CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP023491	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence	0 crisprs	csa3	0	1
CP023493	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence	0 crisprs	NA	0	0
CP023492	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed2, complete sequence	0 crisprs	NA	0	0
CP023495	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed5, complete sequence	0 crisprs	NA	0	0
CP023494	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed4, complete sequence	1 crisprs	NA	1	0
CP023490	Lactobacillus plantarum strain NCIMB 700965 chromosome, complete genome	0 crisprs	DEDDh,cas3,csa3,WYL,DinG	0	14

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

19546 : 54955

Streptococcus_phage(20.0%)

transposase,holin,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE60393.1\|19546_20182_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYE60394.1\|20462_20567_+\|holin	putative holin-like toxin	NA	NA	NA	NA
AYE60395.1\|21007_21145_+\|holin	putative holin-like toxin	NA	NA	NA	NA
AYE60396.1\|23989_24292_+	hypothetical protein	NA	NA	NA	NA
AYE60397.1\|24322_24952_+	hypothetical protein	NA	NA	NA	NA
AYE60398.1\|25027_25993_+	hypothetical protein	NA	NA	NA	NA
AYE60399.1\|25989_26184_+	hypothetical protein	NA	NA	NA	NA
AYE60400.1\|26186_26792_+	hypothetical protein	NA	NA	NA	NA
AYE60401.1\|26794_28579_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	6.8e-82	33.7
AYE60402.1\|28645_28960_+	hypothetical protein	NA	NA	NA	NA
AYE60403.1\|29055_31170_+	hypothetical protein	NA	NA	NA	NA
AYE60404.1\|31179_31968_+	sortase	NA	NA	NA	NA
AYE60405.1\|31996_34939_+	cell surface protein	NA	NA	NA	NA
AYE60406.1\|35015_35312_+	hypothetical protein	NA	NA	NA	NA
AYE60407.1\|35624_36554_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.1e-22	27.4
AYE60408.1\|36870_38046_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	5.3e-27	29.2
AYE60409.1\|38243_39023_+	chain-length determining protein	NA	NA	NA	NA
AYE60410.1\|39034_39763_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AYE60411.1\|39749_40523_+	tyrosine protein phosphatase	NA	NA	NA	NA
AYE60412.1\|40765_41335_+	resolvase	A0A1J1J8Z4	Escherichia_phage	7.0e-33	45.7
AYE60413.1\|41822_42254_-	universal stress protein	NA	NA	NA	NA
AYE60414.1\|42253_43846_-	divalent metal cation transporter	NA	NA	NA	NA
AYE60415.1\|43969_44623_+	Mn-dependent transcriptional regulator	NA	NA	NA	NA
AYE60416.1\|45963_48093_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	0.0e+00	91.0
AYE60417.1\|48085_48454_-	transcriptional regulator	E4ZFI8	Streptococcus_phage	4.5e-49	77.9
AYE60418.1\|48659_49676_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	3.3e-33	32.2
AYE60419.1\|49914_51222_-	Uric acid permease PucJ	NA	NA	NA	NA
AYE60420.1\|51644_52559_-	hypothetical protein	S5VTD3	Leptospira_phage	3.4e-37	37.3
AYE60421.1\|52552_53352_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AYE60422.1\|53807_54698_-	hypothetical protein	Q6J1X2	Lactobacillus_phage	4.2e-157	99.3
AYE60423.1\|54703_54955_-\|transposase	IS3 family transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP023494

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP023494_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP023494_1

19655-19764

Orphan

Consensus_repeat	Method
GTCTATTGATACAATCTAGAAAGAATAACCTAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP023494_1

>merge|CP023494|1|19655-19764|CRISPRCasFinder
GTCTATTGATACAATCTAGAAAGAATAACCTAGAATAGTCTAGTTGGTTGAATAACCTTAGACAACCTGATGAAATGTCTATTGATACAATCTAGAAAGAATAATCTAGA

>CP023494|1|1|19655-19764|CRISPRCasFinder
GTCTATTGATACAATCTAGAAAGAATAACCTAGA	ATAGTCTAGTTGGTTGAATAACCTTAGACAACCTGATGAAAT
GTCTATTGATACAATCTAGAAAGAATAATCTAGA

Protein	Signature genes	Signature genes Name	Protein_function
CP023494.1\|AYE60541.1\|17235_18024_+\|ATPase	unknown	unknown	gnl\|CDD\|379293
CP023494.1\|AYE60540.1\|15682_16681_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
CP023494.1\|AYE60546.1\|22315_22528_-\|hypothetical-protein	unknown	unknown	unknown
CP023494.1\|AYE60534.1\|10538_10982_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|253356
CP023494.1\|AYE60539.1\|14678_15056_-\|hypothetical-protein	unknown	unknown	unknown
CP023494.1\|AYE60537.1\|13642_13945_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	unknown
CP023494.1\|AYE60535.1\|12018_12945_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
CP023494.1\|AYE60538.1\|13919_14719_+\|IS5/IS1182-family-transposase	unknown	unknown	gnl\|CDD\|376573
CP023494.1\|AYE60543.1\|18501_18744_+\|hypothetical-protein	unknown	unknown	unknown
CP023494.1\|AYE60545.1\|21576_22134_-\|DUF1541-domain-containing-protein	unknown	unknown	gnl\|CDD\|369427
CP023494.1\|AYE60536.1\|12947_13277_+\|hypothetical-protein	unknown	unknown	unknown
CP023494.1\|AYE60542.1\|18016_18250_+\|hypothetical-protein	unknown	unknown	unknown
CP023494.1\|AYE60544.1\|20473_21472_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382

Protein	Function_ID	Function_description	E-value
CP023494.1\|AYE60541.1\|17235_18024_+\|ATPase	gnl\|CDD\|379293	pfam13614, AAA_31, AAA domain. This family includes a wide variety of AAA domains including some that have lost essential nucleotide binding residues in the P-loop.	3.98287e-34
CP023494.1\|AYE60538.1\|13919_14719_+\|IS5/IS1182-family-transposase	gnl\|CDD\|376573	pfam01609, DDE_Tnp_1, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. This family contains transposases for IS4, IS421, IS5377, IS427, IS402, IS1355, IS5, which was original isolated in bacteriophage lambda.	3.84436e-18
CP023494.1\|AYE60535.1\|12018_12945_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.79161e-37
CP023494.1\|AYE60534.1\|10538_10982_-\|hypothetical-protein	gnl\|CDD\|253356	pfam05732, RepL, Firmicute plasmid replication protein (RepL). This family consists of Firmicute RepL proteins which are involved in plasmid replication.	3.18264e-24
CP023494.1\|AYE60540.1\|15682_16681_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.01388e-88
CP023494.1\|AYE60545.1\|21576_22134_-\|DUF1541-domain-containing-protein	gnl\|CDD\|369427	pfam07563, DUF1541, Protein of unknown function (DUF1541). This family consists of several hypothetical bacterial and occurs as a tandem repeat.	3.05367e-19
CP023494.1\|AYE60544.1\|20473_21472_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	2.01388e-88

>CP023494.1|AYE60543.1|18501_18744_+|hypothetical-protein
MLGSLLQLLGLSRWYHHEQHADKSNARKASGQSAFSYQDLKGLRKLAFWLFVISVFMNWGMFGAIMLIAWIAMWAVSLLF
>CP023494.1|AYE60542.1|18016_18250_+|hypothetical-protein
MADDFLNKLAQQANQQLGDNESPFKQKKEVTRPVQVRESTYKMVKDIAYHKDAKIVDVIDSMLKYAINSDEFSENNK
>CP023494.1|AYE60541.1|17235_18024_+|ATPase
MTCKTLLHFNFKGGVGKTTLSVMDTYLLGELGHKVLLIDLDPQANATEIMRTTYNVKTEPNVDLFNGLLKLDLTHSIIELTDNVSMIPADWSLSLWPGKVEKIRNHDRMLILKTLIEQFKSQFEYIIIDVPPTLSIFTNNAILASDYVSLVLQTQKQAYTSVLKTAQYMYQLKNDYHATFDVSGVILYLVKRDAKVDREITKAATESFGDAVFINRIWQQERVKLFSNAGIKDEDYWDKKAISMYTMVLKEELHRIEEINNG
>CP023494.1|AYE60540.1|15682_16681_+|IS30-family-transposase
MSPYTHLTLKDRECILLGVTLHHTYQVIADQIGCSKATVSREIKRNGGRGAYSAVKAQQNYQQRRLKSRRLRVLENLKLRDFVLHCILQRQWSPEQIAGRLSLENSNWHISYNTIYRGIERNNLGVKRKSHGARGFARKLRHRGKTRKVKGTVNERRGRFNNVPSVHERPVSCENRTRFGHWEGDTVRGKIGRSGLVSLVDRKSRYLLSERVPKVNAKNVTQAMIDLLHTVTPKRVRTLTPDRGTEFAGYREVGKELGISVYFPDPHAPQQRGTNENTNGLIREYFPKGTDLDELTDQDIAKFVRDLNNRPRKVLVWKTPSEVFFGKKLHLI
>CP023494.1|AYE60539.1|14678_15056_-|hypothetical-protein
MIYDISVITMLALFLFSFVVLIRWILKKFFKINIPNLSRIRIVVVSLLSGLLIVGLGYQFRTSAQKRMDEQSESKAAIESSKKAKTKKPKQQYKNIETIFNMHSIKYLSKNVFRIFSRVFAGRLS
>CP023494.1|AYE60538.1|13919_14719_+|IS5/IS1182-family-transposase
MKSFAHHYSSDISREQFELIRTDLEGIRKRTKPRKVDLYDIFCALLYTLKNGCVWRDLPSDFPKWETVYYYWLLWTKTPSPAGITPLDKVFKKIVSQHRLAQKRSVYTSFIILDAQSVKNTDPAESSGYDGGKKVSGIKRHLAVDINGLPMAVHVTTANVSERDGANALLALNKSQFDLVQRVMADGGYTGNNFAQSVQAMINAEVIIAKQSDLRHGQVTPQRWVIERSFSWLGKYRRLWRNCERKLNTSKMMISLAFLRILLKRF
>CP023494.1|AYE60537.1|13642_13945_+|plasmid-mobilization-relaxosome-protein-MobC
MANIKANSDKQTKRINFRLNELEYEKLSQSASTYGLTVSSYAKQLALKSNLRKPYFSASDTQQIILELRTCLDTLTFDLILVKLDQKQEFLIHEKLCTPL
>CP023494.1|AYE60536.1|12947_13277_+|hypothetical-protein
MNELEKIEQLEKQLKARKREALKKGYEKLGRKFYKKTGAKNITTAENMLDHTPVFEKRETASPTLTTEQFQQLQNIANAMTYNGNFWKIEDLKDVSQWLSQFRTENEQS
>CP023494.1|AYE60535.1|12018_12945_+|replication-initiation-protein
MSNELVKYQPELNTIPLRKFTPTEMNLFFSIVSRMRDKGDQTVRFSFEQLKELSNYKPTANRRFIDDIKRTYDHLMDLRFGSQSKSGLSFTRFVMFTKFQINGDADEPYVDVEVYRDAIPLLNNLESWVRYALTEFRDLKSSYAKTMFRLLKGYRTTGYAYFSKNDFFELLAIPVSYSTKMANVDSKVLAPIKEELTPFFRGLTIRKKYGKGRGKPVIGYAFAWKAERKDAEDVHVSKTERLKTAKFNIEHNGELSDKEKWRAIDKIKGLKLGTTEAEHNKQEQAKREEQIRADERKKTLEELRKGWH
>CP023494.1|AYE60534.1|10538_10982_-|hypothetical-protein
MSTISSDTKFLGNGKWVNQDTGEMIEVNEVVKRVPRSGFEITYLTYFMDLFDKLGGQKYQVFKYIIENRSRDNNTLVTTNKELSRLTKTSTKTVQDTINLLKEAGLIERRMGAIMLNPKLVHRGSNQKEKYLLQRFEAFDQADSTEK
>CP023494.1|AYE60544.1|20473_21472_+|IS30-family-transposase
MSPYTHLTLKDRECILLGVTLHHTYQVIADQIGCSKATVSREIKRNGGRGAYSAVKAQQNYQQRRLKSRRLRVLENLKLRDFVLHCILQRQWSPEQIAGRLSLENSNWHISYNTIYRGIERNNLGVKRKSHGARGFARKLRHRGKTRKVKGTVNERRGRFNNVPSVHERPVSCENRTRFGHWEGDTVRGKIGRSGLVSLVDRKSRYLLSERVPKVNAKNVTQAMIDLLHTVTPKRVRTLTPDRGTEFAGYREVGKELGISVYFPDPHAPQQRGTNENTNGLIREYFPKGTDLDELTDQDIAKFVRDLNNRPRKVLVWKTPSEVFFGKKLHLI
>CP023494.1|AYE60545.1|21576_22134_-|DUF1541-domain-containing-protein
MKKLVRYVCAVVAMLFLVAGCSSNSTQKEGSSTHSHSSEKTEMHEHTGSKKVHGLKKAEQPKYKAGTKVKLTADHMKGMKDANATIVNAYGSKLYAVDYKSTSDKKMVKDHKWVTINEIEGNRKEYKKGDKVTLKADHMAGMKNSSATIVEIQKGPAYMVNYQPTNGGKQVTNHKWVAEDEIEKR
>CP023494.1|AYE60546.1|22315_22528_-|hypothetical-protein
MVNTILKEADLFCPNSVRINFTIYLLIIFPGNIIGGTILYAVTALVMTDPTQGDHSDDGDSVIKGEFREK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP023494_1	1.1\|19689\|42\|CP023494\|CRISPRCasFinder	19689-19730	42	NZ_CP026508	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed3, complete sequence	5601-5642	0	1.0
CP023494_1	1.1\|19689\|42\|CP023494\|CRISPRCasFinder	19689-19730	42	NZ_CP023494	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed4, complete sequence	19689-19730	0	1.0

1. spacer 1.1|19689|42|CP023494|CRISPRCasFinder matches to NZ_CP026508 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed3, complete sequence) position: , mismatch: 0, identity: 1.0

atagtctagttggttgaataaccttagacaacctgatgaaat	CRISPR spacer
atagtctagttggttgaataaccttagacaacctgatgaaat	Protospacer
******************************************

2. spacer 1.1|19689|42|CP023494|CRISPRCasFinder matches to NZ_CP023494 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed4, complete sequence) position: , mismatch: 0, identity: 1.0

atagtctagttggttgaataaccttagacaacctgatgaaat	CRISPR spacer
atagtctagttggttgaataaccttagacaacctgatgaaat	Protospacer
******************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP023490

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37871 : 98354

unidentified_phage(12.5%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE57715.1\|37871_38801_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	5.0e-20	29.5
AYE57716.1\|38909_39788_-\|transposase	IS982 family transposase	NA	NA	NA	NA
AYE57717.1\|40777_41857_+	LD-carboxypeptidase	NA	NA	NA	NA
AYE57718.1\|41954_42443_+	N-acetyltransferase	NA	NA	NA	NA
AYE57719.1\|42590_43934_+	glycosyl hydrolase family 25	A0A1S5RCQ2	Lactobacillus_phage	1.4e-36	32.2
AYE57720.1\|45294_46470_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE57721.1\|47625_48378_+	hypothetical protein	NA	NA	NA	NA
AYE57722.1\|48377_49055_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	2.7e-07	29.1
AYE57723.1\|49209_50289_-	hypothetical protein	NA	NA	NA	NA
AYE57724.1\|50544_51339_+	alpha/beta hydrolase	NA	NA	NA	NA
AYE57725.1\|51496_52603_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AYE57726.1\|52599_52986_-	ribonuclease HI	NA	NA	NA	NA
AYE57727.1\|53020_53407_+	hypothetical protein	NA	NA	NA	NA
AYE57728.1\|53500_55156_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
AYE57729.1\|55488_55938_+	signal peptidase II	NA	NA	NA	NA
AYE60308.1\|55957_56881_+	pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.2e-10	29.1
AYE57730.1\|57039_57564_+	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase	NA	NA	NA	NA
AYE57731.1\|57598_58681_+	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
AYE57732.1\|58677_61239_+	carbamoyl-phosphate-synthetase	NA	NA	NA	NA
AYE57733.1\|61563_63309_+	hypothetical protein	NA	NA	NA	NA
AYE57734.1\|63461_64061_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	3.3e-33	39.3
AYE57735.1\|64171_64582_-	hypothetical protein	NA	NA	NA	NA
AYE57736.1\|65096_65765_-	chloramphenicol acetyltransferase CAT	NA	NA	NA	NA
AYE57737.1\|65765_66137_-	LuxR family transcriptional regulator	NA	NA	NA	NA
AYE57738.1\|66140_66866_-	DUF2087 domain-containing protein	NA	NA	NA	NA
AYE57739.1\|67068_67563_+	NUDIX domain-containing protein	NA	NA	NA	NA
AYE57740.1\|67957_68857_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-36	39.6
AYE57741.1\|68869_69631_+	ABC transporter permease	NA	NA	NA	NA
AYE57742.1\|69748_71455_-	fibronectin/fibrinogen-binding protein	NA	NA	NA	NA
AYE57743.1\|71938_72361_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYE57744.1\|72445_73315_+	DegV family protein	NA	NA	NA	NA
AYE57745.1\|73316_73751_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYE57746.1\|73865_74603_+	DUF975 domain-containing protein	NA	NA	NA	NA
AYE57747.1\|74718_75447_+	hypothetical protein	NA	NA	NA	NA
AYE57748.1\|75538_75829_+	RNA-binding protein	NA	NA	NA	NA
AYE57749.1\|75910_76699_+	DUF4931 domain-containing protein	NA	NA	NA	NA
AYE57750.1\|76901_78089_-	MFS transporter	NA	NA	NA	NA
AYE57751.1\|78426_78759_+	hypothetical protein	NA	NA	NA	NA
AYE57752.1\|78786_79095_+	hypothetical protein	NA	NA	NA	NA
AYE57753.1\|79323_80061_+	DUF1003 domain-containing protein	NA	NA	NA	NA
AYE57754.1\|80196_81054_-	DUF368 domain-containing protein	NA	NA	NA	NA
AYE57755.1\|81075_81261_+	hypothetical protein	NA	NA	NA	NA
AYE57756.1\|81278_82619_+	amino acid permease	NA	NA	NA	NA
AYE57757.1\|82811_83696_+	hypothetical protein	NA	NA	NA	NA
AYE57758.1\|83846_84197_-	hypothetical protein	NA	NA	NA	NA
AYE57759.1\|87200_87999_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AYE57760.1\|88711_89413_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AYE57761.1\|89414_90440_+	ribitol-5-phosphate dehydrogenase	NA	NA	NA	NA
AYE57762.1\|90427_91534_+	ribitolphosphotransferase	NA	NA	NA	NA
AYE57763.1\|91559_93455_+	CDP-glycerol--poly(glycerophosphate) glycerophosphotransferase	NA	NA	NA	NA
AYE57764.1\|93553_94081_+	N-acetyltransferase	NA	NA	NA	NA
AYE57765.1\|94251_94689_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYE57766.1\|94754_96104_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	1.6e-27	26.5
AYE57767.1\|96182_96461_-	hypothetical protein	NA	NA	NA	NA
AYE57768.1\|96762_97470_+\|transposase	transposase	NA	NA	NA	NA
AYE57769.1\|97517_98354_+\|transposase	transposase	U5P429	Shigella_phage	2.2e-19	28.5

DBSCAN-SWA_2

250664 : 348402

102

Lactobacillus_phage(66.0%)

tail,capsid,tRNA,portal,integrase,terminase,transposase,holin,protease,head

attL 293575:293592|attR 355335:355352

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE57895.1\|250664_252218_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	8.8e-54	31.2
AYE57896.1\|252265_252625_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AYE57897.1\|252614_252794_-	hypothetical protein	NA	NA	NA	NA
AYE57898.1\|252920_254198_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
AYE57899.1\|254194_254437_-	D-alanine--poly(phosphoribitol) ligase subunit 2	NA	NA	NA	NA
AYE57900.1\|254460_255675_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	1.9e-27	30.5
AYE57901.1\|257239_257389_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
AYE57902.1\|257420_258596_-	peptidase S12	NA	NA	NA	NA
AYE57903.1\|259029_260172_-	molecular chaperone DnaJ	A0A2K9L588	Tupanvirus	4.3e-21	32.0
AYE57904.1\|260273_262142_-	molecular chaperone DnaK	A0A2P1EIW2	Megavirus	5.0e-136	47.2
AYE57905.1\|262185_262785_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AYE57906.1\|262805_263849_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
AYE57907.1\|264241_264952_-	acetolactate decarboxylase	NA	NA	NA	NA
AYE57908.1\|264952_265954_-	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
AYE57909.1\|265966_266890_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AYE57910.1\|267361_267883_-	shikimate kinase	NA	NA	NA	NA
AYE57911.1\|267885_268983_-	prephenate dehydrogenase	NA	NA	NA	NA
AYE57912.1\|268985_270284_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AYE57913.1\|270297_270825_-	amino acid biosynthesis protein	NA	NA	NA	NA
AYE57914.1\|270833_272003_-	chorismate synthase	NA	NA	NA	NA
AYE57915.1\|271995_273450_-	MFS transporter	NA	NA	NA	NA
AYE57916.1\|273918_274848_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.1e-19	31.8
AYE57917.1\|274857_275676_-\|transposase	IS982 family transposase	NA	NA	NA	NA
AYE57918.1\|276138_276492_-	ribosome-binding factor A	NA	NA	NA	NA
AYE57919.1\|276514_279091_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	9.6e-21	23.3
AYE57920.1\|279105_279411_-	hypothetical protein	NA	NA	NA	NA
AYE57921.1\|279400_279700_-	DUF448 domain-containing protein	NA	NA	NA	NA
AYE57922.1\|279744_280962_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AYE57923.1\|280982_281459_-	ribosome maturation factor RimP	NA	NA	NA	NA
AYE57924.1\|281754_286068_-	PolC-type DNA polymerase III	A0A1X9SH08	Bradyrhizobium_phage	7.7e-15	34.0
AYE57925.1\|286561_288271_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AYE57926.1\|288310_289588_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AYE57927.1\|289625_290411_-	CDP-archaeol synthase	NA	NA	NA	NA
AYE57928.1\|290426_291206_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.8e-23	43.1
AYE57929.1\|291325_291889_-	ribosome-recycling factor	NA	NA	NA	NA
AYE57930.1\|291890_292613_-	UMP kinase	NA	NA	NA	NA
AYE57931.1\|292812_293691_-	elongation factor Ts	NA	NA	NA	NA
293575:293592	attL	NA	NA	NA	NA
AYE57932.1\|293793_294597_-	30S ribosomal protein S2	NA	NA	NA	NA
AYE57933.1\|294821_295544_+	HAD family hydrolase	NA	NA	NA	NA
AYE57934.1\|295832_296831_-	lactate dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
AYE57935.1\|296915_297221_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
AYE57936.1\|297204_297963_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
AYE57937.1\|298074_298710_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AYE57938.1\|298767_299004_-	hypothetical protein	NA	NA	NA	NA
AYE57939.1\|299101_299341_-	DUF896 family protein	NA	NA	NA	NA
AYE57940.1\|299492_300125_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	3.9e-16	54.8
AYE57941.1\|300217_300865_-	hypothetical protein	NA	NA	NA	NA
AYE57942.1\|300964_301594_+	hypothetical protein	NA	NA	NA	NA
AYE57943.1\|301643_302813_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
AYE57944.1\|302848_303241_-	hypothetical protein	NA	NA	NA	NA
AYE57945.1\|303404_303806_+	hypothetical protein	NA	NA	NA	NA
AYE57946.1\|304235_305177_+	glycosyltransferase	V9QJB1	Oenococcus_phage	4.8e-79	49.4
AYE57947.1\|306740_307004_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.2e-34	89.7
AYE57948.1\|307003_308185_-	endolysin	E9LUR8	Lactobacillus_phage	9.3e-189	85.8
AYE57949.1\|308196_308409_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	8.4e-16	73.8
AYE57950.1\|308482_308710_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	1.4e-16	67.1
AYE57951.1\|308706_309732_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	3.3e-49	75.4
AYE57952.1\|310065_310305_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	5.7e-29	89.6
AYE57953.1\|311672_314084_-	hypothetical protein	A0A2P0ZLF8	Lactobacillus_phage	0.0e+00	94.0
AYE57954.1\|314152_315925_-\|tail	phage tail protein	A0A2P0ZLH2	Lactobacillus_phage	1.1e-305	90.7
AYE57955.1\|315999_320898_-	peptidase M23	A0A2P0ZLG0	Lactobacillus_phage	0.0e+00	69.5
AYE57956.1\|320928_321114_-	hypothetical protein	NA	NA	NA	NA
AYE57957.1\|321158_321533_-	hypothetical protein	A0A2P0ZLH4	Lactobacillus_phage	2.3e-56	91.9
AYE57958.1\|321608_322265_-\|tail	phage tail protein	A0A2P0ZLH1	Lactobacillus_phage	2.4e-101	85.3
AYE57959.1\|322280_322661_-	DUF806 domain-containing protein	A0A2P0ZLF4	Lactobacillus_phage	1.4e-48	80.2
AYE57960.1\|322660_323068_-	hypothetical protein	A0A2P0ZLE6	Lactobacillus_phage	1.7e-65	93.2
AYE57961.1\|323070_323418_-\|head,tail	head-tail adaptor protein	A0A2P0ZLF0	Lactobacillus_phage	1.3e-42	70.4
AYE57962.1\|323407_323740_-	DNA packaging protein	E9LUQ4	Lactobacillus_phage	1.4e-44	84.5
AYE57963.1\|323812_325018_-\|capsid	phage major capsid protein	E9LUQ3	Lactobacillus_phage	4.0e-195	87.1
AYE57964.1\|325017_325782_-	peptidase	E9LUQ2	Lactobacillus_phage	1.4e-124	92.5
AYE57965.1\|325759_326923_-\|portal	phage portal protein	E9LUQ1	Lactobacillus_phage	4.2e-210	94.0
AYE57966.1\|326925_327120_-	DUF1056 domain-containing protein	E9LUQ0	Lactobacillus_phage	2.8e-26	93.8
AYE57967.1\|328958_329411_-\|terminase	phage terminase small subunit P27 family	E9LUP8	Lactobacillus_phage	2.8e-77	94.0
AYE57968.1\|329618_330131_-	HNH endonuclease	E9LUP7	Lactobacillus_phage	5.3e-80	91.7
AYE57969.1\|330272_330587_-	hypothetical protein	NA	NA	NA	NA
AYE57970.1\|330588_330891_-	hypothetical protein	NA	NA	NA	NA
AYE57971.1\|331562_331988_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	3.2e-67	87.9
AYE57972.1\|333076_333295_-	hypothetical protein	Q597W8	Lactobacillus_virus	1.0e-24	79.2
AYE57973.1\|333287_333473_-	hypothetical protein	E9LUN7	Lactobacillus_phage	1.5e-05	74.2
AYE57974.1\|333485_333695_-	hypothetical protein	D6PSV2	Lactobacillus_phage	2.0e-30	95.7
AYE57975.1\|333691_334069_-	hypothetical protein	NA	NA	NA	NA
AYE57976.1\|334065_334566_-	hypothetical protein	O03915	Lactobacillus_phage	2.3e-56	65.5
AYE57977.1\|334701_335487_-	DNA replication protein	E9LUN6	Lactobacillus_phage	7.7e-131	90.4
AYE57978.1\|335486_336245_-	replisome organizer	E9LUM6	Lactobacillus_phage	3.0e-39	56.6
AYE57979.1\|336294_336987_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.8e-131	98.7
AYE57980.1\|337033_337693_-	DUF669 domain-containing protein	E9LUU2	Lactobacillus_phage	6.6e-75	78.5
AYE57981.1\|337695_338358_-	nucleotide-binding protein	E9LUU1	Lactobacillus_phage	4.5e-116	95.0
AYE57982.1\|338358_339219_-	DUF1351 domain-containing protein	A0A2D1GPE4	Lactobacillus_phage	3.5e-36	33.8
AYE57983.1\|339534_339789_-	hypothetical protein	NA	NA	NA	NA
AYE57984.1\|339931_340192_-	hypothetical protein	NA	NA	NA	NA
AYE57985.1\|340346_340529_-	hypothetical protein	NA	NA	NA	NA
AYE57986.1\|340542_340752_-	hypothetical protein	NA	NA	NA	NA
AYE57987.1\|340763_341480_-	phage regulatory protein	D2IYT0	Enterococcus_phage	5.7e-64	58.5
AYE57988.1\|341536_341788_+	hypothetical protein	NA	NA	NA	NA
AYE57989.1\|341802_342578_-\|transposase	IS5/IS1182 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.1e-27	53.2
AYE57990.1\|342747_342963_-	transcriptional regulator	A0A2H4JBV7	uncultured_Caudovirales_phage	5.9e-17	71.0
AYE60311.1\|343155_343827_+	multidrug transporter	D7RWL5	Brochothrix_phage	9.7e-42	55.0
AYE57991.1\|343949_345224_+	DNA polymerase III subunit epsilon	A0A0A7RWA3	Clostridium_phage	1.6e-24	35.8
AYE57992.1\|345532_345721_+	hypothetical protein	E9LUS5	Lactobacillus_phage	3.6e-26	98.4
AYE57993.1\|345878_346193_+	hypothetical protein	NA	NA	NA	NA
AYE57994.1\|346383_346692_-	hypothetical protein	NA	NA	NA	NA
AYE57995.1\|347238_348402_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
355335:355352	attR	NA	NA	NA	NA

DBSCAN-SWA_3

639324 : 702688

Lactobacillus_phage(41.03%)

tail,capsid,portal,integrase,terminase,transposase,holin,head

attL 687731:687752|attR 701971:701992

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE58249.1\|639324_639852_-\|transposase	transposase	NA	NA	NA	NA
AYE58250.1\|640036_641008_-	hypothetical protein	NA	NA	NA	NA
AYE58251.1\|641022_642912_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.4e-58	32.1
AYE58252.1\|642911_644642_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.0e-46	27.4
AYE58253.1\|644864_645257_-	hypothetical protein	NA	NA	NA	NA
AYE58254.1\|645479_646331_+	polysaccharide deacetylase	NA	NA	NA	NA
AYE58255.1\|646812_648135_+	Fic family protein	A0A1V0E025	Clostridioides_phage	1.4e-12	35.1
AYE60322.1\|648441_648807_-\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	4.7e-14	79.2
AYE58256.1\|648820_649084_-\|holin	holin	E9LUR9	Lactobacillus_phage	1.1e-36	95.4
AYE58257.1\|649083_650241_-	endolysin	E9LUR8	Lactobacillus_phage	1.4e-189	85.1
AYE58258.1\|650559_650772_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	1.8e-18	80.3
AYE58259.1\|650768_651794_-	hypothetical protein	A0A2P0ZLF6	Lactobacillus_phage	9.9e-54	75.5
AYE58260.1\|651875_652004_-	XkdX family protein	NA	NA	NA	NA
AYE58261.1\|653209_653791_-	DUF2479 domain-containing protein	A0A1J0MFQ3	Staphylococcus_phage	1.5e-43	47.4
AYE58262.1\|653805_654798_-	SGNH/GDSL hydrolase family protein	A0A1S6L1H1	Staphylococcus_phage	1.8e-31	35.0
AYE58263.1\|654802_656701_-	endolysin	A0A1X9IGI5	Lactococcus_phage	5.7e-47	34.3
AYE58264.1\|656700_657438_-\|tail	phage tail protein	A0A1S5SA63	Streptococcus_phage	1.7e-39	35.3
AYE58265.1\|657431_661436_-	tape measure protein	E9LUR1	Lactobacillus_phage	1.2e-81	44.5
AYE58266.1\|661435_661672_-	hypothetical protein	NA	NA	NA	NA
AYE58267.1\|661764_662253_-	hypothetical protein	NA	NA	NA	NA
AYE58268.1\|662270_662831_-\|tail	phage tail protein	NA	NA	NA	NA
AYE58269.1\|662842_663229_-	DUF3168 domain-containing protein	NA	NA	NA	NA
AYE58270.1\|663230_663785_-\|tail	phage tail protein	NA	NA	NA	NA
AYE60323.1\|663774_664098_-	hypothetical protein	NA	NA	NA	NA
AYE58271.1\|664102_664468_-	hypothetical protein	A0A1W6JNH7	Staphylococcus_phage	2.3e-05	39.6
AYE58272.1\|664482_665535_-\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	2.0e-33	31.0
AYE58273.1\|665551_666199_-	DUF4355 domain-containing protein	NA	NA	NA	NA
AYE58274.1\|666305_667250_-\|head	phage head morphogenesis protein	NA	NA	NA	NA
AYE58275.1\|667249_668908_-\|portal	phage portal protein	D2IZF6	Enterococcus_phage	1.3e-63	32.7
AYE58276.1\|668897_670184_-\|terminase	PBSX family phage terminase large subunit	B7T0C6	Staphylococcus_virus	9.1e-113	49.6
AYE58277.1\|670167_670725_-\|terminase	terminase small subunit	H9A0M8	Staphylococcus_phage	1.0e-12	46.5
AYE60324.1\|670765_671098_-	DUF2829 domain-containing protein	A0A0K2FLC4	Brevibacillus_phage	1.5e-11	44.3
AYE58278.1\|671187_671421_-	hypothetical protein	NA	NA	NA	NA
AYE58279.1\|671488_672370_-	hypothetical protein	NA	NA	NA	NA
AYE58280.1\|672980_673442_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	2.0e-38	56.3
AYE58281.1\|673682_673823_-	hypothetical protein	NA	NA	NA	NA
AYE58282.1\|673834_674152_-	hypothetical protein	A0A2K9VC43	Lactobacillus_phage	8.2e-15	43.8
AYE58283.1\|674155_674548_-	hypothetical protein	E9LUP3	Lactobacillus_phage	8.8e-43	65.9
AYE58284.1\|674544_674985_-	hypothetical protein	A0A1S5RCV6	Lactobacillus_phage	2.3e-36	53.4
AYE58285.1\|674968_675166_-	hypothetical protein	NA	NA	NA	NA
AYE58286.1\|675169_675481_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	3.2e-48	90.3
AYE58287.1\|675483_675858_-	hypothetical protein	NA	NA	NA	NA
AYE58288.1\|675854_676373_-	hypothetical protein	O03915	Lactobacillus_phage	9.5e-37	52.3
AYE58289.1\|676377_677100_-	oxidoreductase	Q8SDM9	Staphylococcus_phage	2.8e-50	44.7
AYE58290.1\|677096_677384_-	hypothetical protein	NA	NA	NA	NA
AYE58291.1\|677380_678346_-	DNA replication protein DnaD	NA	NA	NA	NA
AYE58292.1\|678371_679232_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	3.6e-73	49.4
AYE58293.1\|679155_680043_-	recombinase RecT	E9LUM3	Lactobacillus_phage	2.8e-60	46.7
AYE58294.1\|680039_680426_-	hypothetical protein	NA	NA	NA	NA
AYE58295.1\|680558_680729_-	hypothetical protein	NA	NA	NA	NA
AYE58296.1\|680796_681309_-	XRE family transcriptional regulator	D6PST4	Lactobacillus_phage	2.3e-27	42.9
AYE58297.1\|681376_681682_-	DUF771 domain-containing protein	NA	NA	NA	NA
AYE60325.1\|681860_682115_-	XRE family transcriptional regulator	NA	NA	NA	NA
AYE58298.1\|682260_682764_+	XRE family transcriptional regulator	S6C481	Thermus_phage	1.1e-21	41.4
AYE58299.1\|682778_683201_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	1.0e-12	34.4
AYE58300.1\|683304_684024_+	hypothetical protein	NA	NA	NA	NA
AYE58301.1\|684597_684957_+	hypothetical protein	NA	NA	NA	NA
AYE58302.1\|684987_685269_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AYE58303.1\|687217_687424_-	hypothetical protein	NA	NA	NA	NA
687731:687752	attL	NA	NA	NA	NA
AYE58304.1\|687837_688149_-	hypothetical protein	NA	NA	NA	NA
AYE58305.1\|688231_688612_-	hypothetical protein	NA	NA	NA	NA
AYE58306.1\|688761_689031_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
AYE58307.1\|689123_690689_-\|capsid	phage major capsid protein	A0A1J0MFW8	Staphylococcus_phage	1.1e-40	34.4
AYE58308.1\|690678_691785_-\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.8e-48	34.2
AYE58309.1\|691785_691986_-	hypothetical protein	NA	NA	NA	NA
AYE58310.1\|691939_693643_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	4.1e-121	40.1
AYE58311.1\|693639_694113_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
AYE58312.1\|695044_695311_-	hypothetical protein	NA	NA	NA	NA
AYE58313.1\|695351_695732_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.9e-18	43.9
AYE58314.1\|695724_696063_-\|head,tail	head-tail adaptor protein	A0A2P0ZLF0	Lactobacillus_phage	4.6e-08	35.6
AYE58315.1\|696049_696241_-	hypothetical protein	NA	NA	NA	NA
AYE58316.1\|696256_696736_-	hypothetical protein	NA	NA	NA	NA
AYE58317.1\|696881_698276_-	virulence protein	A0A1W6JQD6	Staphylococcus_phage	2.2e-67	41.4
AYE58318.1\|698275_699076_-	DNA replication protein	NA	NA	NA	NA
AYE58319.1\|699072_699291_-	hypothetical protein	NA	NA	NA	NA
AYE58320.1\|699422_699530_-	hypothetical protein	NA	NA	NA	NA
AYE58321.1\|699572_699755_-	DNA-binding protein	NA	NA	NA	NA
AYE58322.1\|699933_700584_+	XRE family transcriptional regulator	A0A1W6JQE6	Staphylococcus_phage	3.6e-09	46.5
AYE58323.1\|700634_701792_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	2.5e-53	34.5
AYE58324.1\|702160_702688_+\|transposase	transposase	NA	NA	NA	NA
701971:701992	attR	NA	NA	NA	NA

DBSCAN-SWA_4

898291 : 906805

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE58491.1\|898291_898870_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.5e-22	33.9
AYE58492.1\|898862_899888_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	3.2e-60	41.0
AYE58493.1\|899884_901339_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.3e-50	34.0
AYE58494.1\|901323_903543_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	2.7e-144	39.3
AYE58495.1\|903535_904216_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AYE58496.1\|904215_904470_-	phosphoribosylformylglycinamidine synthase	NA	NA	NA	NA
AYE58497.1\|904471_905203_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
AYE58498.1\|905205_906336_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AYE58499.1\|906319_906805_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.9e-16	40.4

DBSCAN-SWA_5

1038083 : 1078708

Bacillus_phage(37.5%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE58616.1\|1038083_1039007_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.3e-31	31.3
AYE58617.1\|1039682_1040279_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYE58618.1\|1040288_1041329_-	Zn-dependent alcohol dehydrogenase	NA	NA	NA	NA
AYE58619.1\|1041349_1042207_-	short-chain dehydrogenase	NA	NA	NA	NA
AYE58620.1\|1042646_1042868_-	antitoxin MazE	NA	NA	NA	NA
AYE58621.1\|1043123_1043567_-	universal stress protein	NA	NA	NA	NA
AYE58622.1\|1043638_1044208_-	sugar O-acetyltransferase	NA	NA	NA	NA
AYE58623.1\|1044304_1044988_+	noncanonical pyrimidine nucleotidase, YjjG family	NA	NA	NA	NA
AYE58624.1\|1045129_1045645_-	hypothetical protein	NA	NA	NA	NA
AYE58625.1\|1046066_1046414_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	1.1e-15	43.0
AYE58626.1\|1046413_1046632_-	transcription elongation factor GreAB	NA	NA	NA	NA
AYE58627.1\|1047395_1047935_-	hypothetical protein	NA	NA	NA	NA
AYE58628.1\|1048103_1048871_-	hypothetical protein	NA	NA	NA	NA
AYE58629.1\|1048949_1050272_-	glycosyl hydrolase, family 25 (GH25)	NA	NA	NA	NA
AYE58630.1\|1050359_1051535_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE58631.1\|1051818_1052445_-	hypothetical protein	NA	NA	NA	NA
AYE58632.1\|1052434_1053091_-	multidrug ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-31	39.3
AYE58633.1\|1053087_1053687_-	hypothetical protein	NA	NA	NA	NA
AYE58634.1\|1053736_1053832_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AYE58635.1\|1053858_1054788_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	5.5e-19	29.5
AYE58636.1\|1054834_1055497_-	hypothetical protein	NA	NA	NA	NA
AYE58637.1\|1055545_1056313_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	3.5e-35	33.2
AYE58638.1\|1056351_1056615_-\|transposase	transposase	A0A0C5AJ30	Paenibacillus_phage	6.8e-07	37.5
AYE58639.1\|1056657_1057290_-	hypothetical protein	NA	NA	NA	NA
AYE58640.1\|1057362_1057824_-	hypothetical protein	NA	NA	NA	NA
AYE58641.1\|1058419_1059013_-	NADP oxidoreductase	NA	NA	NA	NA
AYE58642.1\|1060316_1061183_-	DUF3737 domain-containing protein	NA	NA	NA	NA
AYE58643.1\|1061285_1062314_-	aldo/keto reductase	NA	NA	NA	NA
AYE58644.1\|1062951_1064739_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	9.5e-44	25.0
AYE58645.1\|1064738_1066490_-	multidrug ABC transporter permease/ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-53	30.6
AYE58646.1\|1066758_1068153_+	MFS transporter	NA	NA	NA	NA
AYE58647.1\|1068321_1068549_-	hypothetical protein	NA	NA	NA	NA
AYE58648.1\|1068642_1069194_+	hypothetical protein	NA	NA	NA	NA
AYE58649.1\|1069347_1073055_-	hypothetical protein	NA	NA	NA	NA
AYE58650.1\|1073079_1073727_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYE58651.1\|1073732_1074062_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AYE58652.1\|1074550_1075495_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
AYE58653.1\|1075571_1076117_-	N-acetyltransferase	NA	NA	NA	NA
AYE58654.1\|1076379_1076907_-	N-acetyltransferase	NA	NA	NA	NA
AYE58655.1\|1077502_1078708_-\|protease	CPBP family intramembrane metalloprotease domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_6

1174731 : 1240464

unidentified_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE58734.1\|1174731_1175661_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	5.0e-20	29.9
AYE58735.1\|1175687_1175786_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AYE58736.1\|1176217_1176544_-	PTS sugar transporter subunit IIB	NA	NA	NA	NA
AYE58737.1\|1176567_1178040_-	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AYE58738.1\|1178039_1179422_-	glycoside hydrolase family 1 protein	NA	NA	NA	NA
AYE58739.1\|1179618_1180638_-	aldehyde reductase	NA	NA	NA	NA
AYE58740.1\|1180743_1181187_+	MerR family transcriptional regulator	NA	NA	NA	NA
AYE58741.1\|1181570_1182185_+	peptidoglycan-binding protein	A0A2K9V574	Lactobacillus_phage	1.3e-11	60.0
AYE58742.1\|1182375_1183305_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
AYE58743.1\|1183671_1184334_+	peptidoglycan-binding protein	A0A2K9V574	Lactobacillus_phage	7.7e-15	48.9
AYE58744.1\|1185245_1185593_+	RNA-binding protein	NA	NA	NA	NA
AYE58745.1\|1185578_1186472_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AYE58746.1\|1187232_1187877_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AYE58747.1\|1189281_1189707_-	hypothetical protein	NA	NA	NA	NA
AYE58748.1\|1189706_1191227_-	LytTR family transcriptional regulator	D0R0A3	Streptococcus_phage	6.5e-25	28.0
AYE58749.1\|1191567_1192479_-	LysR family transcriptional regulator	NA	NA	NA	NA
AYE60335.1\|1193060_1193804_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYE58750.1\|1193851_1195258_+	hypothetical protein	NA	NA	NA	NA
AYE58751.1\|1195274_1195913_+	saccharopine dehydrogenase	NA	NA	NA	NA
AYE58752.1\|1196386_1196797_+	cupin domain-containing protein	NA	NA	NA	NA
AYE58753.1\|1196810_1197164_+	hypothetical protein	NA	NA	NA	NA
AYE58754.1\|1197180_1197936_+	oxidoreductase	NA	NA	NA	NA
AYE58755.1\|1197952_1198609_+	short-chain dehydrogenase	NA	NA	NA	NA
AYE58756.1\|1198772_1199963_-	hypothetical protein	NA	NA	NA	NA
AYE58757.1\|1199984_1201766_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	5.6e-44	27.0
AYE58758.1\|1204774_1205974_+	amidohydrolase	NA	NA	NA	NA
AYE58759.1\|1206065_1206956_-	NAD(P)-dependent dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.7e-57	47.1
AYE58760.1\|1207756_1208932_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE58761.1\|1209150_1209972_-	transcriptional regulator	NA	NA	NA	NA
AYE58762.1\|1210098_1211583_-	glutamate/gamma-aminobutyrate family transporter YjeM	NA	NA	NA	NA
AYE58763.1\|1211879_1212275_+	transglycosylase	A0A249XZV3	Enterococcus_phage	2.1e-15	60.0
AYE58764.1\|1212570_1213743_+	1,3-propanediol dehydrogenase	NA	NA	NA	NA
AYE58765.1\|1214064_1214280_+	hypothetical protein	NA	NA	NA	NA
AYE58766.1\|1214973_1216095_-	NAD(P)-dependent alcohol dehydrogenase	A0A2K9L7I1	Tupanvirus	4.2e-13	27.8
AYE58767.1\|1216459_1218385_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.2e-81	34.3
AYE58768.1\|1218384_1218654_-	cupredoxin domain-containing protein	NA	NA	NA	NA
AYE58769.1\|1218668_1219043_-	copper-binding protein	NA	NA	NA	NA
AYE58770.1\|1223653_1224415_-	AraC family transcriptional regulator	NA	NA	NA	NA
AYE58771.1\|1224553_1224688_+	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
AYE60336.1\|1224871_1226140_-	GHKL domain-containing protein	NA	NA	NA	NA
AYE58772.1\|1226230_1226314_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AYE58773.1\|1226340_1227270_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.6e-18	31.4
AYE58774.1\|1228288_1229464_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE58775.1\|1229499_1229775_-	hypothetical protein	NA	NA	NA	NA
AYE58776.1\|1229789_1230089_-	PTS galactitol transporter subunit IIB	NA	NA	NA	NA
AYE58777.1\|1230101_1230572_-	PTS lactose transporter subunit IIBC	NA	NA	NA	NA
AYE58778.1\|1230601_1232638_-	transcription antiterminator BglG	NA	NA	NA	NA
AYE58779.1\|1233742_1233970_-	hypothetical protein	NA	NA	NA	NA
AYE58780.1\|1235002_1235245_-	hypothetical protein	NA	NA	NA	NA
AYE58781.1\|1235278_1236016_-	class I SAM-dependent methyltransferase	A0A097BYE1	Leuconostoc_phage	4.5e-40	37.2
AYE58782.1\|1236431_1237124_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AYE58783.1\|1237199_1238282_-	AI-2E family transporter	NA	NA	NA	NA
AYE58784.1\|1238428_1239583_-	ROK family protein	NA	NA	NA	NA
AYE58785.1\|1239936_1240464_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_7

1286772 : 1342238

Erysipelothrix_phage(18.18%)

tRNA,holin,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE58830.1\|1286772_1288218_+\|tRNA	tRNA (uracil-5-)-methyltransferase	A0A2K5B251	Erysipelothrix_phage	4.9e-83	37.7
AYE58831.1\|1288256_1288700_+	hypothetical protein	NA	NA	NA	NA
AYE58832.1\|1289012_1289864_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYE58833.1\|1289978_1290803_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AYE58834.1\|1290874_1291324_-	MerR family transcriptional regulator	NA	NA	NA	NA
AYE58835.1\|1294765_1295434_-	endonuclease III	NA	NA	NA	NA
AYE58836.1\|1295549_1295807_-	hypothetical protein	NA	NA	NA	NA
AYE58837.1\|1295841_1296393_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	1.2e-34	41.5
AYE58838.1\|1296774_1298049_+	hypothetical protein	NA	NA	NA	NA
AYE58839.1\|1298184_1298781_-	hypothetical protein	NA	NA	NA	NA
AYE58840.1\|1298970_1299453_+	transcriptional repressor	NA	NA	NA	NA
AYE58841.1\|1299697_1300054_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AYE58842.1\|1300248_1300476_-	hypothetical protein	NA	NA	NA	NA
AYE58843.1\|1300530_1301385_-	3',5'-cyclic-nucleotide phosphodiesterase	NA	NA	NA	NA
AYE58844.1\|1301826_1302378_+	N-acetyltransferase	NA	NA	NA	NA
AYE58845.1\|1302790_1303210_-	effector of murein hydrolase LrgA	NA	NA	NA	NA
AYE58846.1\|1303229_1303958_-\|holin	antiholin LrgB	NA	NA	NA	NA
AYE58847.1\|1304132_1304972_-	DegV family protein	NA	NA	NA	NA
AYE58848.1\|1305496_1305664_-	hypothetical protein	NA	NA	NA	NA
AYE58849.1\|1305831_1306530_+	peptidase	NA	NA	NA	NA
AYE58850.1\|1308612_1309494_+	phytoene/squalene synthase family protein	NA	NA	NA	NA
AYE58851.1\|1309855_1310797_+	alpha/beta hydrolase	NA	NA	NA	NA
AYE58852.1\|1310863_1311976_-	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-35	35.3
AYE58853.1\|1312111_1313446_+	glutathione reductase	A0A2K5B2C5	Erysipelothrix_phage	2.5e-25	26.4
AYE58854.1\|1313640_1313970_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AYE58855.1\|1314191_1315490_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	3.8e-18	33.6
AYE58856.1\|1315806_1317096_+	adenylosuccinate synthase	L7Y4J5	Megavirus	6.0e-72	37.0
AYE58857.1\|1317138_1318116_+	guanosine monophosphate reductase	Q4ZCY7	Staphylococcus_virus	1.4e-137	71.2
AYE58858.1\|1318271_1319057_+	protein-tyrosine-phosphatase	NA	NA	NA	NA
AYE58859.1\|1319136_1320594_-	cardiolipin synthase	NA	NA	NA	NA
AYE58860.1\|1321276_1321996_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYE58861.1\|1322105_1323980_+	YhgE/Pip domain-containing protein	NA	NA	NA	NA
AYE58862.1\|1324037_1324631_+	DUF1211 domain-containing protein	NA	NA	NA	NA
AYE58863.1\|1325277_1326453_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE58864.1\|1327576_1329001_+	amino acid permease	NA	NA	NA	NA
AYE58865.1\|1329262_1331305_+	potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	8.0e-63	33.7
AYE58866.1\|1331377_1332322_-	cation efflux family transporter	NA	NA	NA	NA
AYE58867.1\|1332650_1333697_-	AI-2E family transporter	NA	NA	NA	NA
AYE58868.1\|1334158_1335277_+	hypothetical protein	A0A218MNE0	uncultured_virus	4.1e-69	43.5
AYE58869.1\|1335364_1335748_-	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AYE58870.1\|1335762_1336071_-	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AYE58871.1\|1336420_1337059_-	hemolysin III	NA	NA	NA	NA
AYE58872.1\|1337335_1337680_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AYE58873.1\|1337818_1338706_+	cation transporter	NA	NA	NA	NA
AYE58874.1\|1338891_1339530_-	XRE family transcriptional regulator	A0A0S2MVM8	Bacillus_phage	1.4e-05	49.2
AYE58875.1\|1339607_1339841_-	hypothetical protein	NA	NA	NA	NA
AYE58876.1\|1340350_1340521_+	hypothetical protein	NA	NA	NA	NA
AYE58877.1\|1340646_1341354_+\|transposase	transposase	NA	NA	NA	NA
AYE58878.1\|1341401_1342238_+\|transposase	transposase	U5P429	Shigella_phage	2.2e-19	28.5

DBSCAN-SWA_8

1432139 : 1493664

unidentified_phage(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE58955.1\|1432139_1433315_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE58956.1\|1434015_1434825_-	WxL domain-containing protein	NA	NA	NA	NA
AYE58957.1\|1434950_1435880_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
AYE58958.1\|1436425_1436929_-	MarR family transcriptional regulator	NA	NA	NA	NA
AYE58959.1\|1437089_1437758_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYE58960.1\|1438064_1439726_+	phosphoenolpyruvate carboxykinase (ATP)	NA	NA	NA	NA
AYE58961.1\|1439827_1440025_+	hypothetical protein	NA	NA	NA	NA
AYE58962.1\|1440191_1441601_+	glutamate decarboxylase	NA	NA	NA	NA
AYE58963.1\|1441732_1442899_-	gamma-D-glutamyl-meso-diaminopimelate peptidase	NA	NA	NA	NA
AYE58964.1\|1443179_1443524_-	hypothetical protein	NA	NA	NA	NA
AYE58965.1\|1443630_1444002_+	hypothetical protein	NA	NA	NA	NA
AYE58966.1\|1444448_1444676_-	hypothetical protein	NA	NA	NA	NA
AYE58967.1\|1444809_1445985_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE58968.1\|1446092_1446632_-	hypothetical protein	NA	NA	NA	NA
AYE58969.1\|1447126_1447657_-	XRE family transcriptional regulator	NA	NA	NA	NA
AYE58970.1\|1447824_1448418_-	hypothetical protein	NA	NA	NA	NA
AYE58971.1\|1448439_1448751_-	DUF2316 domain-containing protein	NA	NA	NA	NA
AYE58972.1\|1448764_1449766_-	amidohydrolase	NA	NA	NA	NA
AYE58973.1\|1449885_1450464_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYE58974.1\|1450624_1451578_+	peroxidase	S4VXK8	Pandoravirus	5.7e-19	28.7
AYE58975.1\|1451845_1452559_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
AYE58976.1\|1452559_1453255_+	S-adenosyl-L-methionine-binding protein	NA	NA	NA	NA
AYE60341.1\|1454444_1454690_+	hypothetical protein	NA	NA	NA	NA
AYE58977.1\|1454682_1454856_+	hypothetical protein	NA	NA	NA	NA
AYE58978.1\|1454992_1455178_+	hypothetical protein	NA	NA	NA	NA
AYE58979.1\|1455323_1457228_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.6e-95	34.2
AYE58980.1\|1457381_1458134_-	aquaporin family protein	M1HQW3	Paramecium_bursaria_Chlorella_virus	3.8e-26	31.0
AYE58981.1\|1458518_1458839_+	thioredoxin	A0A2K9L3H4	Tupanvirus	5.2e-09	39.1
AYE58982.1\|1458862_1459132_+	hypothetical protein	NA	NA	NA	NA
AYE58983.1\|1459231_1459435_-	hypothetical protein	NA	NA	NA	NA
AYE58984.1\|1459563_1460118_-	DNA starvation/stationary phase protection protein	NA	NA	NA	NA
AYE58985.1\|1460121_1460355_-	copper chaperone	NA	NA	NA	NA
AYE58986.1\|1460552_1461218_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AYE58987.1\|1461528_1463445_+	peptidase M13	E3T4I7	Cafeteria_roenbergensis_virus	2.8e-73	29.6
AYE60342.1\|1464277_1464484_-	hypothetical protein	NA	NA	NA	NA
AYE58988.1\|1464597_1465071_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYE58989.1\|1465129_1466482_-	NADH oxidase	NA	NA	NA	NA
AYE58990.1\|1466798_1468949_-	cell surface protein	NA	NA	NA	NA
AYE58991.1\|1468970_1469984_-	cell surface protein	NA	NA	NA	NA
AYE58992.1\|1470081_1470774_-	WxL domain-containing protein	NA	NA	NA	NA
AYE58993.1\|1470811_1471384_-	WxL domain-containing protein	NA	NA	NA	NA
AYE58994.1\|1471380_1471659_-	cell surface protein	NA	NA	NA	NA
AYE58995.1\|1472320_1472908_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYE58996.1\|1473035_1473335_-	hypothetical protein	NA	NA	NA	NA
AYE58997.1\|1473336_1474674_-	hypothetical protein	NA	NA	NA	NA
AYE58998.1\|1474691_1475885_-	ATPase	A0MZB4	Enterobacteria_phage	7.6e-05	24.8
AYE58999.1\|1476256_1476907_+	aquaporin	A0A1V0SCL5	Indivirus	1.9e-05	41.6
AYE59000.1\|1477118_1478855_-	2-octaprenylphenol hydroxylase	G8DDN0	Micromonas_pusilla_virus	2.5e-41	27.7
AYE59001.1\|1479350_1480742_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
AYE59002.1\|1480885_1482832_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AYE59003.1\|1482850_1484902_-	beta-galactosidase	NA	NA	NA	NA
AYE60343.1\|1485855_1485981_+	DNA methyltransferase	NA	NA	NA	NA
AYE59004.1\|1485935_1486722_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AYE59005.1\|1488136_1488532_-	PASTA domain-containing protein	NA	NA	NA	NA
AYE59006.1\|1488654_1489442_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AYE60344.1\|1489396_1489516_-	DNA methyltransferase	NA	NA	NA	NA
AYE59007.1\|1489885_1491844_-	alpha-rhamnosidase	NA	NA	NA	NA
AYE59008.1\|1492743_1493664_-\|transposase	IS30 family transposase ISLsa1	Q9MBM9	Staphylococcus_prophage	9.2e-51	38.2

DBSCAN-SWA_9

1832521 : 1889813

unidentified_phage(30.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE59298.1\|1832521_1833283_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYE59299.1\|1834219_1835014_-	transglycosylase	K4ID66	Lactobacillus_phage	5.6e-12	47.1
AYE59300.1\|1835563_1835665_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AYE59301.1\|1835691_1836621_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	34.5
AYE59302.1\|1837112_1837736_-	peptidase M23	NA	NA	NA	NA
AYE59303.1\|1838140_1838515_-	glycine cleavage system protein H	NA	NA	NA	NA
AYE59304.1\|1838524_1839442_-	hypothetical protein	NA	NA	NA	NA
AYE59305.1\|1839438_1840155_-	hypothetical protein	A0A1I9S5V4	Bacillus_phage	1.9e-19	37.1
AYE59306.1\|1840154_1842524_-	ATP-dependent DNA helicase	NA	NA	NA	NA
AYE59307.1\|1842942_1843305_-	hypothetical protein	NA	NA	NA	NA
AYE59308.1\|1843493_1844690_+	acetate kinase	NA	NA	NA	NA
AYE59309.1\|1844819_1845263_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYE59310.1\|1845336_1845759_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYE59311.1\|1845947_1847150_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AYE59312.1\|1847281_1847614_+	hypothetical protein	NA	NA	NA	NA
AYE59313.1\|1847713_1848784_-	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
AYE59314.1\|1848780_1849596_-	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
AYE59315.1\|1849595_1850429_-	spermidine/putrescine ABC transporter permease	Q6GZ02	Mycoplasma_phage	3.8e-11	22.5
AYE59316.1\|1850440_1851538_-	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	1.5e-36	41.6
AYE59317.1\|1851608_1852151_-	XRE family transcriptional regulator	NA	NA	NA	NA
AYE59318.1\|1852618_1853086_-	ASCH domain-containing protein	NA	NA	NA	NA
AYE59319.1\|1853271_1853757_+	N-acetyltransferase	NA	NA	NA	NA
AYE59320.1\|1853760_1854288_+	N-acetyltransferase	NA	NA	NA	NA
AYE59321.1\|1854381_1854567_+	hypothetical protein	NA	NA	NA	NA
AYE59322.1\|1854827_1855181_+	GntR family transcriptional regulator	NA	NA	NA	NA
AYE59323.1\|1855180_1856074_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AYE59324.1\|1856369_1857299_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
AYE59325.1\|1857325_1858147_+	acetoin ABC transporter permease	NA	NA	NA	NA
AYE59326.1\|1858252_1859620_-	acetaldehyde dehydrogenase	NA	NA	NA	NA
AYE59327.1\|1860046_1860910_+	fructose-1,6-bisphosphate aldolase, class II	NA	NA	NA	NA
AYE59328.1\|1861202_1862519_-	MFS transporter	NA	NA	NA	NA
AYE59329.1\|1862688_1863591_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
AYE59330.1\|1863603_1863804_-	hypothetical protein	NA	NA	NA	NA
AYE59331.1\|1865970_1866216_+	hypothetical protein	NA	NA	NA	NA
AYE59332.1\|1866344_1866908_+	BioY family transporter	NA	NA	NA	NA
AYE59333.1\|1866945_1867917_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AYE59334.1\|1867913_1868234_+	hypothetical protein	NA	NA	NA	NA
AYE59335.1\|1868387_1869563_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AYE59336.1\|1869737_1870904_-	hypothetical protein	NA	NA	NA	NA
AYE59337.1\|1871499_1872315_+	Teichoic acid translocation permease TagG	NA	NA	NA	NA
AYE59338.1\|1872327_1873419_+	teichoic acids export ATP-binding protein TagH	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7
AYE59339.1\|1874790_1875063_+	hypothetical protein	NA	NA	NA	NA
AYE59340.1\|1875289_1875832_+	PadR family transcriptional regulator	NA	NA	NA	NA
AYE59341.1\|1875828_1877274_+	MFS transporter	NA	NA	NA	NA
AYE59342.1\|1877378_1878086_+\|transposase	transposase	NA	NA	NA	NA
AYE59343.1\|1878133_1878970_+\|transposase	transposase	U5P429	Shigella_phage	2.2e-19	28.5
AYE59344.1\|1879307_1880624_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	1.9e-33	29.6
AYE59345.1\|1881119_1882079_+	L-lactate dehydrogenase	NA	NA	NA	NA
AYE59346.1\|1882181_1882451_+	hypothetical protein	NA	NA	NA	NA
AYE59347.1\|1882680_1883244_-	peptidase M10	NA	NA	NA	NA
AYE59348.1\|1883437_1884106_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
AYE59349.1\|1884263_1885769_+	copper oxidase	NA	NA	NA	NA
AYE59350.1\|1886033_1886402_+	DUF1304 domain-containing protein	NA	NA	NA	NA
AYE59351.1\|1886506_1887016_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
AYE59352.1\|1887046_1888243_-	DUF2075 domain-containing protein	NA	NA	NA	NA
AYE59353.1\|1888352_1888823_+	transcriptional regulator	NA	NA	NA	NA
AYE59354.1\|1888883_1889813_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9

DBSCAN-SWA_10

1906462 : 1940498

Bacillus_phage(25.0%)

tRNA,transposase,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE59367.1\|1906462_1907392_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9
AYE59368.1\|1907616_1907775_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
AYE59369.1\|1907799_1907970_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
AYE59370.1\|1908236_1910387_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	2.1e-45	28.2
AYE59371.1\|1910402_1911779_+	HlyD family secretion protein	NA	NA	NA	NA
AYE59372.1\|1912422_1913190_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.5e-35	33.2
AYE59373.1\|1913228_1913492_-\|transposase	transposase	A0A0C5AJ30	Paenibacillus_phage	6.8e-07	37.5
AYE59374.1\|1913932_1914613_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYE59375.1\|1914706_1915393_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYE60353.1\|1915543_1915831_+	hypothetical protein	NA	NA	NA	NA
AYE59376.1\|1915841_1916135_+	addiction module antidote protein, HigA family	M9MUN2	Rhodococcus_phage	9.9e-07	48.3
AYE59377.1\|1916424_1918734_-	ATP-dependent DNA helicase	NA	NA	NA	NA
AYE59378.1\|1918992_1919769_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
AYE59379.1\|1920208_1921225_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AYE59380.1\|1921632_1922343_+	GntR family transcriptional regulator	NA	NA	NA	NA
AYE59381.1\|1923784_1923973_+	hypothetical protein	NA	NA	NA	NA
AYE59382.1\|1923962_1924385_+	DUF3284 domain-containing protein	NA	NA	NA	NA
AYE60354.1\|1924607_1925963_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AYE59383.1\|1925980_1927417_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
AYE59384.1\|1927537_1928434_+	ROK family protein	NA	NA	NA	NA
AYE59385.1\|1928583_1929330_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AYE60355.1\|1929442_1930456_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
AYE59386.1\|1930897_1931815_+	exopolyphosphatase	NA	NA	NA	NA
AYE59387.1\|1931860_1933135_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
AYE59388.1\|1933127_1934087_+	IpaB/EvcA family protein	NA	NA	NA	NA
AYE59389.1\|1934108_1934813_+	NAD-dependent protein deacylase	NA	NA	NA	NA
AYE59390.1\|1934812_1935655_+	DUF72 domain-containing protein	NA	NA	NA	NA
AYE59391.1\|1936251_1936641_+	NUDIX domain-containing protein	NA	NA	NA	NA
AYE59392.1\|1936962_1939014_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
AYE59393.1\|1939089_1939716_-	hypothetical protein	A0A2I6AZV9	Macacine_betaherpesvirus	1.4e-37	44.7
AYE59394.1\|1939970_1940498_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_11

2109620 : 2118233

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE59533.1\|2109620_2111318_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
AYE59534.1\|2111339_2111648_+	nucleoid-associated protein, YbaB/EbfC family	NA	NA	NA	NA
AYE59535.1\|2111663_2112263_+	recombination protein RecR	NA	NA	NA	NA
AYE59536.1\|2112277_2112529_+	DUF2508 domain-containing protein	NA	NA	NA	NA
AYE59537.1\|2112914_2113580_+	thymidylate kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
AYE59538.1\|2113576_2113906_+	hypothetical protein	NA	NA	NA	NA
AYE59539.1\|2113922_2114942_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
AYE59540.1\|2114967_2115315_+	initiation-control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
AYE59541.1\|2115413_2116310_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	9.9e-82	55.7
AYE59542.1\|2116313_2117099_+	acyl-ACP thioesterase	NA	NA	NA	NA
AYE59543.1\|2117237_2118233_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.6e-51	38.2

DBSCAN-SWA_12

2198216 : 2248957

Staphylococcus_phage(16.67%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE59608.1\|2198216_2198807_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.0e-55	56.0
AYE59609.1\|2199779_2201117_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
AYE59610.1\|2201333_2202365_+	SorC family transcriptional regulator	NA	NA	NA	NA
AYE59611.1\|2202431_2203454_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AYE59612.1\|2203574_2204777_+	phosphoglycerate kinase	NA	NA	NA	NA
AYE59613.1\|2204803_2205562_+	triose-phosphate isomerase	NA	NA	NA	NA
AYE59614.1\|2205643_2206972_+	enolase	A0A1X9I5Z8	Streptococcus_phage	7.3e-174	71.1
AYE59615.1\|2207263_2207995_+	hypothetical protein	NA	NA	NA	NA
AYE59616.1\|2208011_2209565_+	ClC family H(+)/Cl(-) exchange transporter	NA	NA	NA	NA
AYE59617.1\|2209664_2209901_+	preprotein translocase subunit SecG	NA	NA	NA	NA
AYE59618.1\|2209949_2210699_+	carboxylesterase	NA	NA	NA	NA
AYE59619.1\|2210707_2213122_+	ribonuclease R	Q0GXV6	Lactococcus_phage	7.2e-87	39.6
AYE59620.1\|2213147_2213618_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	8.6e-45	61.0
AYE59621.1\|2213913_2214792_-\|transposase	IS982 family transposase ISLpl4	NA	NA	NA	NA
AYE59622.1\|2221703_2223140_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AYE59623.1\|2223142_2223877_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-32	39.7
AYE59624.1\|2224151_2224715_-	hypothetical protein	NA	NA	NA	NA
AYE59625.1\|2224738_2225608_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AYE59626.1\|2225723_2226416_+	uracil-DNA glycosylase	A0A1R3T3N6	Sphenicid_alphaherpesvirus	2.0e-42	41.1
AYE59627.1\|2226439_2227417_+	phosphate acetyltransferase	NA	NA	NA	NA
AYE59628.1\|2227526_2227988_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AYE59629.1\|2227993_2228509_+	N-acetyltransferase	NA	NA	NA	NA
AYE59630.1\|2228732_2229269_-	exonuclease	A0A2I6PEZ7	Staphylococcus_phage	8.9e-22	32.5
AYE59631.1\|2229331_2230096_-	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	3.0e-55	45.8
AYE59632.1\|2230416_2231319_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AYE59633.1\|2231490_2232399_+	UDP-N-acetylenolpyruvoylglucosamine reductase	NA	NA	NA	NA
AYE59634.1\|2232432_2234562_+	sodium:proton antiporter	NA	NA	NA	NA
AYE59635.1\|2234701_2235214_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYE59636.1\|2235289_2235955_-	DUF1361 domain-containing protein	NA	NA	NA	NA
AYE59637.1\|2236139_2236982_+	TIGR00159 family protein	NA	NA	NA	NA
AYE59638.1\|2236978_2237956_+	cell surface protein	NA	NA	NA	NA
AYE59639.1\|2237987_2239343_+	phosphoglucosamine mutase	NA	NA	NA	NA
AYE59640.1\|2241181_2241697_-	hypothetical protein	NA	NA	NA	NA
AYE59641.1\|2241668_2242358_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.8e-20	30.1
AYE59642.1\|2242718_2243894_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AYE59643.1\|2243929_2244253_-	DUF1700 domain-containing protein	NA	NA	NA	NA
AYE59644.1\|2244242_2244563_-	PadR family transcriptional regulator	NA	NA	NA	NA
AYE59645.1\|2244725_2244926_+	hypothetical protein	NA	NA	NA	NA
AYE59646.1\|2245221_2246145_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.1e-32	31.9
AYE59647.1\|2246243_2247143_+	hypothetical protein	NA	NA	NA	NA
AYE59648.1\|2247132_2247816_+	hypothetical protein	NA	NA	NA	NA
AYE59649.1\|2247887_2248655_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.5e-35	33.2
AYE59650.1\|2248693_2248957_-\|transposase	transposase	A0A0C5AJ30	Paenibacillus_phage	6.8e-07	37.5

DBSCAN-SWA_13

2315053 : 2370239

unidentified_phage(40.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE59705.1\|2315053_2315983_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.5e-19	29.9
AYE59706.1\|2316333_2317011_-	histidine phosphatase family protein	NA	NA	NA	NA
AYE59707.1\|2317025_2317682_-	histidine phosphatase family protein	NA	NA	NA	NA
AYE59708.1\|2317752_2319609_-	potassium transporter	NA	NA	NA	NA
AYE59709.1\|2319630_2320698_-	phosphohydrolase	NA	NA	NA	NA
AYE59710.1\|2320716_2321364_-	cytochrome O ubiquinol oxidase	NA	NA	NA	NA
AYE59711.1\|2321595_2323902_+	ATP-dependent DNA helicase	NA	NA	NA	NA
AYE59712.1\|2324194_2325124_+	enoyl-[acyl-carrier-protein] reductase FabK	NA	NA	NA	NA
AYE59713.1\|2325292_2326222_+	type I pantothenate kinase	NA	NA	NA	NA
AYE59714.1\|2326315_2327872_+	GMP synthase (glutamine-hydrolyzing)	A0A1V0SH76	Hokovirus	5.6e-16	29.2
AYE59715.1\|2330034_2330796_-	hypothetical protein	NA	NA	NA	NA
AYE59716.1\|2331038_2331737_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYE59717.1\|2331956_2332301_+	transcriptional regulator	NA	NA	NA	NA
AYE59718.1\|2332432_2333731_-	MFS transporter	NA	NA	NA	NA
AYE59719.1\|2336577_2336892_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	3.3e-08	36.0
AYE59720.1\|2339799_2340390_+	hypothetical protein	NA	NA	NA	NA
AYE59721.1\|2342473_2342857_+	hypothetical protein	NA	NA	NA	NA
AYE59722.1\|2342846_2344694_+	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	3.4e-20	23.3
AYE59723.1\|2344934_2345189_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AYE59724.1\|2345200_2345746_+	alkaline shock response membrane anchor protein AmaP	NA	NA	NA	NA
AYE59725.1\|2345758_2345941_+	hypothetical protein	NA	NA	NA	NA
AYE59726.1\|2345955_2346378_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
AYE59727.1\|2346438_2346879_+	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
AYE59728.1\|2346928_2347408_-	N-acetyltransferase	NA	NA	NA	NA
AYE59729.1\|2348484_2349495_+	DUF4767 domain-containing protein	NA	NA	NA	NA
AYE59730.1\|2349587_2350511_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.1e-32	31.9
AYE59731.1\|2350914_2351247_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AYE59732.1\|2353314_2354241_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	8.5e-20	31.4
AYE59733.1\|2354241_2356413_+	TIGR02687 family protein	NA	NA	NA	NA
AYE59734.1\|2356535_2359070_+	peptidase	A0A0P0IY26	Acinetobacter_phage	1.2e-68	27.3
AYE59735.1\|2360441_2360651_+	hypothetical protein	NA	NA	NA	NA
AYE59736.1\|2360647_2361196_+	hypothetical protein	A0A2I6AZV9	Macacine_betaherpesvirus	1.6e-29	39.8
AYE59737.1\|2361773_2362694_+\|transposase	IS30 family transposase	H7BW47	unidentified_phage	2.9e-28	37.4
AYE59738.1\|2363165_2363354_+	hypothetical protein	NA	NA	NA	NA
AYE59739.1\|2364040_2364571_-	histidine phosphatase family protein	NA	NA	NA	NA
AYE59740.1\|2364685_2368459_-	mucus-binding protein	NA	NA	NA	NA
AYE59741.1\|2368664_2368787_+	hypothetical protein	NA	NA	NA	NA
AYE59742.1\|2368830_2369457_-	hypothetical protein	A0A2I6AZV9	Macacine_betaherpesvirus	1.4e-37	44.7
AYE59743.1\|2369711_2370239_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2511430 : 2572894

Bacillus_phage(23.53%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYE59872.1\|2511430_2512354_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.3e-32	31.9
AYE59873.1\|2512454_2513882_+	amino acid permease	NA	NA	NA	NA
AYE59874.1\|2514002_2514584_+	ECF transporter S component	NA	NA	NA	NA
AYE59875.1\|2514676_2514853_-	hypothetical protein	NA	NA	NA	NA
AYE59876.1\|2518054_2519494_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AYE59877.1\|2519486_2520482_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AYE59878.1\|2520610_2522344_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	2.1e-19	22.5
AYE59879.1\|2522343_2524104_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.7e-24	24.3
AYE59880.1\|2524200_2524305_+	ribosome recycling factor	NA	NA	NA	NA
AYE59881.1\|2524309_2525287_-	hypothetical protein	NA	NA	NA	NA
AYE59882.1\|2525477_2526455_-	heptaprenyl diphosphate synthase	NA	NA	NA	NA
AYE59883.1\|2526599_2527514_+	1,4-dihydroxy-2-naphthoate octaprenyltransferase	NA	NA	NA	NA
AYE59884.1\|2527739_2528267_+\|transposase	transposase	NA	NA	NA	NA
AYE60367.1\|2528521_2529148_+	hypothetical protein	A0A2I6AZV9	Macacine_betaherpesvirus	1.4e-37	44.7
AYE59885.1\|2529220_2530195_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AYE59886.1\|2530641_2531283_+	cell wall hydrolase	S5M633	Brevibacillus_phage	6.7e-24	42.0
AYE59887.1\|2531333_2531921_+	xanthine phosphoribosyltransferase	NA	NA	NA	NA
AYE59888.1\|2531943_2532492_+	hypothetical protein	NA	NA	NA	NA
AYE59889.1\|2532604_2533774_+	phosphoribosylaminoimidazole carboxylase	NA	NA	NA	NA
AYE59890.1\|2534214_2536482_+	DNA helicase PcrA	A7KV33	Bacillus_phage	4.8e-133	42.7
AYE59891.1\|2536498_2538538_+	NAD-dependent DNA ligase LigA	A0A0A8J9A9	Ralstonia_phage	4.7e-95	33.3
AYE59892.1\|2538534_2539710_+	CamS family sex pheromone protein	NA	NA	NA	NA
AYE59893.1\|2539750_2540071_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit C	NA	NA	NA	NA
AYE59894.1\|2540070_2541534_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A	NA	NA	NA	NA
AYE59895.1\|2541533_2542958_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B	NA	NA	NA	NA
AYE59896.1\|2543062_2544085_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	2.6e-17	26.5
AYE59897.1\|2544418_2545792_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	5.5e-124	49.8
AYE59898.1\|2546247_2546823_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYE59899.1\|2547089_2549429_+	magnesium-transporting ATPase	M1HI01	Paramecium_bursaria_Chlorella_virus	1.6e-38	24.8
AYE59900.1\|2551993_2552872_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AYE59901.1\|2552896_2553673_+	lysozyme	A0A141HSE6	Bacillus_phage	2.6e-06	31.1
AYE59902.1\|2553828_2554194_-	DUF4828 domain-containing protein	NA	NA	NA	NA
AYE59903.1\|2554537_2554738_+	cold-shock protein	Q9AZD3	Lactococcus_phage	3.1e-20	71.4
AYE59904.1\|2554924_2555932_+	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AYE59905.1\|2555944_2557279_+	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-37	30.9
AYE59906.1\|2557561_2558002_-	universal stress protein	NA	NA	NA	NA
AYE59907.1\|2558135_2559443_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AYE59908.1\|2559435_2560302_+	acyltransferase	NA	NA	NA	NA
AYE59909.1\|2560451_2560652_-	hypothetical protein	NA	NA	NA	NA
AYE59910.1\|2560850_2561291_+	hypothetical protein	NA	NA	NA	NA
AYE59911.1\|2561724_2562288_+	hypothetical protein	NA	NA	NA	NA
AYE59912.1\|2562370_2563207_-\|transposase	transposase	U5P429	Shigella_phage	2.2e-19	28.5
AYE59913.1\|2563254_2563962_-\|transposase	transposase	NA	NA	NA	NA
AYE59914.1\|2564077_2565424_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
AYE59915.1\|2565691_2566867_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
AYE59916.1\|2567055_2568174_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	7.1e-21	31.3
AYE59917.1\|2568551_2569481_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
AYE59918.1\|2569670_2570387_+	aquaporin family protein	A0A1J0F964	Only_Syngen_Nebraska_virus	2.5e-19	33.1
AYE59919.1\|2570455_2571604_-\|transposase	ISL3 family transposase	NA	NA	NA	NA
AYE59920.1\|2571964_2572894_-\|transposase	IS30 family transposase	H7BW61	unidentified_phage	6.5e-20	29.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP023491

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP023494

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP023490

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection