEKSLAAARTALSVHGDPVNAAHAAYLQARRLLLLGRLDEADRALAGVDAPAMPAASRAIHELIAGGIALRRVRAHDAAAALARAEHAARQAGVPALVAEVDHAVQALHAVAARHVTPDGTRDLTLADAEALLASPALIIDACRNAVRQGERIVPLASRPILFALARLLAQGWPHDVSREFLIARAFRTGFQDDSHRARLRVEIGRLRTALRPLAAVTATRDGFALRPHADLGVIVLARPVDVADRDHAAVLACLVDGQAWSSSALALALGASQRTVQRALDALAASGQVLPLGHGRARRWTTPSVPAFTTSLLLPTLMPGQ
>CP032084.1|AYD64526.1|2619320_2619953_+|glutamine-cyclotransferase
MKRSQAEIVREYGPFPGADAVHGVSYDGRHVWVALGEMLIALDPESGETLRTLDVVANAGTAFDGKHLYQIAEGKIQKLDPVSGKVLASIPAPGGGDDSGMAWADGSLWVGQYQQRKIHQVDPETGRVLRTIDSNRYVTGVTWVDGQLWHGTWEENARELRRLEPDTGAVLESIDMPEGVGVSGLESDGADRFFCGGGNAGKVRAVRRPT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP032084_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032084_4

4036539-4036671

Orphan

Consensus_repeat	Method
GCGCTGCCCCCCGAGGGGGCTACCCCCGCCTTGGGGCGGCCCGGCGGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032084_4

>merge|CP032084|4|4036539-4036671|CRISPRCasFinder
GCGCTGCCCCCCGAGGGGGCTACCCCCGCCTTGGGGCGGCCCGGCGGCGCAGGGTTGCCCCCACGCGCCAGGCCCTCCGGGCCCGCGCTGCCCCCCGAGGGGGCTACCCCCGCCTTGGGGCGGCCCGGCGGCG

>CP032084|4|4|4036539-4036671|CRISPRCasFinder
GCGCTGCCCCCCGAGGGGGCTACCCCCGCCTTGGGGCGGCCCGGCGGCG	CAGGGTTGCCCCCACGCGCCAGGCCCTCCGGGCCC
GCGCTGCCCCCCGAGGGGGCTACCCCCGCCTTGGGGCGGCCCGGCGGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP032084.1\|AYD65631.1\|4040539_4041442_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133055
CP032084.1\|AYD65630.1\|4039200_4040517_+\|polysaccharide-biosynthesis-family-protein	unknown	unknown	gnl\|CDD\|240533
CP032084.1\|AYD65625.1\|4031757_4032894_-\|multidrug-MFS-transporter	unknown	unknown	gnl\|CDD\|237903
CP032084.1\|AYD65635.1\|4044776_4045337_+\|colanic-acid-biosynthesis-acetyltransferase-WcaF	unknown	unknown	gnl\|CDD\|236703
CP032084.1\|AYD65626.1\|4033138_4034548_+\|undecaprenyl-phosphate-glucose-phosphotransferase	unknown	unknown	gnl\|CDD\|274396
CP032084.1\|AYD65627.1\|4035076_4036507_+\|mannose-1-phosphate-guanylyltransferase/mannose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|273648
CP032084.1\|AYD65623.1\|4027990_4029394_-\|phosphomannomutase/phosphoglucomutase	unknown	unknown	gnl\|CDD\|100091
CP032084.1\|AYD67733.1\|4025224_4026298_-\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|187558
CP032084.1\|AYD65620.1\|4023290_4024109_-\|NAD-dependent-protein-deacetylase	unknown	unknown	gnl\|CDD\|235415
CP032084.1\|AYD67734.1\|4034618_4035071_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|239522
CP032084.1\|AYD65629.1\|4038204_4039167_+\|GDP-L-fucose-synthase	unknown	unknown	gnl\|CDD\|187550
CP032084.1\|AYD65633.1\|4042751_4043879_+\|glycosyltransferase	unknown	unknown	gnl\|CDD\|340839
CP032084.1\|AYD67735.1\|4036685_4037078_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227939
CP032084.1\|AYD65632.1\|4041454_4042759_+\|O-antigen-ligase-domain-containing-protein	unknown	unknown	gnl\|CDD\|377422
CP032084.1\|AYD65622.1\|4026309_4027977_-\|glucose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234679
CP032084.1\|AYD65628.1\|4037088_4038198_+\|GDP-mannose-4,6-dehydratase	unknown	unknown	gnl\|CDD\|224014
CP032084.1\|AYD65634.1\|4043892_4044780_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
CP032084.1\|AYD65621.1\|4024128_4025076_-\|serine-acetyltransferase	unknown	unknown	gnl\|CDD\|200082
CP032084.1\|AYD65624.1\|4029414_4031676_-\|tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|273391
CP032084.1\|AYD65636.1\|4045333_4046626_+\|colanic-acid-biosynthesis-glycosyltransferase-WcaI	unknown	unknown	gnl\|CDD\|236670

Protein	Function_ID	Function_description	E-value
CP032084.1\|AYD65631.1\|4040539_4041442_+\|glycosyltransferase	gnl\|CDD\|133055	cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	5.13686e-78
CP032084.1\|AYD65630.1\|4039200_4040517_+\|polysaccharide-biosynthesis-family-protein	gnl\|CDD\|240533	cd13128, MATE_Wzx_like, Wzx, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli Wzx and related proteins from other gram-negative bacteria are thought to act as flippases, assisting in the membrane translocation of lipopolysaccharides including those containing O-antigens. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	8.25186e-24
CP032084.1\|AYD65625.1\|4031757_4032894_-\|multidrug-MFS-transporter	gnl\|CDD\|237903	PRK15078, PRK15078, polysaccharide export protein Wza; Provisional.	6.4636e-96
CP032084.1\|AYD65635.1\|4044776_4045337_+\|colanic-acid-biosynthesis-acetyltransferase-WcaF	gnl\|CDD\|236703	PRK10502, PRK10502, putative acyl transferase; Provisional.	4.98458e-99
CP032084.1\|AYD65626.1\|4033138_4034548_+\|undecaprenyl-phosphate-glucose-phosphotransferase	gnl\|CDD\|274396	TIGR03023, Sugar_transferase., Undecaprenyl-phosphate glucose phosphotransferase. This family of proteins encompasses the E. coli WcaJ protein involved in colanic acid biosynthesis, the Methylobacillus EpsB protein involved in methanolan biosynthesis, as well as the GumD protein involved in the biosynthesis of xanthan. All of these are closely related to the well-characterized WbaP (formerly RfbP) protein, which is the first enzyme in O-antigen biosynthesis in Salmonella typhimurium. The enzyme transfers galactose from UDP-galactose (NOTE: not glucose) to a polyprenyl carrier (utilizing the highly conserved C-terminal sugar transferase domain, pfam02397) a reaction which takes place at the cytoplasmic face of the inner membrane. The N-terminal hydrophobic domain is then believed to facilitate the "flippase" function of transferring the liposaccharide unit from the cytoplasmic face to the periplasmic face of the inner membrane. Most of these genes are found within large operons dedicated to the production of complex exopolysaccharides such as the enterobacterial O-antigen. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase, and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity.	0
CP032084.1\|AYD65627.1\|4035076_4036507_+\|mannose-1-phosphate-guanylyltransferase/mannose-6-phosphate-isomerase	gnl\|CDD\|273648	TIGR01479, Mannose-1-phosphate_guanylyltransferase, mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase. This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase (EC 5.3.1.8) (PMI) and mannose-1-phosphate guanylyltransferase (EC 2.7.7.22) in Pseudomonas aeruginosa, Xanthomonas campestris, and Gluconacetobacter xylinus. The literature on the enzyme from E. coli attributes mannose-6-phosphate isomerase activity to an adjacent gene, but the present sequence has not been shown to lack the activity. The PMI domain is C-terminal. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
CP032084.1\|AYD65623.1\|4027990_4029394_-\|phosphomannomutase/phosphoglucomutase	gnl\|CDD\|100091	cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e.g. between mannose-1-phosphate and mannose-6-phosphate or glucose-1-phosphate and glucose-6-phosphate) via a bisphosphorylated sugar intermediate. The reaction involves two phosphoryl transfers, with an intervening 180 degree reorientation of the reaction intermediate during catalysis. Reorientation of the intermediate occurs without dissociation from the active site of the enzyme and is thus, a simple example of processivity, as defined by multiple rounds of catalysis without release of substrate. Glucose-6-phosphate and glucose-1-phosphate are known to be utilized for energy metabolism and cell surface construction, respectively. PMM/PGM belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the phosphoglucomutases (PGM1 and PGM2). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
CP032084.1\|AYD67733.1\|4025224_4026298_-\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	0
CP032084.1\|AYD65620.1\|4023290_4024109_-\|NAD-dependent-protein-deacetylase	gnl\|CDD\|235415	PRK05333, PRK05333, NAD-dependent protein deacetylase.	1.70402e-172
CP032084.1\|AYD67734.1\|4034618_4035071_+\|NUDIX-domain-containing-protein	gnl\|CDD\|239522	cd03430, GDPMH, GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily. This class of enzymes is unique from other members of the superfamily in two aspects. First, it contains a modified Nudix signature sequence. The slight changes to the conserved sequence motif, GX5EX7REUXEEXGU, where U = I, L or V), are believed to contribute to the removal of all magnesium binding sites but one, retaining only the metal site that coordinates the pyrophosphate of the substrate. Secondly, it is not a pyrophosphatase that substitutes at a phosphorus; instead, it hydrolyzes nucleotide sugars such as GDP-mannose to GDP and mannose, cleaving the phosphoglycosyl bond by substituting at a carbon position. GDP-mannose provides mannosyl components for cell wall synthesis and is required for the synthesis of other glycosyl donors (such as GDP-fucose and colitose) for the cell wall. The importance of GDP-sugar hydrolase activities is thus closely related to the regulation of cell wall biosynthesis. Enzymes in this family are believed to regulate the concentration of GDP-mannose and GDP-glucose in the bacterial cell wall.	7.8071e-59
CP032084.1\|AYD65629.1\|4038204_4039167_+\|GDP-L-fucose-synthase	gnl\|CDD\|187550	cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs. GDP-fucose synthetase (aka 3, 5-epimerase-4-reductase) acts in the NADP-dependent synthesis of GDP-fucose from GDP-mannose. Two activities have been proposed for the same active site: epimerization and reduction. Proteins in this subgroup are extended SDRs, which have a characteristic active site tetrad and an NADP-binding motif, [AT]GXXGXXG, that is a close match to the archetypical form. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.86978e-175
CP032084.1\|AYD65633.1\|4042751_4043879_+\|glycosyltransferase	gnl\|CDD\|340839	cd03811, GT4_GT28_WabH-like, family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.	2.25494e-76
CP032084.1\|AYD67735.1\|4036685_4037078_+\|hypothetical-protein	gnl\|CDD\|227939	COG5652, COG5652, Predicted integral membrane protein [Function unknown].	1.02503e-06
CP032084.1\|AYD65632.1\|4041454_4042759_+\|O-antigen-ligase-domain-containing-protein	gnl\|CDD\|377422	pfam04932, Wzy_C, O-Antigen ligase. This group of bacterial proteins is involved in the synthesis of O-antigen, a lipopolysaccharide found in the outer membrane in gram-negative bacteria. This family includes O-antigen ligases such as E. coli RfaL.	6.86624e-10
CP032084.1\|AYD65622.1\|4026309_4027977_-\|glucose-6-phosphate-isomerase	gnl\|CDD\|234679	PRK00179, pgi, glucose-6-phosphate isomerase; Reviewed.	0
CP032084.1\|AYD65628.1\|4037088_4038198_+\|GDP-mannose-4,6-dehydratase	gnl\|CDD\|224014	COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane].	0
CP032084.1\|AYD65634.1\|4043892_4044780_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	4.36308e-51
CP032084.1\|AYD65621.1\|4024128_4025076_-\|serine-acetyltransferase	gnl\|CDD\|200082	TIGR01172, Serine_acetyltransferase, serine O-acetyltransferase. Cysteine biosynthesis [Amino acid biosynthesis, Serine family].	5.7934e-54
CP032084.1\|AYD65624.1\|4029414_4031676_-\|tyrosine-protein-kinase	gnl\|CDD\|273391	TIGR01005, Putative_tyrosine-protein_kinase_EpsB, exopolysaccharide transport protein family. The model describes the exopolysaccharide transport protein family in bacteria. The transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis. Detailed molecular characterization and gene fusion analysis revealed atleast seven gene products are involved in the overall regulation, which among other things, include exopolysaccharide biosynthesis, property of conferring virulence and exopolysaccharide export. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.52223e-163
CP032084.1\|AYD65636.1\|4045333_4046626_+\|colanic-acid-biosynthesis-glycosyltransferase-WcaI	gnl\|CDD\|236670	PRK10307, PRK10307, colanic acid biosynthesis glycosyltransferase WcaI.	0

>CP032084.1|AYD65627.1|4035076_4036507_+|mannose-1-phosphate-guanylyltransferase/mannose-6-phosphate-isomerase
MTNPPPAYRAVILCGGSGSRLWPLSRELLPKQFIRLTDSRSLLQNTLLRLGSAGAQAKPMLVCNDAHQYIAAEQAQELGIKDAEVILEPFARNTAPAIAAATLRAMRDGEDPIMLIMPSDHVLEDGDVLRQAFAQAYEAARQGALVTFGITPTAPLSGYGYIQSDEPGVMAPARRVRRFVEKPSPEVAQRLIDDGGYYWNSGMFAFQASVFLSEMARLAPKMLEQVQAAVATGHGEAGLFHLDGPSFEACPSDSMDYAIMERTDSAVVIPLAASWSDVGAWDAVWGIAQKTVEGNSTTGDVMVEDSRNCLIHSTSRLVASVGLDDIVVIETADAVLVAHKSRSQDVKRLVEIFKTQHRSELNHHREVQRPWGSYDSVGHGPRYQVKRITVKPGARLSSQMHHHRAEHWIVVSGTARIYNGDKQYLLTENQSTYIPLGETHSLENPGKIPLEIIEVQSGAYLGEDDIVRFQDMYGRV
>CP032084.1|AYD67734.1|4034618_4035071_+|NUDIX-domain-containing-protein
MLPRADFRQAVEMLPLVSIDLLLRDGAGRYLTGLRTNPPARGAWFVPGGRIRKNEPLRTALDRIAREELGLAIAPESWTPRGVYEHFYGTNFAGEAGRSTHYVVLAYEAELSLDTATLPRGQHHGYRWLQAEEIAADPGVHPYTQAYFKE
>CP032084.1|AYD65626.1|4033138_4034548_+|undecaprenyl-phosphate-glucose-phosphotransferase
MDPSHSDTSARFSGASYLYRLLDAAIVITCGLTATGLKFSEDAMADPPQIHLFLIYLCGLGVIALFPAFRLYVSWRGRLLTDLVVRSLAAWATVFALGILVSFLMHQTAAISRMWAATWFGMAALTLAGVRIAVYAALGAARDRGLNKKNVLLVGFGALGHDLWRRVERYRGAGYEVAGIYAEPHESLPPQVRRLHDLDNLHSFVHENNVREIWIVLPMEAGQELREVLYHLRNDLVDIRWIPDVMSIQLLGHRIGEFLGLPAIQLNSLPAAGVRGWAKEVFDRGFAFFALIGLAPLMLSIALAIKLTSRGPVFFTQPRLGVDGKVFHVYKFRTMTVHQEHGTVTQATRNDTRITRIGGFLRRTSLDELPQFLNVLMGDMSVVGPRPHALEHNEMYKDLVQRYMMRHRVKPGITGWAQVNGFRGQTDTLRKMSDRVEHDIYYIQHWTFRMDLLIIARTAVSGWTGRNVY
>CP032084.1|AYD65625.1|4031757_4032894_-|multidrug-MFS-transporter
MTTFFGTLSRAIAAIALVSSLGACALSPGMTFNSGHLVDPMDPNSVAPIKEITPSLVVDDLRNRQALIDNDGVEKLVGSVEPYRIGPGDILSIVVWDHPELVLPTQTYAIGTGVTELVMGDTASGIPGYTVSSTGYIQFPYTGLLKVAGLTELQARNLIVNSSGKYIQDPQITVRVLGYRSKRVYVEGEVKLPGTVAINDIPMTLLEAVNRAGGLLPTADRSAVYVIRDGRRTRVNLPALIERGQDLNQVMLKSGDIVRVTPRDDSKIFVMGEVFLPTTVVMRDGRMSLTEALGMAGGPNQLTADASQVFVVRSTEQATPQVFHLNAKSPQALAVGAKFELEPKDVVFVDTAALVRWNRFISNLFPSAQTVQTVKSIN
>CP032084.1|AYD65624.1|4029414_4031676_-|tyrosine-protein-kinase
MSLPIEAFEPNVPARQQETPLSSHVDAIISNRWMILGITLLAFLGALAYVMVTPSVYSADIIVQVEEEMPNGQARSLLGDVSAMFDTKAETSGEMEVLRSRMVVGPAVDKFLLYIHAKPRYFPVVGEWLAQRYEALPYPSSLPRGGYAWGGEQIAISQLDVPNEWLGKPFRVTTQGEGRYTLTDKFTGATFSGAVGKPEHFLLPGGGAMDVHIDALTGRPGTEFTISRSSRLAAIENVQSHLGIFERGRASGVIGVTLEGNDPALTTAVLNQIGQEYVQQNVNRKAAQAEKSLGFLEQQLPILKGELDAAETKYNALRNKRGTIDLSEEAKLILAQSVDAQTKVMELRSKRQELITRFAPTHPSIVAIDRQIASLSGDVSRIGNNIKALPDLEQDVVRLVRDVRVNTELYTGLLNNAQQLRLIRAGKVGNVRILDAAVQPDRPVRPKAAIIIGVATVIGLIFGMLCAFVRNALFGGLSEPDDVERYTGLPVLAAIPYSDMQDKLWRRSRRKNATVPALLAQSQGNAPPIESLRSFRNVLQASLRQSANNMVMFTGPVAGVGKSFLSANFAFIQGGVGKRVLLIDADFRKGQLNRYFGVPKEDGLFEVLSGTIPLARVRKHSVSEGVDFIATGAVTFDPSELLASPVFGATLRELSSQYDMVILDTAPVLSSPDAAVVGTHAAAVMVVVRSGMNTVGEIRETAKRLIQAGAPVDGVLFNGLKLMPERFGFRSKYGNYRYSRAAYYGDFKQNGPK
>CP032084.1|AYD65623.1|4027990_4029394_-|phosphomannomutase/phosphoglucomutase
MHGTFGWDTPQILDAVFKAYDIRGTVPDEIDARFAHSLGMAAGTKARELGARSMVVGRDGRLSSVELAAALQAGLRSAGMHVIDIGMATTPMVYFATRLMDTGAGIAVTGSHNPPAHNGFKIVLDGASLYGDGITALRDAMRLPIESASVSGGRTQMQIQPCYAARLVGDIRMARPMKIAIDCGSGVAGAVAPALFRALGCEVTELFCEVDGSFPGHHPDPADPQNLQDLIYCLRYSDCEVGLAFDGDGDRLGVVTKSGQIIWPDRQLILFARDVLSRNPGAEVLYDVKCSRHVARAIFEAGGKPTMCKTGHSLIKAKMRESGALLAGEMSGHMFFKERWYGFDDGIYAAARLLEILSAAPDPSALLEGLPQSCATPEIKLDTAEGEQFELVKLLREQGEFPSAVSINDLDGVRVDYVDGFGLARPSNTTPTVVLRFEGDTVAALARIEEDFRNAFRRIAPLVRLPF
>CP032084.1|AYD65622.1|4026309_4027977_-|glucose-6-phosphate-isomerase
MGKANFAIEALRADSGLAQSPEWQAFAQAAEAAELDANTLKVIEAAGLCVDLTMQRQSPALEAAALNLLQARGLADARHALFTGEPVNWTEGRPAWHTAVRAGRTPEQPDGLDADSVCEYSRMSDFVRRVDQTADFSTVLHIGIGGSDWGPRLAVQAFGGPSQRRQIRFVSNIDGHAFHDAVAGLDPRRCLVVISSKSFTTSETMHNARAAIAWLKQGGVADVSEHLAAVTANVSAARALGVPASHTFKMCDWVGGRYSVWSVAGLSIALTVGADVLIGMRAGAEAMDQHFQNAPFAANAPIQLALAGLVNCSVLGYNSLNIAAYSARLLHLVTYLQQLEMESLGKRVAGDGTAVGVPTAPIIWGMPGTDGQHTFFQWLHQSEDGAPVDFIASLQGHADSPDAHRHLLANCLAQRQALLRGKNLEQALQDVAHIDDQEKALSLAQHMVHPGGRPSTLIVLRQLDPRGLGALLALYEHKVFVQSVVWGINPFDQFGVELGKRLATGIDRELAVPVSAGVVDWGHDASTSYWIDRYRSHTQAPRPRHAWVPGVAAHL
>CP032084.1|AYD67733.1|4025224_4026298_-|UDP-glucose-4-epimerase-GalE
MSGMHVLVTGGAGYIGTHTLIAMLAAGQRPLVLDNFSNGSREAVRRVERLCGQPIALIEGDIRTPGLIERVLSDAAARGQPVQAVLHLAGCKAVGESVADPLKYYDNNVTGSMVLLRAMREAGVSRLVFSSSATVYGEPQFLPFTEAHPLAPANPYGRTKLMVEEMLRDVCTADPSFSAVTLRYFNPIGAHPSGQIGESPRDLPNNLFPYLTQVAVGRQPFLRVFGNDYDTVDGTGVRDYLHVMDLAQGHVQALAYGAGQSGFVAVNLGTGHGTSVLELVRAFEAASGLRIPVQIMPRRPGDVARTWADPSLAESLLGWRSTYDVAAMCADGWRWQQGNPQGYEADDASQGVQAAVA
>CP032084.1|AYD65621.1|4024128_4025076_-|serine-acetyltransferase
MNGPTYIPPAHWNLDSIVSGLREARVAWRGPRGRLREDSGLREFPSQESLRQIIKDLCGALFPMRLGPIDLREEVEDFYVGHTIGAALDALLHQVCLELQYVGRHEHVDPAETQRRAIEIVRQFGAELPRVRAALDLDVTAAYQGDPAAHSVDEVLLCYPGVAAMIHHRLANVLYRLNVPMLARIVAEIAHADTGIDIHPGATIGRSFFIDHGTGVVIGETAIIGDRVRLYQMVTLGAKRFPPGENGELKKGLPRHPLIEDDVVIYAGATILGRVTIGKGSTIGGNVWLTRSVPPGSNVTQASLVSDMPDCGLGG
>CP032084.1|AYD65620.1|4023290_4024109_-|NAD-dependent-protein-deacetylase
MDTQVSDLAALRGFVDRHPRLFVLTGAGVSTDSGIPDYRDTEGEWKRKPPMTLQTFMGDDLARARYWARSMVGWRRFGHVQPNESHRALARLQARGLITVLVTQNVDGLHEAAGSRDVVDLHGRLDEVRCMNCDWRGGRADWQDRLQNGNPAWTSLDATDAPDGDADLEGEDFSQFTVPPCPRCGGIVKPDVVFFGETVPRDRVDRANAGLMSADAVLVVGSSLMVYSGYRFVTAASRNGMPIAAINLGRTRADSLLTLKVEQPCAVALEAL
>CP032084.1|AYD67735.1|4036685_4037078_+|hypothetical-protein
MDGEPFWRPGVARLCLPVAGLFFGVLITVGNLPGLAAEMSDAFGDKRLHLLAYAVLTGLIYLSVNRRPALVAMLAVTALGALDESIQSFFPYRQAELLDLLADILAAGATVISLHIGSAAFGSFRAVTKS
>CP032084.1|AYD65628.1|4037088_4038198_+|GDP-mannose-4,6-dehydratase
MPKRALITGVTGQDGAYLAEFLLAKGYEVHGIKRRASLFNTARIDHLYQDPHDKPRNFVLHHGDMTDSCSLIRIVQSVQPDEIYNLAAQSHVGVSFEEPEYTANADGLGTLRLLEAIRILKLENKARFYQASTSELYGLVQETPQKETTPFYPRSPYAAAKLYAYWISVNYREAYGMYACNGILFNHESPKRGETFVTRKITRGLARIVLGLQECLYLGNLSALRDWGHARDYVEMQWLMLQQDTPEDYVIATGLQYSVREFINTAARELGILLAWEGEGLEETATVLFSPVHDVKPGQVIVRVDPRYFRPTEVETLLGDPTKAREKLGWSPRTTFAELVKEMVEADLKDARRDALVEQNGYEIYAYKE
>CP032084.1|AYD65629.1|4038204_4039167_+|GDP-L-fucose-synthase
MTNLDQRVFVAGHRGMVGAAITRELHRRGYPNVLTRSRAELDLENQNQVHRFFSTTPVDVVYLAAAKVGGILANQNHPVDFLYKNLMIQCNVIRAAYAAGVRKLLFLGSSCIYPREAPQPIREDALLTGPLEATNEPYAIAKIAGLKLCEAYQREYGARFICAMPTNLYGPHDNYDLHSSHVLPALIRKFHEGREAGQDSVTIWGTGTPLREFLYVDDLAKASVMLMEHPDAEGIYNIGAGKDISIADLAALVARVVGYQGRIVYDTGKPDGTPRKLMDSSRVTALGWQPAVSLTEGIALAYQHFLRERADQSQSALPVA
>CP032084.1|AYD65630.1|4039200_4040517_+|polysaccharide-biosynthesis-family-protein
MFGFVRKHIAGNASFWGLVEYGIGPVAALIALPILFRQLGTVGFGQYSMIIALAGFGNAANLGAAVTATKLVSERMHEPGGAYRAAGVSMSLIGCALGVVTLAAVLLWAVVGLAWPAATFGGVAVTLLALPALAIYLTQQYDQLFSGCLKGREDFRATALCEVFSRSGTMALACATAWMTASPTYTGLAQALGLLVAGSVKMRVFSRTYGHVLVRPVRDRGAMMDAFKFSRWSWLNSLSALAFGSVDRVLVGSMMGPAALAIYTVGVQVGQIIHTASVAIFQKAMPRVTRLSVSPPYAGAVEREIRRMMGWNLVLSATATLAVLAVSHPLLNLLLGDNVAAGHLGTFQLLIVASGLLSLNAAAHFSLLGLGNSRAVAILNGLGGLAMLCVMAGLVHAAGEHAAAWGRMAYAAITLAGVALAIRQSRPEFPGALPAATR
>CP032084.1|AYD65631.1|4040539_4041442_+|glycosyltransferase
MRKRHNEYSRQLIDFVRELRPPAPIAGGLLPKVTIVTPSYNQAKFLERTILSVLNQGYPRLEYIIIDGGSTDGSVDIIRKYERYLTYWESTPDRGQSHAINKGFERATGDYVGWQNSDDLYFPGALRKLGAAAARGRAPIVSGNLFVADANNHIFRKIHYTPVNRGTLTVVKASIPNQSAIFRRDLLRKYGLLQESMRYCMDLELWSRLLREGKNLIVPDALGVYTAHDETKTALMQDVLLEEREQIVTRIRRTEPGLGKLFELSCRASKVAAHARQGDLSYLFEKLTTKIFGRDDWAAH
>CP032084.1|AYD65632.1|4041454_4042759_+|O-antigen-ligase-domain-containing-protein
MSPHRRLSTLHLLGLFAFTALALNDDRFILGVGSFKLSPFDVLFVAMLAVKALRLAEPSAYALPRGLLGALLGLQAMSVIYLLLVSMHHPGIETGDVARDLRIVFYFLCTPFLCYKDIDSPAAYAVLQKYIVAACLAVATLMLLEQLQGFSVSNPLRNVRLGVWAIPFGVVSLLTFRRTLNVSGPKAYALTLYMLLALVFSLNRSQYLQLAISVVIAVLLGTGPELRRRAVLIFAPAAVAGVLVFASIGYLDVLSNRIFSVEKLDEDSSYGARIQEMQGQMDYFAESPVFGKGAGFRSWVMGENGFELSTFAHNSWAFYLMKFGVVGTIMIMLPPLLILLLTLLRRYAHPGLEMHRRYLLATAPIYIFIDSLSGGLAYAPKTAFTGFLLCYCLSLMRNAQIMPVPRADAPRAPLSPSHRPDAVRRTPPRVIPHA
>CP032084.1|AYD65633.1|4042751_4043879_+|glycosyltransferase
MPDVLFVAPDLHGGVGRCVAFIVDALPEQGVDSGLFLLRSRNREYPVANPKVTRALPIIESPTKLRLMLPVAFMRLLAQIRRDKPAIVCSHGLLCNMLVVLARKLLGGTFRTVAFEHSSPAIHYGASRMRRLKCWLVSQTYRRHDAVVGVSRGVKEDLVSMFPPLRGKVHTIYNGVPLDNVRRQGAQRTQGDAAAPYHVVAVGRLEAVKDYATLVDAAALLDDPGIAFTILGEGSEHDALQKRIDERPSRSPVTLAGHIDNPFPVIASAGAFVLTSIRESFGNVLVEALCLGVPVISTDCPHGPAEILDAGRYGLLVPVGDAAALADAVRRLAYDAKMREQLAAQGPERADAFSLERHCRNVIALFQPLMQRGTP
>CP032084.1|AYD65634.1|4043892_4044780_+|glycosyltransferase-family-2-protein
MQKIPVSVVVMTKNEERNIAKCLKALVEFDEVFVVDSNSTDATCAMATALGARVSNFQWNGKYPKKKQWCLEQLPFSHPVVLYVDADEEMTPQLAAEIREVLPRFAAGAGGAFVPFDYVFCGKKLVHGHRVYKLALLARDQSRFLDYDDLDVAHMWEVEGHYQPQVKGETFALRQRMVHNDHDSLFHYFDKHNRYSDWEANLRTKGLMNDPREANVGARALLKRIFQAMPFKAPISFLHSYVFRLGFLDGKAGYDYAVARAMYYWQIRIKTEELQKARLARANGTQADAVPGAAK
>CP032084.1|AYD65635.1|4044776_4045337_+|colanic-acid-biosynthesis-acetyltransferase-WcaF
MSALQQLDRFALAPGQRGRSALTVQLWWTVQATLFRWSPQVAYGFRRWLLRCFGAQVGKKVLIRPSATVTYPWKVQIGDYAWIGDDAVLYSLGPIHIGAHAVVSQRSYLCAADHDAGQPDFPLRERAVRVEDGAWVATDVFVGPGVTIGREAVVGARSSVFRNMPAAMVCHGNPCRPVRPRMATAP
>CP032084.1|AYD65636.1|4045333_4046626_+|colanic-acid-biosynthesis-glycosyltransferase-WcaI
MKILIYGINYAPELTGIGKYSAELAEWLAAHGHQVSVVTAPPYYPQWQVHDGYRAGRYRKEERRGVTVRRAPLWVPARPGGLKRLIHLASFAVSSLPSLLRAAAGRPDLILVVEPALFCAPAAWITARLCGARAWLHIQDYEVDAAFELGLLKGAGLRALVKRGERWLMRRFDRVSTISNRMLDLAIAKGVEPDRAVLLPNWIDVNAITPRTEGGDYRAQLGIPANAIVALYSGNMGGKQGLQTLADVARRLGRESRLWFIFCGQGPERAPLEAACQGLPRVRFLDLQPADRLGALLNTADIHLLPQRAGAADLVMPSKLTGMLASGRPVVCGAAPGTELAGVVARCGLLTPPEDAEAMAEAVRKLSYNAQIRETLGAAARQYALNHLHVDAVLAAAEREFAKVVGKRATKGAAATAAAAVDAVPREGER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP032084_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032084_6

4836982-4837098

Orphan

Consensus_repeat	Method
CGGGCCGCCCCAAGGCGGGAGACGCCCCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032084_6

>merge|CP032084|6|4836982-4837098|CRISPRCasFinder
CGGGCCGCCCCAAGGCGGGAGACGCCCCCTCAGGGGGCAGCAAGCACGCCTAGCGTGCGCCGCGTGGGGGCATTCCCTCCCGCCGCCGGGCCGCCCCAAGGCGGGAGGCGCCCCCTC

>CP032084|6|6|4836982-4837098|CRISPRCasFinder
CGGGCCGCCCCAAGGCGGGAGACGCCCCCTC	AGGGGGCAGCAAGCACGCCTAGCGTGCGCCGCGTGGGGGCATTCCCTCCCGCCGC
CGGGCCGCCCCAAGGCGGGAGGCGCCCCCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP032084.1\|AYD66281.1\|4829881_4832758_+\|formate-dehydrogenase-subunit-alpha	unknown	unknown	gnl\|CDD\|225918
CP032084.1\|AYD66289.1\|4842131_4842560_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
CP032084.1\|AYD67802.1\|4844201_4844651_+\|azurin	unknown	unknown	gnl\|CDD\|259989
CP032084.1\|AYD66283.1\|4833694_4833952_+\|formate-dehydrogenase	unknown	unknown	gnl\|CDD\|378656
CP032084.1\|AYD66284.1\|4834026_4835694_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340911
CP032084.1\|AYD66291.1\|4845592_4847107_+\|DUF1800-domain-containing-protein	unknown	unknown	gnl\|CDD\|378055
CP032084.1\|AYD66280.1\|4828261_4829866_+\|NADH-quinone-oxidoreductase-subunit-NuoF	unknown	unknown	gnl\|CDD\|224806
CP032084.1\|AYD67800.1\|4837156_4837759_-\|DUF1345-domain-containing-protein	unknown	unknown	gnl\|CDD\|377769
CP032084.1\|AYD66286.1\|4838032_4838557_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
CP032084.1\|AYD67801.1\|4842743_4844030_+\|sorbosone-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|225044
CP032084.1\|AYD66288.1\|4841688_4842114_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP032084.1\|AYD66290.1\|4844775_4845480_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
CP032084.1\|AYD66279.1\|4827695_4828265_+\|formate-dehydrogenase-subunit-gamma	unknown	unknown	gnl\|CDD\|180339
CP032084.1\|AYD66277.1\|4825276_4826392_-\|GTP-3',8-cyclase-MoaA	unknown	unknown	gnl\|CDD\|234672
CP032084.1\|AYD66287.1\|4838553_4839129_-\|chromate-transporter	unknown	unknown	gnl\|CDD\|376780
CP032084.1\|AYD67799.1\|4824651_4825266_-\|molybdenum-cofactor-guanylyltransferase	unknown	unknown	gnl\|CDD\|234725
CP032084.1\|AYD66285.1\|4835833_4836955_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225443
CP032084.1\|AYD66292.1\|4847103_4848510_+\|DUF1501-domain-containing-protein	unknown	unknown	gnl\|CDD\|226587
CP032084.1\|AYD66282.1\|4832786_4833617_+\|formate-dehydrogenase-accessory-sulfurtransferase-FdhD	unknown	unknown	gnl\|CDD\|234823
CP032084.1\|AYD66278.1\|4826434_4827514_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378934

Protein	Function_ID	Function_description	E-value
CP032084.1\|AYD66281.1\|4829881_4832758_+\|formate-dehydrogenase-subunit-alpha	gnl\|CDD\|225918	COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only].	0
CP032084.1\|AYD66289.1\|4842131_4842560_+\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	1.08682e-26
CP032084.1\|AYD67802.1\|4844201_4844651_+\|azurin	gnl\|CDD\|259989	cd13922, Azurin, Azurin is a redox partner for enzymes such as nitrite reductase or arsenite oxidase. Azurin is a bacterial blue copper-binding protein. It serves as a redox partner to enzymes such as nitrite reductase or arsenite oxidase. The copper of Azurin is tetrahedrally coordinated by a cysteine, 2 histidines, and a methionine residue. The electron transfer reactions are carried out with the Cu center transitioning between the oxidized Cu(II) form and the reduced Cu(I) form. Azurin can function as a tumor suppressor; it forms a complex with p53 that triggers apoptosis in various human cancer cells.	1.92027e-79
CP032084.1\|AYD66283.1\|4833694_4833952_+\|formate-dehydrogenase	gnl\|CDD\|378656	pfam11390, FdsD, NADH-dependant formate dehydrogenase delta subunit FdsD. FdsD is the delta subunit of the enzyme formate dehydrogenase. This subunit may play a role in maintaining the quaternary structure by means of electrostatic interactions with the other subunits. The delta subunit is not involved in the active centre of the enzyme.	8.29145e-29
CP032084.1\|AYD66284.1\|4834026_4835694_+\|MFS-transporter	gnl\|CDD\|340911	cd17353, MFS_OFA_like, Oxalate:formate antiporter (OFA) and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of Oxalobacter formigenes oxalate:formate antiporter (OFA or OxlT) and similar proteins. O. formigenes, a commensal found in the gut of animals and humans, plays an important role in clearing dietary oxalate from the intestinal tract, which is carried out by OFA/OxlT, an anion transporter that facilitates the exchange of divalent oxalate with monovalent formate, the product of oxalate decarboxylation. This exchange generates an electrochemical proton gradient and is the source of energy for ATP synthesis in this cell. The OFA-like subfamily belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.78688e-116
CP032084.1\|AYD66291.1\|4845592_4847107_+\|DUF1800-domain-containing-protein	gnl\|CDD\|378055	pfam08811, DUF1800, Protein of unknown function (DUF1800). This is a family of large bacterial proteins of unknown function.	3.64181e-99
CP032084.1\|AYD66280.1\|4828261_4829866_+\|NADH-quinone-oxidoreductase-subunit-NuoF	gnl\|CDD\|224806	COG1894, NuoF, NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit [Energy production and conversion].	0
CP032084.1\|AYD67800.1\|4837156_4837759_-\|DUF1345-domain-containing-protein	gnl\|CDD\|377769	pfam07077, DUF1345, Protein of unknown function (DUF1345). This family consists of several hypothetical bacterial proteins of around 230 residues in length. The function of this family is unknown.	2.17302e-62
CP032084.1\|AYD66286.1\|4838032_4838557_-\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	5.47464e-30
CP032084.1\|AYD67801.1\|4842743_4844030_+\|sorbosone-dehydrogenase-family-protein	gnl\|CDD\|225044	COG2133, COG2133, Glucose/sorbosone dehydrogenases [Carbohydrate transport and metabolism].	1.41215e-101
CP032084.1\|AYD66288.1\|4841688_4842114_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	1.06299e-22
CP032084.1\|AYD66290.1\|4844775_4845480_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	5.5824e-98
CP032084.1\|AYD66279.1\|4827695_4828265_+\|formate-dehydrogenase-subunit-gamma	gnl\|CDD\|180339	PRK05988, PRK05988, formate dehydrogenase subunit gamma; Validated.	5.07059e-85
CP032084.1\|AYD66277.1\|4825276_4826392_-\|GTP-3',8-cyclase-MoaA	gnl\|CDD\|234672	PRK00164, moaA, GTP 3',8-cyclase MoaA.	5.32613e-168
CP032084.1\|AYD66287.1\|4838553_4839129_-\|chromate-transporter	gnl\|CDD\|376780	pfam02417, Chromate_transp, Chromate transporter. Members of this family probably act as chromate transporters. Members of this family are found in both bacteria and archaebacteria. The proteins are composed of one or two copies of this region. The alignment contains two conserved motifs, FGG and PGP.	1.27427e-32
CP032084.1\|AYD67799.1\|4824651_4825266_-\|molybdenum-cofactor-guanylyltransferase	gnl\|CDD\|234725	PRK00317, mobA, molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed.	1.99147e-74
CP032084.1\|AYD66285.1\|4835833_4836955_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225443	COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis].	2.90302e-26
CP032084.1\|AYD66292.1\|4847103_4848510_+\|DUF1501-domain-containing-protein	gnl\|CDD\|226587	COG4102, COG4102, Uncharacterized protein conserved in bacteria [Function unknown].	1.85253e-45
CP032084.1\|AYD66282.1\|4832786_4833617_+\|formate-dehydrogenase-accessory-sulfurtransferase-FdhD	gnl\|CDD\|234823	PRK00724, PRK00724, formate dehydrogenase accessory sulfurtransferase FdhD.	1.3813e-124
CP032084.1\|AYD66278.1\|4826434_4827514_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|378934	pfam12727, PBP_like, PBP superfamily domain. This family belongs to the periplasmic binding domain superfamily. It is often associated with a helix-turn-helix domain.	2.04258e-65

>CP032084.1|AYD66285.1|4835833_4836955_+|class-I-SAM-dependent-methyltransferase
MSAPELHWVENDVPHSARWRSETGATPPKRVVVVDDKLTADMAYRQACEGAGLLWRGDFQNARQLLLAMTRRVDKRPRKPVETMLEAFNQHRQIQSQRARILGMLLIPFDAGHGISLRRAPDARQACEEAHGPADEPYVASLRELLGLIGAFEWRKKGVEIPALNNRIHPHYGVFSPLRGEYVDLVANTPMPRGSVAFDIGTGTGVLAAVIARRGGKRVIATDQDPRALACARENLERLGLDKQVDVVDADLFPEGRVSLVVCNPPWLPARPSSPVEQAVYDPDSRMLRGFLNGLPAHLTPNGEGWLILSDLAEHLGLRTREQLLEMIATAGLRVIERLDTRPTHARAKDPSDPLYAARSKEVTSLWRLGAAA
>CP032084.1|AYD66284.1|4834026_4835694_+|MFS-transporter
MESTATLDLPGAKPGFFDKERTIAGPGFSRWLVPPAALAIHLCIGMAYGFSVFWLPLSKVVGGAKPLACPADMSLVAELFTTSCDWKISTMGWMYTLFFVLLGCSAALWGGWLERAGPRKAGVVSAVCWCGGLVISAIGVYLHQMWMLWLGSGVIGGIGLGLGYISPVSTLIKWFPDRRGMATGMAIMGFGGGAMIGAPLADLLMRHFATPTSPGVWQTFLTMAVVYFVFMMSGALGYRVPPTGWKPQGWTAPAKHANNAMITKGHVHVKRVWGVPQFWLVWLVLCLNVTAGIGILGMASPLLQEVFGGGLINKPELGFGQLDKDQLAAIAAIAAGFTGLLSLFNIGGRFFWASLSDKLGRKMTYLIFFVLGFVLYAAIPWTAHIGALALFVAAFCVILSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWSAAGIFGPVLVNYIREYQLSIGVPRAQVYDITMYILAGMLVLGFLCNLAIRPVNPKYFMSDDELAHEKALAHERAAAAETHGVGASTFRTPAVLVLFAWACVGIPLAWGIWITLQKAVVLFH
>CP032084.1|AYD66283.1|4833694_4833952_+|formate-dehydrogenase
MEIGNLIRMANRIGQFFDAMPDRHEALEGVANHIHKFWEPRMRNELLGFLAATPNGDAGDEQLHPLVLDAVTQNRQRLTPAPRVN
>CP032084.1|AYD66282.1|4832786_4833617_+|formate-dehydrogenase-accessory-sulfurtransferase-FdhD
MTSQTTPPPPRPDCTPTQVTRVRGGAIAPAAESDFVAEETPVALEFNGISHATMLATPADLEDFAVGFSLSEGIIDSVSDVRGIDVLPQCDGIVVQVEISSACEVRLKTRRRAMAGRTGCGLCGVETLPEVLRPVAPVTNGSAVRIRAVLAAMRDMRARQALHDITGATHAAGWAGGDGAVALLREDVGRHNALDKLIGALARQAMHGGNGIVLVSSRASFEMVQKTAAAGVAVLAAVSAPTALAIRLAQDANVSLVGFLRGDDATLYSHPERFIA
>CP032084.1|AYD66281.1|4829881_4832758_+|formate-dehydrogenase-subunit-alpha
MLETVIKRDRDLGTPARESANTITLTIDGQEICVPEGTSLMRAAAEAGINIPKLCATDSLEPFGSCRLCLVQIEGRRGYPASCTTPAENGMVVVTETPKLHELRRGVMELYISDHPLDCLTCPANGDCELQDMAGVVGLRNVRYGYDGANHLDAKVDDSNPYFSYDASKCIVCNRCVRACEETQGTFALTISGKGFESRVSPGQDQPFLDSECVSCGACVQACPTSTLQEKTVIMMGQAEHSVITTCAYCGVGCGFKAEMKGQEVVRMVPWKDGQANRGHSCVKGRFAWGYATHKERVLKPMIRKHITDSWKEVSWDEAINYAASEFRRIQSQYGRDAVGGITSSRCTNEETWLVQKLVRAAFGTNNVDTCARVCHSPTGYGLKQTLGESAGTQTFDSVMHTDVVIVMGANPSSGHPVFASRLKRRLRQGARLIVIDPRRIELVSSPHIKADYHLQVRPGTNTALLSSLAHVIATEGLIDEAFVAERCEAKAFNEWRDFVSLPENSPEAMAEITGVPAQAVRGAARLFATGGNGSIYYGLGVTEHSQGSTTVMAIANLAMATGNIGREGVGVNPLRGQNNVQGSCDMGSFPHELPGYRHISDNTVRAQFERDWGVTLQPEPGLRIPNMFEAALGGSFKGLYCQGEDIVQSDPNTQHVAASLAAMECIVVQDLFLNETAKYAHVFLPGSSFLEKDGTFTNAERRISRVRKVMEPKNGKSDWEVTVALSNALGYPMNYTHPREIMEEIARLTPTFAGVSYDKLDKLGSLQWPCNDDAPEGTPIMHIDTFVRGKGKFMITKYVPTDERSTRRFPLLLTTGRILSQYNVGAQTRRTPNVMWHGEDVLELHPQDAEDRGVAEGDWVGIQSRAGETVLRATLTDRVQPGVVYTTFHFPESGANVVTTDSSDWATNCPEYKVTAVQVTRVSQPSEWQRQWSRFADIQQKLLRERSRENEAALTGK
>CP032084.1|AYD66280.1|4828261_4829866_+|NADH-quinone-oxidoreductase-subunit-NuoF
MSAPVVIYVPRDAAALAMDADAVAREVERIADARGLAVQVVRNGSRGLLWLEPLVEVTTPNGRVAYGPVAVEDVAGLFDAGWLTHHDNAAGAAPKHPLRLGLTEDIPYLKQQERLTFARVGVIDPLSLQDYAAHGGLAGLKRALAMDPAAIIDEMVTSGLRGRGGAAFPTGIKWKTVAGTPGDQKYIVCNADEGDSGTFADRLLMEGDPYVLIEGMTIAGLAVGATYGYIYVRSEYPHAIDTLQAAIARARSVGWLGADVHGSGRRFDLEVRKGAGAYICGEETSLLESLEGKRGVVRAKPPLPAISGLFGKPTVINNVISLATVPIILAKGAAYYRDYGVGRSHGTLPFQLAGNVRQGGLVEKAFGLSLRDLLYTFGGGSASGRPLRAVQVGGPLGAYLPESQWDVPLDYEAYIQISAMIGHGGLVAFDDTVDMARMARYAMEFCAIESCGKCTPCRIGSTRGVETIDKIAAGGVSPAQREQQVHLLRDLCDTMMGGSLCALGGMAPYPVLSALNHFPQDFGIESSQSAAHAA
>CP032084.1|AYD66279.1|4827695_4828265_+|formate-dehydrogenase-subunit-gamma
MHQREATSDLASSGGARGGQLALDAAQASTTPAIATTARIVARLKDLPGPLLPVLHQVQHELGCIPAEAVQTIAEALNLSRAEVHGVITFYPHFRSQPAARHTLEVCRAESCQAMGGEQLAAHARAHLGCDFHAHTADGNFTLEPVYCLGLCAQSPAIMIDGRPHARVTPEKLDRLLARTLAQPQETTP
>CP032084.1|AYD66278.1|4826434_4827514_-|LysR-family-transcriptional-regulator
MTYKFRIGLRPQWTLGGGDDTAPLPLQDMLALLAAIDATGNITGACRACGLSYRHAWGVLRRFETLFGTQLLVTNRRQGTQLAPFAQRLLWANRRIEARLMPTLDSMASELQEELEKLLPESGPHLRLHASHGFAVESLMQHMGGRKPGLELRYRTAIEALASLERHECDLAGFQVPLGDFEAPIMERYAQWLHADEYLLIHLAVRNTGLFVTAGNPKQIRGMADLARPDVRFVNRQIGSSTRYLVSLMLQRAGVSIGEVQGYETNEFTHMAIAAHIASGMADTGVGVETAACRFGLDFIPLVRERYFFAIRKSALETPAMQDLLSIMRSADYVGYVGQLVGYDAKDTGRLQTLEEAFA
>CP032084.1|AYD66277.1|4825276_4826392_-|GTP-3',8-cyclase-MoaA
MSKVIFLADRRSDRSAWPAPGELPADGQPALDRRARPLRDLRISVTDRCNFRCTYCMPREVFDASYTFMPHSALLSFEEISRLAGIFTQLGVEKIRLTGGEPLLRKHIENLVGQLAALRTPAGQPLDLTLTTNGSVLARKAAALKAAGLTRVTVSLDALDASMFQDMSDSGFTPDDVLRGIDAAADAGLAPVKVNMVVRRGLNDGQILPMAERFRHSGHILRFIEYMDVGNTNGWNLSEVVPSQEVLDRIGAAYPLEPVQSADMGRVAERWRYLDGGGEIGVISSVTHAFCGGCTRARLSPEGKLFLCLFAHEGFDLRAPLRDGATDAELAAMLAGIWGGRADNYSELRGRNMADPTPDPGRKVEMSYIGG
>CP032084.1|AYD67799.1|4824651_4825266_-|molybdenum-cofactor-guanylyltransferase
MAPCIAGLILAGGQGSRMAHQDKGLVLLNGEPMVAHVARRLAPQVARLIISANRHADHYARYGTVVADNEPGLEKYQGPLLGIAAGLAAVAAVADVDWVVVVPCDTPFLPGDLAARLVDAAQSAQAPMAYAMVGEQRHSACMALRPSLLPGLRAYLHGGDRKVGLWQARVGAVAARFDDAPHAFMNVNTPEELAEAQRYASQGR
>CP032084.1|AYD67800.1|4837156_4837759_-|DUF1345-domain-containing-protein
MLCGMLFLAVGGGAYAWGRSVSLALLLGFDAAALVFLVLTARVFGKASPASMRVQARQQDVGRFGVLWSSVALSCMVLMALWVELHGESSSGGALDILAAGATIVLSWLYMNMIFALHYAHGYYGHRTGAHKGLDFPGTQEPDYWDFAYFALVLGMTFQVSDVQIVNRRVRRMALMHSVIAFFFNVFIIAISVNVAAGKA
>CP032084.1|AYD66286.1|4838032_4838557_-|chromate-transporter
MIHTLIALALIFSQLSVLAFGGGNTILPEMQRQVVDVHGWMTAADFSALFALGQAAPGPNLMVVTLVGWHVAGWWGMLVTTIAKFGPSSLITIVALGLWERFKDRPWRGVIQAGIFPMTVGLVAASAALITEASVHSWLLAAITTVVAVLGSTTRVHPLWLLFGGALVGLLAIG
>CP032084.1|AYD66287.1|4838553_4839129_-|chromate-transporter
MNAAALTPDAATRPPPTCGQLFTGFLMLGLTAFGGALPLARRMVVEKHGWLSGPEFTDLLGLCQFLPGGNIINLSVALGMKFRGPRGAFAALMGLILAPSAIVILLGMVYDRFQNDPHIQHLFAGLAAAAAGLLISMAVKIGVPVIKRRDWLAGVVATLCFVAVAVLRIPLLPTMAVLTPLSILLVWRQRR
>CP032084.1|AYD66288.1|4841688_4842114_+|universal-stress-protein
MKRILIPVDGSPPALHAVQALLAARAYDPVAHVELLTVQIPLKSGKIGRGLAQADIDAYHRDEARAALRASSDLLTKAGVPFDVRIEVGEPADTIIRVAAESDADEIYMGSRGLGSVSSLFMGSIATRVVHLTDLPVTLVK
>CP032084.1|AYD66289.1|4842131_4842560_+|universal-stress-protein
MLNILVPVDGSDNANRAVLYARQLAEGAASARIHLINVQTPTHGRAGVSRLITQDMIDQFYAREGQEATQDARQLLGATGTDHTSQVLFGHPATEIAGYARDQHCARIVMGTRGHGTLVNILMGSVANQVLQLAEVPVTLVK
>CP032084.1|AYD67801.1|4842743_4844030_+|sorbosone-dehydrogenase-family-protein
MAALATLAACGEIATLPVESGMGPNPTLPAPNSTLIPTVNTAKAVGWSDGAQPVAAAGLAVNAYAGGLDHPRWLYVLPNGDVLVAETNAPPKPEGAGGGIKEWAAGIVMKRAGAKTPSANRITLLRDADHDGVAETRSVLLQNLNSPFGMALVGNQLYVANADAVLRFPYQPGQTQIQAPGVHVTDLPAGINHHWTKNLIANADGSKLYVSVGSNSNVAENGMDIEEGRAAIWEIDVATGTKRLYATGLRNPVGMAWAPDGKTLWTAVNERDELGSDLVPDYMTSVKDGGFYGWPYSYYGQHVDTRVTPPRPDLVARAIVPDYALGPHTASLGLAWSGAARLPAPYAGGMFVGQHGSWNRDPRSGYKVIFVPFENNAPNGPARDVLTGFLNKDGQAQGRPVGVAIDGQGDLLVADDVGNVIWRVSPKP
>CP032084.1|AYD67802.1|4844201_4844651_+|azurin
MFKKLCVAAILAAASAPVLAAECSVDIAGNDQMQFDKKEITVSKSCKQFTVNLKHPGNLAKNVMGHNWVLTTSADMQGAVNDGMAAGLDNDYVKKGDARVIAHTKVIGGGQSDSVTFDVSKLAAGTDYTYFCSFPGHFALMKGSLKLVD
>CP032084.1|AYD66290.1|4844775_4845480_+|SDR-family-oxidoreductase
MSTEKVAIVTAGGSGMGAAAARKLAADGYRVAILSSSGKGESLAGELGGLGVTGSNRSPEDLARLVETTLQKWGRVDAVVNSAGHGPKGPLLSISDEDWHLGMEYYLLNVVRIARLVAPVMKQQQSGAIVNISTYATFEPEALFPTSGVFRAGLAAFTKVFSDEYAEHNVRMNNVLPGFIDSLPEKEDRRARIPMGRYGTAEEVADLIAFLASDASSYITGQNIRIDGGITRSV
>CP032084.1|AYD66291.1|4845592_4847107_+|DUF1800-domain-containing-protein
MTVTPGQASRFLAQATFGPTPALIDAVVRDGYAAWLDAQLAMPPSQTHFDWLLQQKKNTEAFKGNGINAPLESTLWRKFISAEDQVRTRMAFALSEIFVVGVQSITASWPLFGAAGFMDLLAEHALGSYQALLTAVTKNLSMGCMLTYRGNRKEDPKTGRHPDENYAREVMQLFSIGLLELEPDGTVRKVNGAPVETYTNADVQGLARVFTGWDINGPETDVQFHRRPMALNNAQHSMAEKRFLGTVIPAGTDGHLSLKRAMDVICAHPNVGPFIGMQLIQRLVTSNPSPAYVRRVSAVFDDDGSGARGNLKAVLRAILLDPEARNPDLANPGWGKVREPILRFSGWARAFGATSTNGAWAMPDTTDNTIRLAQSPMRSATVFNFFRPRYTPPVTELARRHLVAPELQITDETSIAGYLNFLAVYADRGWEDLQTSYAPEIALARDPDALVARVVLLLAGDAFSATTASAIAQAVATLPAHRPRDRVRAAIMLVAASPEYLVQK
>CP032084.1|AYD66292.1|4847103_4848510_+|DUF1501-domain-containing-protein
MKRSHDADRRAFLLRACALGATGAAAPLALNLAALGAAAAQSLPEPSASGSGSPSSYKALVCVFLYGGNDPYNTIVPFDSPAYRAYAAARGDIALPRDALQATVLRGKAPAAGGAQFALAPALAPLAPLYESGRLAVLLNVGPLVAPTTKAEYISARVPLPPKLFSHNDQQAYWQALAPEGASSGWGGRLTDLFASANAQRTFTGITAGGSTVLLAGRKVAGYRVGINGSTSIDLLHRDMYGSSACTALLRQLITQPREHLMERELSRIAAQSIDADTQLRAALADVAVPGDFASPLAQQLKIVARIIGARQALGARRQVFFVSQNGYDNHTGLNDTHPALLRELGQAMATFQQALASMGVAESVTTFTASEFGRTLGSNGNGSDHGWGAHHLVMGGAVNGGRFYGTHPEIALDGPGFVDNGRLLPTLAVDQLGASLGAWFGAGRDDLGLVFPNLKNFDADRLMLMQA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	CP054934	Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence	16578-16602	3	0.88
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	709852-709876	3	0.88
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	857093-857117	4	0.84
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP032703	Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence	88731-88755	4	0.84
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	458862-458886	4	0.84
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	116118-116142	4	0.84
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	167265-167289	4	0.84
CP032084_5	5.1\|4672911\|25\|CP032084\|CRISPRCasFinder	4672911-4672935	25	NZ_CP010326	Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence	315389-315413	5	0.8

1. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to CP054934 (Nocardiopsis flavescens strain NA01583 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.88

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggcagcgcgctgcgcgcctgagcc	Protospacer
***** *** *************.*

2. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 3, identity: 0.88

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
ccgcaccgccctgcgcggctgcgtc	Protospacer
* *************** *** ***

3. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.84

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggcaccgccctgcgcgcccgcgca	Protospacer
*******************.* *.

4. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP032703 (Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.84

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggtaccgccctgcgcgcctgctac	Protospacer
***.*****************   *

5. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 4, identity: 0.84

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggcaccgccctgcgcgcccgcgca	Protospacer
*******************.* *.

6. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 4, identity: 0.84

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggcaccgccctgcgcgcccgcgca	Protospacer
*******************.* *.

7. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 4, identity: 0.84

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggcaccgccctgcgcgccggccac	Protospacer
******************* *   *

8. spacer 5.1|4672911|25|CP032084|CRISPRCasFinder matches to NZ_CP010326 (Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence) position: , mismatch: 5, identity: 0.8

cggcaccgccctgcgcgcctgagtc	CRISPR spacer
cggcaccgcgctgcgcgcctgttat	Protospacer
********* ***********   .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2761700 : 2769812

Moraxella_phage(28.57%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYD67611.1\|2761700_2762288_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	3.7e-21	35.8
AYD64642.1\|2762348_2762723_-	thioredoxin	V9SJ74	Achromobacter_phage	1.1e-10	28.9
AYD64643.1\|2762895_2763918_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
AYD64644.1\|2764105_2765398_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	6.0e-64	36.3
AYD64645.1\|2765509_2766541_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	2.6e-94	53.2
AYD64646.1\|2766541_2767186_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
AYD64647.1\|2767366_2768125_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.6e-67	51.6
AYD67612.1\|2768295_2768934_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.2e-30	46.2
AYD64648.1\|2768951_2769812_+	LysM peptidoglycan-binding domain-containing protein	A0A292GJG6	Xanthomonas_phage	9.3e-13	44.3

DBSCAN-SWA_2

3582872 : 3669978

Burkholderia_phage(18.75%)

protease,lysis,head,integrase,tRNA,capsid,tail,portal,terminase

attL 3646283:3646300|attR 3676692:3676709

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYD65256.1\|3582872_3584171_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-130	54.1
AYD65257.1\|3584272_3584926_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.3e-54	55.2
AYD65258.1\|3584930_3586241_-	trigger factor	NA	NA	NA	NA
AYD65259.1\|3586405_3587161_-	peptidase	NA	NA	NA	NA
AYD65260.1\|3587424_3587970_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	2.9e-20	32.7
AYD65261.1\|3588116_3588323_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.4e-15	59.7
AYD65262.1\|3588345_3588570_+	hypothetical protein	NA	NA	NA	NA
AYD65263.1\|3588626_3589190_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	2.9e-15	38.9
AYD65264.1\|3589321_3589525_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.3e-17	63.6
AYD65265.1\|3589895_3590216_-	hypothetical protein	NA	NA	NA	NA
AYD65266.1\|3590311_3590710_-	hypothetical protein	NA	NA	NA	NA
AYD67689.1\|3590834_3591137_+	DUF2513 domain-containing protein	NA	NA	NA	NA
AYD65267.1\|3591159_3591432_-	hypothetical protein	NA	NA	NA	NA
AYD65268.1\|3591497_3592652_-	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
AYD65269.1\|3592773_3593685_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYD65270.1\|3593697_3594096_-	RidA family protein	NA	NA	NA	NA
AYD65271.1\|3594161_3595352_-	MFS transporter	NA	NA	NA	NA
AYD65272.1\|3595448_3596036_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYD65273.1\|3596185_3597634_+	MFS transporter	NA	NA	NA	NA
AYD67690.1\|3597775_3598084_+	hypothetical protein	NA	NA	NA	NA
AYD65274.1\|3598130_3598388_-	hypothetical protein	NA	NA	NA	NA
AYD65275.1\|3598494_3600126_-	MCE family protein	NA	NA	NA	NA
AYD67691.1\|3600224_3600719_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYD65276.1\|3600715_3601024_-	carbohydrate isomerase	NA	NA	NA	NA
AYD65277.1\|3601093_3601951_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	7.3e-50	42.1
AYD65278.1\|3602050_3602614_-	cytochrome b	NA	NA	NA	NA
AYD67692.1\|3602792_3604010_+	hypothetical protein	NA	NA	NA	NA
AYD65279.1\|3604035_3604620_-	glycerol-3-phosphate responsive antiterminator	NA	NA	NA	NA
AYD65280.1\|3604622_3606185_-	FAD-binding oxidoreductase	NA	NA	NA	NA
AYD65281.1\|3606181_3607861_-	glycerol-3-phosphate dehydrogenase/oxidase	NA	NA	NA	NA
AYD65282.1\|3607857_3609399_-	glycerol kinase	NA	NA	NA	NA
AYD65283.1\|3609395_3610853_-	MFS transporter	NA	NA	NA	NA
AYD65284.1\|3611340_3611577_+	toluene tolerance protein	NA	NA	NA	NA
AYD65285.1\|3612066_3612732_+	SOS response-associated peptidase	NA	NA	NA	NA
AYD67693.1\|3612874_3613096_+	hypothetical protein	NA	NA	NA	NA
AYD65286.1\|3613197_3613455_+	hypothetical protein	NA	NA	NA	NA
AYD65287.1\|3613407_3613632_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
AYD65288.1\|3614295_3614514_+	hypothetical protein	NA	NA	NA	NA
AYD65289.1\|3614515_3615034_-\|lysis	lysis protein	K7PKF2	Enterobacteria_phage	6.0e-07	30.7
AYD65290.1\|3615030_3615531_-	hypothetical protein	I6NSS1	Burkholderia_phage	1.4e-40	55.5
AYD65291.1\|3615527_3615806_-	hypothetical protein	NA	NA	NA	NA
AYD65292.1\|3615807_3616116_-	hypothetical protein	NA	NA	NA	NA
AYD65293.1\|3616214_3617006_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYD65294.1\|3617002_3617719_-	hypothetical protein	NA	NA	NA	NA
AYD65295.1\|3617737_3618163_-	hypothetical protein	NA	NA	NA	NA
AYD65296.1\|3618164_3618617_-	hypothetical protein	NA	NA	NA	NA
AYD67694.1\|3618861_3622692_-	hypothetical protein	Q7Y5J5	Xanthomonas_virus	7.3e-49	28.4
AYD65297.1\|3622721_3623108_-	hypothetical protein	NA	NA	NA	NA
AYD65298.1\|3623109_3623586_-	DUF1833 domain-containing protein	I7GYA2	Xanthomonas_virus	5.0e-08	26.3
AYD65299.1\|3623587_3623932_-	hypothetical protein	NA	NA	NA	NA
AYD65300.1\|3623932_3626725_-\|tail	phage tail tape measure protein	A0A1V0E8B0	Vibrio_phage	1.6e-106	34.7
AYD65301.1\|3626727_3627027_-	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	1.1e-08	37.4
AYD65302.1\|3627035_3627347_-	hypothetical protein	NA	NA	NA	NA
AYD65303.1\|3627346_3628000_-\|tail	phage tail protein	A0A0H5BBY3	Pseudomonas_phage	1.1e-37	42.2
AYD65304.1\|3628059_3628419_-	DUF3168 domain-containing protein	NA	NA	NA	NA
AYD65305.1\|3628408_3628906_-	HK97 gp10 family phage protein	Q2NPI1	Xanthomonas_virus	4.1e-21	38.4
AYD65306.1\|3628898_3629249_-\|head,tail	head-tail adaptor protein	Q7Y5K6	Xanthomonas_virus	3.0e-10	33.9
AYD65307.1\|3629245_3629665_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
AYD65308.1\|3630073_3631312_-\|capsid	phage major capsid protein	C7BGH0	Burkholderia_phage	1.7e-100	49.3
AYD65309.1\|3631380_3632121_-\|protease	Clp protease ClpP	C7BGG9	Burkholderia_phage	2.6e-56	56.1
AYD65310.1\|3632083_3633427_-\|portal	phage portal protein	C7BGG8	Burkholderia_phage	1.4e-55	37.3
AYD65311.1\|3633426_3635130_-\|terminase	terminase large subunit	Q3HQS7	Burkholderia_phage	4.4e-224	67.4
AYD65312.1\|3635133_3635595_-\|terminase	terminase small subunit	A0A2H4J8R0	uncultured_Caudovirales_phage	1.2e-19	42.3
AYD67695.1\|3635978_3636320_-	HNH endonuclease	NA	NA	NA	NA
AYD65313.1\|3636440_3637088_+	hypothetical protein	NA	NA	NA	NA
AYD65314.1\|3637191_3637839_-	hypothetical protein	Q3HR05	Burkholderia_phage	2.4e-29	42.1
AYD65315.1\|3637838_3638252_-	hypothetical protein	NA	NA	NA	NA
AYD65316.1\|3638260_3638983_-	hypothetical protein	NA	NA	NA	NA
AYD65317.1\|3638990_3639842_-	helix-turn-helix domain-containing protein	A0A1W6JTD5	Pseudomonas_phage	3.7e-38	53.3
AYD65318.1\|3639838_3640336_-	DUF1364 family protein	NA	NA	NA	NA
AYD65319.1\|3640326_3640632_-	hypothetical protein	NA	NA	NA	NA
AYD65320.1\|3640624_3640900_-	hypothetical protein	A0A1J0GUZ1	Halomonas_phage	5.4e-07	37.2
AYD65321.1\|3640923_3641439_-	hypothetical protein	B7SYH6	Stenotrophomonas_phage	3.3e-29	41.1
AYD65322.1\|3641612_3641912_-	hypothetical protein	NA	NA	NA	NA
AYD67696.1\|3642479_3643079_+	S24 family peptidase	NA	NA	NA	NA
AYD65323.1\|3643560_3643962_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYD65324.1\|3644503_3644740_+	hypothetical protein	NA	NA	NA	NA
AYD65325.1\|3644751_3645390_-	hypothetical protein	NA	NA	NA	NA
AYD65326.1\|3645458_3645989_-	hypothetical protein	NA	NA	NA	NA
AYD65327.1\|3646034_3647003_+	hypothetical protein	A0A0U4JP11	Pseudomonas_phage	2.3e-44	40.0
3646283:3646300	attL	NA	NA	NA	NA
AYD65328.1\|3647126_3647333_-	hypothetical protein	NA	NA	NA	NA
AYD65329.1\|3647390_3648965_+	DNA cytosine methyltransferase	A0A1B0V7P0	Salmonella_phage	6.4e-52	33.5
AYD65330.1\|3648961_3649747_+	hypothetical protein	NA	NA	NA	NA
AYD65331.1\|3649743_3649986_+	hypothetical protein	NA	NA	NA	NA
AYD65332.1\|3650510_3651494_-\|integrase	site-specific integrase	A0A0A0YR56	Pseudomonas_phage	1.0e-55	42.8
AYD65333.1\|3651750_3652965_+	succinyldiaminopimelate transaminase	NA	NA	NA	NA
AYD65334.1\|3652989_3653811_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AYD65335.1\|3653810_3654947_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AYD65336.1\|3655049_3655946_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AYD65337.1\|3655942_3657877_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	4.6e-68	31.9
AYD65338.1\|3657983_3658289_-	chorismate mutase	NA	NA	NA	NA
AYD65339.1\|3658291_3660586_-	DNA helicase II	A7KV33	Bacillus_phage	1.2e-107	36.1
AYD65340.1\|3660582_3661791_-	acyl-CoA desaturase	NA	NA	NA	NA
AYD65341.1\|3662149_3662545_+	hypothetical protein	NA	NA	NA	NA
AYD65342.1\|3662622_3664098_-	RsmB/NOP family class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
AYD65343.1\|3664077_3665355_+	hypothetical protein	NA	NA	NA	NA
AYD67697.1\|3665332_3665998_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.8e-27	35.7
AYD65344.1\|3666161_3667127_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AYD65345.1\|3667116_3669978_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	6.4e-74	26.2
3676692:3676709	attR	NA	NA	NA	NA

DBSCAN-SWA_3

4175170 : 4188956

Pseudomonas_phage(36.36%)

holin,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYD65736.1\|4175170_4175665_-	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	4.5e-44	62.3
AYD65737.1\|4175725_4176016_-\|holin	holin	C7BGD7	Burkholderia_phage	1.0e-11	44.7
AYD65738.1\|4176060_4176666_-	hypothetical protein	U5P083	Shigella_phage	3.6e-11	34.6
AYD65739.1\|4176682_4179115_-	hypothetical protein	A0A1Y0SVH2	Sinorhizobium_phage	4.4e-07	51.4
AYD65740.1\|4179114_4179780_-	DUF2612 domain-containing protein	A0A0N9SSD8	Pseudomonas_phage	2.0e-31	37.3
AYD65741.1\|4179779_4181231_-	hypothetical protein	A0A0N9SH53	Pseudomonas_phage	9.4e-74	35.4
AYD65742.1\|4181256_4181625_-	hypothetical protein	E5AGC2	Erwinia_phage	2.0e-12	37.5
AYD65743.1\|4182317_4183268_-	hypothetical protein	A9DEK1	Yersinia_phage	2.6e-16	27.7
AYD65744.1\|4183254_4183587_-	hypothetical protein	A0A0N9SG14	Pseudomonas_phage	1.0e-12	41.2
AYD65745.1\|4183583_4184171_-	hypothetical protein	NA	NA	NA	NA
AYD65746.1\|4184179_4186522_-\|tail	phage tail tape measure protein	E5AGB7	Erwinia_phage	3.4e-09	21.3
AYD65747.1\|4186524_4186752_-	hypothetical protein	NA	NA	NA	NA
AYD65748.1\|4186670_4187156_-	hypothetical protein	NA	NA	NA	NA
AYD65749.1\|4187155_4187584_-	DUF3277 family protein	NA	NA	NA	NA
AYD65750.1\|4187597_4188956_-	DUF3383 family protein	A0A0N9SJA3	Pseudomonas_phage	3.0e-82	40.0

DBSCAN-SWA_4

5924416 : 5934162

uncultured_Caudovirales_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYD67131.1\|5924416_5925649_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.5e-107	60.8
AYD67132.1\|5925821_5926607_+	3-hydroxybutyrate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	7.0e-07	27.0
AYD67133.1\|5926652_5927414_+	uracil-DNA glycosylase	J9QYL4	Leporid_alphaherpesvirus	9.7e-46	52.9
AYD67134.1\|5927692_5929489_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.6e-51	33.0
AYD67135.1\|5929639_5930827_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYD67136.1\|5930896_5932006_-\|tRNA	CCA tRNA nucleotidyltransferase	A0A0F6YPT7	Sinorhizobium_phage	1.4e-53	51.4
AYD67893.1\|5932002_5934162_-	lytic transglycosylase domain-containing protein	A0A0S2SXL7	Bacillus_phage	7.3e-14	37.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP032084

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection