CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP026982	Pectobacterium parmentieri strain IFB5486 chromosome, complete genome	8 crisprs	csa3,cas1,cas3f,cas8f,cas5f,cas7f,cas6f,DinG,cas3,DEDDh,WYL,cas2,cas6e,cas5,cas7,cse2gr11,cas8e	0	82	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026982_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_1

455919-456032

Orphan

Consensus_repeat	Method
AAAAAACGTAGGGAACGTTTTTCAACGTCGCTTGCGACGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026982_1

>merge|CP026982|1|455919-456032|CRISPRCasFinder
AAAAAACGTAGGGAACGTTTTTCAACGTCGCTTGCGACGGCCCGCAGGGGGGCGGCCAGGGATGGCACGCCATAAAAAACGTAGGGAACGTTTTTCAACGTCGCTTGCGACGGC

>CP026982|1|1|455919-456032|CRISPRCasFinder
AAAAAACGTAGGGAACGTTTTTCAACGTCGCTTGCGACGGC	CCGCAGGGGGGCGGCCAGGGATGGCACGCCAT
AAAAAACGTAGGGAACGTTTTTCAACGTCGCTTGCGACGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH17342.1\|453005_453329_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225495
CP026982.1\|AYH17345.1\|454665_455892_+\|bifunctional-succinylornithine-transaminase/acetylornithine-transaminase	unknown	unknown	gnl\|CDD\|179933
CP026982.1\|AYH17343.1\|453427_453610_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366690
CP026982.1\|AYH17336.1\|444415_444985_+\|peptidylprolyl-isomerase-A	unknown	unknown	gnl\|CDD\|182824
CP026982.1\|AYH17352.1\|462777_463332_+\|glutathione-regulated-potassium-efflux-system-ancillary-protein-KefG	unknown	unknown	gnl\|CDD\|179895
CP026982.1\|AYH17350.1\|460072_460675_+\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
CP026982.1\|AYH17349.1\|458928_459966_-\|hydrolase	unknown	unknown	gnl\|CDD\|182883
CP026982.1\|AYH17338.1\|446509_447634_-\|pectate-lyase	unknown	unknown	gnl\|CDD\|366158
CP026982.1\|AYH17344.1\|453970_454546_+\|aminodeoxychorismate-synthase-component-II	unknown	unknown	gnl\|CDD\|180689
CP026982.1\|AYH17346.1\|456122_456755_-\|cAMP-activated-global-transcriptional-regulator-CRP	unknown	unknown	gnl\|CDD\|236969
CP026982.1\|AYH17347.1\|457129_457537_+\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|182688
CP026982.1\|AYH17348.1\|458695_458932_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|179903
CP026982.1\|AYH17354.1\|465198_465405_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|226060
CP026982.1\|AYH21220.1\|457703_458573_-\|phosphoribulokinase	unknown	unknown	gnl\|CDD\|237970
CP026982.1\|AYH17341.1\|452224_452842_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|273358
CP026982.1\|AYH17340.1\|450014_451139_-\|pectate-lyase	unknown	unknown	gnl\|CDD\|366158
CP026982.1\|AYH17351.1\|460747_462655_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|236729
CP026982.1\|AYH17353.1\|463333_465145_+\|glutathione-regulated-potassium-efflux-system-protein-KefB	unknown	unknown	gnl\|CDD\|179625
CP026982.1\|AYH17339.1\|448341_449466_-\|pectate-lyase	unknown	unknown	gnl\|CDD\|366158
CP026982.1\|AYH17337.1\|445069_446347_-\|pectate-lyase	unknown	unknown	gnl\|CDD\|226384

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH17342.1\|453005_453329_-\|transcriptional-regulator	gnl\|CDD\|225495	COG2944, COG2944, Predicted transcriptional regulator [Transcription].	2.99402e-43
CP026982.1\|AYH17345.1\|454665_455892_+\|bifunctional-succinylornithine-transaminase/acetylornithine-transaminase	gnl\|CDD\|179933	PRK05093, argD, acetylornithine/succinyldiaminopimelate transaminase.	0
CP026982.1\|AYH17343.1\|453427_453610_-\|hypothetical-protein	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	4.02136e-10
CP026982.1\|AYH17336.1\|444415_444985_+\|peptidylprolyl-isomerase-A	gnl\|CDD\|182824	PRK10903, PRK10903, peptidylprolyl isomerase A.	2.63337e-129
CP026982.1\|AYH17352.1\|462777_463332_+\|glutathione-regulated-potassium-efflux-system-ancillary-protein-KefG	gnl\|CDD\|179895	PRK04930, PRK04930, glutathione-regulated potassium-efflux system ancillary protein KefG; Provisional.	1.37495e-141
CP026982.1\|AYH17350.1\|460072_460675_+\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	9.06492e-31
CP026982.1\|AYH17349.1\|458928_459966_-\|hydrolase	gnl\|CDD\|182883	PRK10985, PRK10985, putative hydrolase; Provisional.	0
CP026982.1\|AYH17338.1\|446509_447634_-\|pectate-lyase	gnl\|CDD\|366158	pfam00544, Pec_lyase_C, Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.	3.18407e-94
CP026982.1\|AYH17344.1\|453970_454546_+\|aminodeoxychorismate-synthase-component-II	gnl\|CDD\|180689	PRK06774, PRK06774, aminodeoxychorismate synthase component II.	2.24148e-140
CP026982.1\|AYH17346.1\|456122_456755_-\|cAMP-activated-global-transcriptional-regulator-CRP	gnl\|CDD\|236969	PRK11753, PRK11753, cAMP-activated global transcriptional regulator CRP.	6.42084e-163
CP026982.1\|AYH17347.1\|457129_457537_+\|OsmC-family-protein	gnl\|CDD\|182688	PRK10738, PRK10738, OsmC family protein.	2.82934e-97
CP026982.1\|AYH17348.1\|458695_458932_-\|hypothetical-protein	gnl\|CDD\|179903	PRK04966, PRK04966, hypothetical protein; Provisional.	2.00719e-45
CP026982.1\|AYH17354.1\|465198_465405_+\|DNA-binding-protein	gnl\|CDD\|226060	COG3529, COG3529, Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only].	1.53095e-21
CP026982.1\|AYH21220.1\|457703_458573_-\|phosphoribulokinase	gnl\|CDD\|237970	PRK15453, PRK15453, phosphoribulokinase; Provisional.	0
CP026982.1\|AYH17341.1\|452224_452842_-\|LysE-family-translocator	gnl\|CDD\|273358	TIGR00949, Uncharacterized_membrane_protein_YahN, The Resistance to Homoserine/Threonine (RhtB) Family protein. [Transport and binding proteins, Amino acids, peptides and amines].	6.55002e-29
CP026982.1\|AYH17340.1\|450014_451139_-\|pectate-lyase	gnl\|CDD\|366158	pfam00544, Pec_lyase_C, Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.	1.78531e-102
CP026982.1\|AYH17351.1\|460747_462655_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|236729	PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional.	0
CP026982.1\|AYH17353.1\|463333_465145_+\|glutathione-regulated-potassium-efflux-system-protein-KefB	gnl\|CDD\|179625	PRK03659, PRK03659, glutathione-regulated potassium-efflux system protein KefB; Provisional.	0
CP026982.1\|AYH17339.1\|448341_449466_-\|pectate-lyase	gnl\|CDD\|366158	pfam00544, Pec_lyase_C, Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.	5.13919e-97
CP026982.1\|AYH17337.1\|445069_446347_-\|pectate-lyase	gnl\|CDD\|226384	COG3866, PelB, Pectate lyase [Carbohydrate transport and metabolism].	3.35168e-06

>CP026982.1|AYH17345.1|454665_455892_+|bifunctional-succinylornithine-transaminase/acetylornithine-transaminase
MAAEQKAVTRDTHDKVILPVYAPAKFVPVKGKGSRVWDQDGREYIDFSGGIAVTALGHCHPALVNALQQQGEKLWHTSNIFTNEPALRLASKLIDATFADRVFFVNSGAEANEAAFKLARHYAVKRHSPYKTKIIAFYNAFHGRTLFTVSVGGQPKYADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFLQGVRELCDQHKALLVFDEVQSGMGRTGKLFSYMHYGITPDILTTAKALGGGFPISAMLTTEEIASAMTVGVHGTTYGGNPLACAVAEAALDIINTPEVLSGVADRHDRFVSELEKINQQYGVFDQVRGMGLLLGAELKPQWYGRAGEFLAAATAQGLMVLMAGPNVIRFVPSLIIDEDDIAQGMAKFANAVAQVVNAGN
>CP026982.1|AYH17344.1|453970_454546_+|aminodeoxychorismate-synthase-component-II
MLLIIDNYDSFTYNLYQYFCELGAQVVVKRNDELTLHEIERLAPERLVISPGPCTPDEAGISLAAIRHFADKLPILGVCLGHQAMGQAFGARVVRARQVMHGKTSTIAHSNTGVFAGLAQPLTVTRYHSLIIDAASLPDCFEITAWSEHEGKRDEIMGIRHRSLPLEGVQFHPESILSQQGHQLLDNFLKI
>CP026982.1|AYH17343.1|453427_453610_-|hypothetical-protein
MTRQQYTPEFKRRAVALLLESGKSVARMAQGLDIKENTPYNWKKLYQDIDALEMANIDIS
>CP026982.1|AYH17342.1|453005_453329_-|transcriptional-regulator
MTAQSKFKNPAFEAIHSAASGLFSVDAIPQETMRNFDKACLNSVDDLHHLEIKALREKLNVSQPVFARYLNTRVSTVQKWESGVKRPSGLSLKLLTVVQKHGLKVLV
>CP026982.1|AYH17341.1|452224_452842_-|LysE-family-translocator
MTIDFIALSAIGVAITIGAMSPGVSFLLVARTAMSSSRRAALFVAAGMGFGALVFAAIALAGLHTLLTLVPSLYTALKVVGGCYLLWLALKMFRRPSNRFNDPAVSGNISASKAFLTGVFTQISNPHTALVFASIFSAALSKDIQPVMYIILPMMAFVIDVLWYAVVACLLSTEGPRQAYIKYRKFLDRLSGAVMAFLGIRLLLK
>CP026982.1|AYH17340.1|450014_451139_-|pectate-lyase
MKYLLPSAAAGLLLLAAQPTMAANTGGYATTDGGDVSGAVKKTARSLQEIINLIEEAQLDSKGKKVKGGAYPLVITYNGNEDALIKAAEANICGQWSKDPRGVEIKEFTKGLTILGTNGSSANFGIWLVNSSNVVVRNMRFGYMPGGAKDGDAVRIDNSPNVWIDHNEIFAKNFECAGTPDNDTTFESAVDIKKGSTNVTVSYNYIHGVKKVGLSGSSNTDTGRNLTYHHNIYSDVNSRLPLQRGGQVHAYNNLYDGIKSSGFNVRQKGIALIESNWFENALNPVTARNDDSNFGTWELRNNNITSPSDFAKYKITWGKPSTPHINADDWKSTGKFPAVPYSYSPVSAQCVKDKLANYAGVGKNQAVLTAANCK
>CP026982.1|AYH17339.1|448341_449466_-|pectate-lyase
MKYLLPTAAAGLLLLAAQPAMAANTGGYATTDGGDVSGSVKKTARSLQEIVDIIEAAKVDSKGKKVKGGAYPLIITYNGNEDSLIKAAEKNICGQWSKDARGVQIKEFTKGITIQGTNGSSANFGVWIVNSSNVVVRNMRFGYMPGGAQDGDAIRVDNSPNVWIDHNEIFAKNFECKGTPDNDTTFESAVDIKKGSTNVTVSYNYIHGIKKVGLSGASNTDTGRNLTYHHNIYRDVNSRLPLQRGGLVHAYNNLYDGITGSGFNVRQKGIALIESNWFENALNPVTARNDSSNFGTWELRNNNITKPADFSKYNITWGRPSTPHVNADDWKSTGKFPSISYKYTPVSAQCVKDKLANYAGVGKNLAVLTAANCK
>CP026982.1|AYH17338.1|446509_447634_-|pectate-lyase
MKYLLPSAAAGLLLLAAQPTMAANTGGYATTDGGNVAGAVNKTARSMQDIIDIIEAAKLDAKGKKVKGGAYPLVITYNGNEDALIKAAENDICGQWSKDARGVEIKEFTKGITIIGTNGSSANFGIWLTKSSDIVIRNMRFGYMPGGAQDGDAIRIDNTPNVWIDHNEIFAKNFECKGTKDGDTTFESAIDIKKASTNVTVSYNYIHGIKKVGLSGFSSSDTGRDLTYHHNIYDDVNARLPLQRGGQVHAYNNLYTNITSSGLNVRQKGIALIERNWFENAKNPVTSRYDGSNFGTWELRNNNVMSPADFAKYNITWDKDTKPYVNAEDWKSTGTFASVPYSYSPVSAQCVKDKLANYAGVNKNLAVLTAANCN
>CP026982.1|AYH17337.1|445069_446347_-|pectate-lyase
MKRTLLFAALFSTSLTFSVGIPMASAATPAAPELKGFGTDTVAGSGGRIIRVTTLASSGAGSLREALAAKGPRIIVFEVGGIIDLNKSDLRLTEPFVTIAGQTAPSPGITIIRGGMGISTHDVLMQHIRFRIGDAGTGKKSGFERDVSINGANAYNVVIDHSSFAWGTDENLSISGPRYDGPQNTAHRITLSNNIVAEGLYDSAHTKGIHSMGTLVHDNVTDVTIVGSLYAHNNERNAWFKAGSTGVMVNNLIYNPGIWGLRVGGVKGEWEGKTMPASPRVSVAGNVMHYGVNTKAGLGLVGSNSSGDVWMSDNLAYDANGKTAPQTSGSGITLLKVSPIWPAGLTASPASSVTNQVLQSAGARPKDRDAVDKRIVDNVKQRKGSFVNSQEDVGGYPVATATYRKLSVPSTGVDAWLQQMAKALE
>CP026982.1|AYH17336.1|444415_444985_+|peptidylprolyl-isomerase-A
MFKRTLVAAAALISLAAFSPAFAASGTTHVLLTTSAGNIELSLDNQKAPVSVKNFVEYVNNGFYNGTTFHRVIPGFMVQGGGFSGEMSQKATNAPIKNEADNGLRNQRGTIAMARTADKDSATSQFFINIADNAFLDHGQRDFGYAVFGKVVKGMEVVDKISQVPTKNVGPYQNVPTTPIVIQSAKVLP
>CP026982.1|AYH17346.1|456122_456755_-|cAMP-activated-global-transcriptional-regulator-CRP
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMANRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
>CP026982.1|AYH17347.1|457129_457537_+|OsmC-family-protein
MQARVKWVEGLTFLGESASGHQILMDGNSGDKAPSPMEMVLMSVGGCSAIDVVSILQKGRNDVADCEVKLTSERRSEAPRLFTHINLHFIVTGKGLTDNVVERAVALSAEKYCSVALMLGKAVEVTHSHEIRALA
>CP026982.1|AYH21220.1|457703_458573_-|phosphoribulokinase
MSHQHPIIAVTGSSGAGTTTTSLAFRKIFQQFDLRAAQLEGDSFHRYTRPEMDMAIRKARDLGRHISYFGPEANDFSLLEQSFIEYGLHGHGQTRKYLHTYDEAIPYNQVPGTFTPWEPMPEPTDILFYEGLHGGVVTDQNDVAQHVDLLVGVVPIVNLEWIQKLIRDVNERGHSREAVMDSVVRSMEDYITYITPQFSRTHINFQRVPTVDTSNPFAAKSIPSLDESFVVIHFQGLDNIDYPYLLAMLQGAFISHINTLVVPGGKMGLAMELIMAPLVQRLIEGKAIE
>CP026982.1|AYH17348.1|458695_458932_-|hypothetical-protein
MIIPWQQLDPETLDNIIESFVLREGTDYGEQERSLAQKVEDIRSQLQSGDVVLVWSELHETLNIMPRGQLNAGGHAPY
>CP026982.1|AYH17349.1|458928_459966_-|hydrolase
MHDHFRPLSGAHNPHLQTLLPRLIRRHAQFLPVWQALELPDGDFVDLAWSEAPEQARHKPRVVLFHGLEGSFHSPYAHGLLHACKQRGWLAVIMHFRGCSGKPNRMKRIYHSGETSDAGYFLHWMQETLGEAPTAAIGVSLGGNMLAYLLGQQGEACSLSAAVIVSAPLMLEPCSRRMEQGFSRIYQHYLLRLLKQNAGRKLAAYPDTLPIQLPQLKKIRQLREFDDVITSRIHGFHDAADYYRRCSALPLLPQIRKPLLIIHAKDDPFMTPEVIPDLSQLPSNIEYQLTEHGGHVGFVSGTLLKPEMWLEQRIPNWLSPFLDYATDSSLGTLLTQEPFYSGNIA
>CP026982.1|AYH17350.1|460072_460675_+|LysE-family-translocator
MELSLFLSMLGFLWVAAITPGPNNMLLTTSGANFGFMRSLWLMVGIMLGMQSILLLVAFGVGGLILIYPSLHFVLKVLGSAYLLWLAWKIATAAYERLETSVAPPQPIRLYQGWLLQFLNPKAWLMALGAVASFSLAGEGYNHSVIAISIGIVLVNLVSGVIWLGFGTMIGRLLRSKKAWIIFNVSMGLLTAACVLLIWH
>CP026982.1|AYH17351.1|460747_462655_-|ABC-transporter-ATP-binding-protein
MIVFSSLQIRRGVRVLIDNATATVNPGQKVGLVGKNGCGKSTLLSLLKGEISADGGSATFPQNWSLAWVNQETPALDKPALDYVIDGDREFRQLEAALQTANEENDGNAIATLHGKLDAIQAWTIQARASSLLSGLGFSQPQLQQPVSAFSGGWRMRLNLAQALICRSDLLLLDEPTNHLDLDAVIWLEKWLKNYAGTLVLISHDRDFLDPVVTKILHIEQQSLNEYTGNYSSFERQRATRLAQQQSLYEHQQERVAHLQHYIDRFRAQATKAKQAQSRIKMLERMEMIAPAHVDNPFRFSFRAPESLPNPLMKMEKVSAGYNDKLILESIKLNLVPGSRIGLLGHNGAGKSTLIKLLAGTLAPLKGEIGLAKGVKLGYFAQHQLEFLRADESPLQHLVRLAERETEQQLRDYLGGFGFQGDKVTEITERFSGGEKARLVLALIVWQRPNLLLLDEPTNHLDLDMRQALTEALIDFEGALVVVSHDRHLIRSTTDDLYLVHDQKVEPFDGDLEDYQQWLVGLQRQENAADETPKENAANSAQGRKDQKRREAELRTQTQPLRKQITKLEQQMEKLGEALATLEAKLADSAIYDISRKAELTDCLQQQTKVKIDLEETELSWLDAQEQLEQMMQSE
>CP026982.1|AYH17352.1|462777_463332_+|glutathione-regulated-potassium-efflux-system-ancillary-protein-KefG
MMSQPPKILLLYAHPEPQDSVANRVLLQPAQQLANVTVHDLYAHYPDFFIDIHHEQQLLREHQIIVFQHPFYTYSCPALLKEWLDRVLSRGFANGIGGNALAGKYWRSVITTGEPEDAYHADGNNRYPMEDLLRPFELTAAMCRMHWMRPMIVYWARRLQPDVLSSQARAYGEWLSSPLSEEER
>CP026982.1|AYH17353.1|463333_465145_+|glutathione-regulated-potassium-efflux-system-protein-KefB
MESSALLTAGVLFLFVAVVAVPIAARLGIGAVLGYLIAGIAIGPWGLGFIRDVDAILHFSELGVVFLMFIIGLELNPAKLWTLRRSIFGVGAAQVGLSALILGGALYLTDFSWQSALIGGVGLAMSSTAMALQLMREKGMNRSESGQLGFSVLLFQDLAVIPALALIPILAGVQGDFGDWERIGLKVAAFLGMLIGGRYLVRPLFRFIAASGVREVFTAAALLLVLGSALFMEALGLSMALGTFIAGILLAESEYRHELEIAIEPFKGLLLGLFFISVGMALNLGILYTHIVKIMVAVLVLVAVKAAVLYFLARINRMRRSERLQFAGVLSQGGEFAFVLFSAAASFNVLKGEQLPLLLVTVTLSMMTTPLLMQVIDRILARRYNVQDVPDEKPYVEDDEPQVIVVGFGRFGQVISRLLMANKMRITVLERDISAVSLMRSYGYKVYYGDATELELLRSAGADKARSIVITCNAPEDTMEIVHLCQQHFPNLEILARARGRVEAHELLQTGVKHFSRETFSSALELGRKTLVTLGMHPHQAMRAQQHFRRLDMRMLRELMPQLTGDVAQISRVKEARRELEDIFQREMLRERRRPSVWDEDDE
>CP026982.1|AYH17354.1|465198_465405_+|DNA-binding-protein
MGASMRKRFIAGAVCPTCQAQDTLAVGREDDVEVVVCVKCGYRQSRADEPMTAPAPQASDIIGIFRPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_2

883730-885323

TypeI-F

I-F

Consensus_repeat	Method
TTTCTAAGCTGCCTATACGGCAGTGAAC	CRISPRCasFinder
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CRT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	PILER-CR

26 spacers

cas1,cas3f,cas8f,cas5f,cas7f,cas6f

The CRISPR arrays of CP026982_2

>merge|CP026982|2|883730-885323|CRISPRCasFinder,CRT,PILER-CR
ACACTGAACTGCCTGCACGGCAGTGAACGCTGAATATCGTTTTCCTGTTCACTGTGATCTTTTCTAAGCTGCCTGTACGGCAGTGAACATATTGTACTGAAACGTGATTGGCTCCATTCTTTTCTAAGCTGCCTGTACGGCAGTGGACTCACGCTGTACGGAAAACTGGCAGAGGTGGCTTTTCTAAGCTGCCTGTACGGCAGTGAACTGATTGCCCAATACCAAACGCTGGAATTTAACTTTCTAAGCTGCCTGTACGGCAGTGAACGCCGAGTTTCACGACAGCCACATTCGGTGCACTTTCTAAGCTGCCTATACGGCAGTGAACGCAATTAGCGACCCGTAAAACCCGCCCTCCACTTTCTAAGCTGCCTATACGGCAGTGAACTCAGAAATTCCATCCACTTATCGTTAATCAGCTTTCTAAGCTGCCTATACGGCAGTGAACACGAAAGCGGCGCAACGTCAGTATCGGGCGGCGTTTCTAAGCTGCCTATACGGCAGTGAACGTGAATGCGCCATCGGAATAAATATTGATAACTTTCTAAGCTGCCTGTACGGCAGTGAACATAGCGCACCATAACATTGTTAGCGCTTACATTTTCTAAGCTGCCTGTACGGCAGTGAACACATGAAATTCACGGATAGTGATTATATAATGATTTCTAAGCTGCCTGTACGGCAGTGAACATCATGCACATCATGGATGAATTGGAATTGTGTTTCTAAGCTGCCTGTACGGCAGTGAACACGGAGGCGACCGTGACAGCGACCATTACCCATTTCTAAGCTGCCTGTACGGCAGTGAACGAGCTGCGCAAGAAAAATTGCCTCGTCATCATTTTCTAAGCTGCCTGTACGGCAGTGAACGGGGCGATGGTTGCTACAGTGATACTACTGTAGTTTCTAAGCTGCCTGTACGGCAGTGAACTTTATGGATGCGCGGGCGTTAGATTTTGCTATTTTCTAAGCTGCCTGTACGGCAGTGAACCGAAAGGCACGTAAACAGATTGCCCGACTTTATTTCTAAGCTGCCTGTACGGCAGTGAACTAACCTCAACAAAGAATAAGCCCCTATTATCTATTTCTAAGCTGCCTGTACGGCAGTGAACTTGCCCTGCACAGCTTCAATGATGCGTATGAATTTCTAAGCTGCCTGTACGGCAGTGAACACGAGTTTCTGCCGCTTGCCCTGCTTTCTGCTTTTCTAAGCTGCCTGTACGGCAGTGAACCCAAGATATCTAAAAGGCTAGAATCTTCCTCTATTTCTAAGCTGCCTGTACGGCAGTGAACACACGCAGGGCATAGTCAAGCACGTTGAATGATTTCTAAGCTGCCTGTACGGCAGTGAACGCTAACGCTAAATTGTTCCACCAGCTAAACGCTTTCTAAGCTGCCTGTACGGCAGTGAACCCTGCGAAACCTGAAAGCGGATAATTTGCAGTGTTTCTAAGCTGCCTGTACGGCAGTGAACAGGAGCTTTTAGGGGTATGTATGTTTATACAGTTTCTAAGCTGCCTGTACGGCAGTGAACTTCGATAGCGGAGTACACCGCCGCGTTTAGCTTTTCTAAGCTGCCTGTACGGCAGTGAAC

>CP026982|2|2|883730-885323|CRISPRCasFinder
ACACTGAACTGCCTGCACGGCAGTGAAC	GCTGAATATCGTTTTCCTGTTCACTGTGATCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATATTGTACTGAAACGTGATTGGCTCCATTCT
TTTCTAAGCTGCCTGTACGGCAGTGGAC	TCACGCTGTACGGAAAACTGGCAGAGGTGGCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TGATTGCCCAATACCAAACGCTGGAATTTAAC
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GCCGAGTTTCACGACAGCCACATTCGGTGCAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCAATTAGCGACCCGTAAAACCCGCCCTCCAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGAAATTCCATCCACTTATCGTTAATCAGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACGAAAGCGGCGCAACGTCAGTATCGGGCGGCG
TTTCTAAGCTGCCTATACGGCAGTGAAC	GTGAATGCGCCATCGGAATAAATATTGATAAC
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATAGCGCACCATAACATTGTTAGCGCTTACAT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACATGAAATTCACGGATAGTGATTATATAATGA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATCATGCACATCATGGATGAATTGGAATTGTG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACGGAGGCGACCGTGACAGCGACCATTACCCA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GAGCTGCGCAAGAAAAATTGCCTCGTCATCAT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GGGGCGATGGTTGCTACAGTGATACTACTGTAG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TTTATGGATGCGCGGGCGTTAGATTTTGCTAT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CGAAAGGCACGTAAACAGATTGCCCGACTTTA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TAACCTCAACAAAGAATAAGCCCCTATTATCTA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TTGCCCTGCACAGCTTCAATGATGCGTATGAA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACGAGTTTCTGCCGCTTGCCCTGCTTTCTGCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CCAAGATATCTAAAAGGCTAGAATCTTCCTCTA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACACGCAGGGCATAGTCAAGCACGTTGAATGA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GCTAACGCTAAATTGTTCCACCAGCTAAACGC
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CCTGCGAAACCTGAAAGCGGATAATTTGCAGTG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	AGGAGCTTTTAGGGGTATGTATGTTTATACAG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TTCGATAGCGGAGTACACCGCCGCGTTTAGCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC

>CP026982|2|1|883730-885323|CRT
ACACTGAACTGCCTGCACGGCAGTGAAC	GCTGAATATCGTTTTCCTGTTCACTGTGATCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATATTGTACTGAAACGTGATTGGCTCCATTCT
TTTCTAAGCTGCCTGTACGGCAGTGGAC	TCACGCTGTACGGAAAACTGGCAGAGGTGGCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TGATTGCCCAATACCAAACGCTGGAATTTAAC
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GCCGAGTTTCACGACAGCCACATTCGGTGCAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCAATTAGCGACCCGTAAAACCCGCCCTCCAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGAAATTCCATCCACTTATCGTTAATCAGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACGAAAGCGGCGCAACGTCAGTATCGGGCGGCG
TTTCTAAGCTGCCTATACGGCAGTGAAC	GTGAATGCGCCATCGGAATAAATATTGATAAC
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATAGCGCACCATAACATTGTTAGCGCTTACAT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACATGAAATTCACGGATAGTGATTATATAATGA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATCATGCACATCATGGATGAATTGGAATTGTG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACGGAGGCGACCGTGACAGCGACCATTACCCA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GAGCTGCGCAAGAAAAATTGCCTCGTCATCAT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GGGGCGATGGTTGCTACAGTGATACTACTGTAG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TTTATGGATGCGCGGGCGTTAGATTTTGCTAT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CGAAAGGCACGTAAACAGATTGCCCGACTTTA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TAACCTCAACAAAGAATAAGCCCCTATTATCTA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TTGCCCTGCACAGCTTCAATGATGCGTATGAA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACGAGTTTCTGCCGCTTGCCCTGCTTTCTGCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CCAAGATATCTAAAAGGCTAGAATCTTCCTCTA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ACACGCAGGGCATAGTCAAGCACGTTGAATGA
TTTCTAAGCTGCCTGTACGGCAGTGAAC	GCTAACGCTAAATTGTTCCACCAGCTAAACGC
TTTCTAAGCTGCCTGTACGGCAGTGAAC	CCTGCGAAACCTGAAAGCGGATAATTTGCAGTG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	AGGAGCTTTTAGGGGTATGTATGTTTATACAG
TTTCTAAGCTGCCTGTACGGCAGTGAAC	TTCGATAGCGGAGTACACCGCCGCGTTTAGCT
TTTCTAAGCTGCCTGTACGGCAGTGAAC

>CP026982|2|1|883790-885323|PILER-CR
TTTCTAAGCTGCCTGTACGGCAGTGAAC	ATATTGTACTGAAACGTGATTGGCTCCATTCT
TTTCTAAGCTGCCTGTACGGCAGTGGAC	TCACGCTGTACGGAAAACTGGCAGAGGTGGCTTTT
CTAAGCTGCCTGTACGGCAGTGAACTGA	TTGCCCAATACCAAACGCTGGAATTTAACTTT
CTAAGCTGCCTGTACGGCAGTGAACGCC	GAGTTTCACGACAGCCACATTCGGTGCACTTT
CTAAGCTGCCTATACGGCAGTGAACGCA	ATTAGCGACCCGTAAAACCCGCCCTCCACTTT
CTAAGCTGCCTATACGGCAGTGAACTCA	GAAATTCCATCCACTTATCGTTAATCAGCTTT
CTAAGCTGCCTATACGGCAGTGAACACG	AAAGCGGCGCAACGTCAGTATCGGGCGGCGTTT
CTAAGCTGCCTATACGGCAGTGAACGTG	AATGCGCCATCGGAATAAATATTGATAACTTT
CTAAGCTGCCTGTACGGCAGTGAACATA	GCGCACCATAACATTGTTAGCGCTTACATTTT
CTAAGCTGCCTGTACGGCAGTGAACACA	TGAAATTCACGGATAGTGATTATATAATGATTT
CTAAGCTGCCTGTACGGCAGTGAACATC	ATGCACATCATGGATGAATTGGAATTGTGTTT
CTAAGCTGCCTGTACGGCAGTGAACACG	GAGGCGACCGTGACAGCGACCATTACCCATTT
CTAAGCTGCCTGTACGGCAGTGAACGAG	CTGCGCAAGAAAAATTGCCTCGTCATCATTTT
CTAAGCTGCCTGTACGGCAGTGAACGGG	GCGATGGTTGCTACAGTGATACTACTGTAGTTT
CTAAGCTGCCTGTACGGCAGTGAACTTT	ATGGATGCGCGGGCGTTAGATTTTGCTATTTT
CTAAGCTGCCTGTACGGCAGTGAACCGA	AAGGCACGTAAACAGATTGCCCGACTTTATTT
CTAAGCTGCCTGTACGGCAGTGAACTAA	CCTCAACAAAGAATAAGCCCCTATTATCTATTT
CTAAGCTGCCTGTACGGCAGTGAACTTG	CCCTGCACAGCTTCAATGATGCGTATGAATTT
CTAAGCTGCCTGTACGGCAGTGAACACG	AGTTTCTGCCGCTTGCCCTGCTTTCTGCTTTT
CTAAGCTGCCTGTACGGCAGTGAACCCA	AGATATCTAAAAGGCTAGAATCTTCCTCTATTT
CTAAGCTGCCTGTACGGCAGTGAACACA	CGCAGGGCATAGTCAAGCACGTTGAATGATTT
CTAAGCTGCCTGTACGGCAGTGAACGCT	AACGCTAAATTGTTCCACCAGCTAAACGCTTT
CTAAGCTGCCTGTACGGCAGTGAACCCT	GCGAAACCTGAAAGCGGATAATTTGCAGTGTTT
CTAAGCTGCCTGTACGGCAGTGAACAGG	AGCTTTTAGGGGTATGTATGTTTATACAGTTT
CTAAGCTGCCTGTACGGCAGTGAACTTC	GATAGCGGAGTACACCGCCGCGTTTAGCTTTT
CTAAGCTGCCTGTACGGCAGTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH17701.1\|891652_892585_+\|type-I-F-CRISPR-associated-protein-Csy2	cas5f	cd09676_cas5f_CAS-I-F	gnl\|CDD\|378221
CP026982.1\|AYH17691.1\|875653_876085_+\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
CP026982.1\|AYH17706.1\|895862_896291_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17702.1\|892598_893612_+\|type-I-F-CRISPR-associated-protein-Csy3	cas7f	pfam09615_cas7f_CAS-I-F	gnl\|CDD\|378222
CP026982.1\|AYH17694.1\|879625_880168_-\|single-stranded-DNA-binding-protein-SSB1	unknown	unknown	gnl\|CDD\|236362
CP026982.1\|AYH17696.1\|883269_883689_+\|YjbQ-family-protein	unknown	unknown	gnl\|CDD\|376651
CP026982.1\|AYH17704.1\|894580_895441_+\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH17692.1\|876196_876787_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH17698.1\|886597_889894_+\|type-I-F-CRISPR-associated-helicase-Cas3	cas3f	cd09673_cas3f_CAS-I-F	gnl\|CDD\|274201
CP026982.1\|AYH17693.1\|877541_879383_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|224490
CP026982.1\|AYH17700.1\|890321_891656_+\|type-I-F-CRISPR-associated-protein-Csy1	cas8f	cd09675_cas8f_CAS-I-F	gnl\|CDD\|187866
CP026982.1\|AYH17703.1\|893621_894176_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	cas6f	cd09739_cas6f_CAS-I-F:CAS-IV	gnl\|CDD\|378224
CP026982.1\|AYH17705.1\|895433_895838_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17699.1\|890044_890281_+\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH17695.1\|880417_883252_+\|excinuclease-ABC-subunit-UvrA	unknown	unknown	gnl\|CDD\|234734
CP026982.1\|AYH21236.1\|876854_877313_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP026982.1\|AYH17697.1\|885620_886601_+\|type-I-F-CRISPR-associated-endonuclease-Cas1	cas1	cd09718_cas1_CAS-I-F	gnl\|CDD\|132676
CP026982.1\|AYH17688.1\|872480_873530_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
CP026982.1\|AYH17690.1\|875081_875513_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP026982.1\|AYH17689.1\|873571_874990_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH17701.1\|891652_892585_+\|type-I-F-CRISPR-associated-protein-Csy2	gnl\|CDD\|378221	pfam09614, Cas_Csy2, CRISPR-associated protein (Cas_Csy2). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This entry, typified by YPO2464 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy2, for CRISPR/Cas Subtype Ypest protein 2.	1.14579e-152
CP026982.1\|AYH17691.1\|875653_876085_+\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	1.60846e-29
CP026982.1\|AYH17706.1\|895862_896291_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	4.01506e-41
CP026982.1\|AYH17702.1\|892598_893612_+\|type-I-F-CRISPR-associated-protein-Csy3	gnl\|CDD\|378222	pfam09615, Cas_Csy3, CRISPR-associated protein (Cas_Csy3). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This entry, typified by YPO2463 of Yersinia pestis, is a CRISPR-associated (Cas) entry strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy3, for CRISPR/Cas Subtype Ypest protein 3.	0
CP026982.1\|AYH17694.1\|879625_880168_-\|single-stranded-DNA-binding-protein-SSB1	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	1.20048e-109
CP026982.1\|AYH17696.1\|883269_883689_+\|YjbQ-family-protein	gnl\|CDD\|376651	pfam01894, UPF0047, Uncharacterized protein family UPF0047. This family has no known function. The alignment contains a conserved aspartate and histidine that may be functionally important.	1.9323e-59
CP026982.1\|AYH17705.1\|895433_895838_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	1.0748e-37
CP026982.1\|AYH17698.1\|886597_889894_+\|type-I-F-CRISPR-associated-helicase-Cas3	gnl\|CDD\|274201	TIGR02562, conserved_hypothetical_protein, CRISPR-associated helicase Cas3, subtype I-F/YPEST. The helicase in many CRISPR-associated (cas) gene clusters is designated Cas3, and most Cas3 proteins are described by model TIGR01587. Members of this family are considerably larger, show a number of motifs in common with TIGR01587 sequences, and replace Cas3 in some CRISPR/cas loci in a number of Proteobacteria, including Yersinia pestis, Chromobacterium violaceum, Erwinia carotovora subsp. atroseptica SCRI1043, Photorhabdus luminescens subsp. laumondii TTO1, Legionella pneumophila, etc.	0
CP026982.1\|AYH17693.1\|877541_879383_-\|amidohydrolase	gnl\|CDD\|224490	COG1574, COG1574, Predicted metal-dependent hydrolase with the TIM-barrel fold [General function prediction only].	4.67916e-141
CP026982.1\|AYH17700.1\|890321_891656_+\|type-I-F-CRISPR-associated-protein-Csy1	gnl\|CDD\|187866	cd09735, Csy1_I-F, CRISPR/Cas system-associated protein Csy1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins; Predicted subunit of the Cascade complex; signature gene for I-F subtype; also known as Csy1 family.	0
CP026982.1\|AYH17703.1\|893621_894176_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	gnl\|CDD\|378224	pfam09618, Cas_Csy4, CRISPR-associated protein (Cas_Csy4). CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) is a widespread family of prokaryotic direct repeats with spacers of unique sequence between consecutive repeats. This protein family, typified by YPO2462 of Yersinia pestis, is a CRISPR-associated (Cas) family strictly associated with the Ypest subtype of CRISPR/Cas locus. It is designated Csy4, for CRISPR/Cas Subtype Ypest protein 4.	7.75946e-99
CP026982.1\|AYH17695.1\|880417_883252_+\|excinuclease-ABC-subunit-UvrA	gnl\|CDD\|234734	PRK00349, uvrA, excinuclease ABC subunit UvrA.	0
CP026982.1\|AYH21236.1\|876854_877313_-\|N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.42658e-15
CP026982.1\|AYH17697.1\|885620_886601_+\|type-I-F-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|132676	TIGR03637, cas1_YPEST, CRISPR-associated endonuclease Cas1, subtype I-F/YPEST. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the YPEST subtype of CRISPR/Cas system.	0
CP026982.1\|AYH17688.1\|872480_873530_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	3.34402e-79
CP026982.1\|AYH17690.1\|875081_875513_+\|N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.53034e-11
CP026982.1\|AYH17689.1\|873571_874990_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	9.99854e-138

>CP026982.1|AYH17696.1|883269_883689_+|YjbQ-family-protein
MWAQYEIRLKPKARGFHLVTDEILAQVTALRQIKAGLMHVFIKHTSAALTINENADPTVRQDFESFFNRLVPEDEPYYRHIYEGSDDMPAHLKGSLLGNSLTLPITDGCLNIGTWQGIYLCEHRNHGGSRSLVVTLNGE
>CP026982.1|AYH17695.1|880417_883252_+|excinuclease-ABC-subunit-UvrA
MDKIEVRGARTHNLKNINLIIPRDKLIVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEIHDYLRLLFARVGEPRCPEHDVPLDAQTVSQMVDNVLAQPEGKRLMLLAPIVKDRKGEHSKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVVDRFKVREDLAQRLAESFETALDLSGGSVVVADMDDPTQPELLFSANFACPVCGYSMHELEPRMFSFNNPAGACPSCDGLGVQQFFDPVRVVQNAELSLAGGAIRGWDRRNFYYFQMLRSLAEHYKFDVDAPFEDQTAAVQKVILYGSGKENVEFKYINDRGDTSVRRHPFEGVLHNMERRYKETESTAVREELAKFISNRSCASCGGTRLREEARNVFVEQTTLPQISDMSIGHAMTFFQNMKLSGQRAQIAEKVLKEIGDRLKFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIGLHQRDNERLLETLVHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGQIVAEGTMEEIMAVPGSLTGQFLSGKRKIEIPKQRVPADPTKVLKLIGAKGNNLKDVTLTLPVGLFTCITGVSGSGKSTLINDTLFPLAQRQLNGATLAEPAAYREIQGLEHFDKVIDIDQSPIGRTPRSNPATYTGIFTPIRELFAGVPEARTRGYNPGRFSFNVRGGRCEACQGDGVIKVEMHFLPDVYVPCDQCKGKRYNRETLEIKYKGKGIHEVLDMTIEEAREFFDAIPALARKLQTLIDVGLSYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIEQLLTVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAACEQSHTARFLRPILAREA
>CP026982.1|AYH17694.1|879625_880168_-|single-stranded-DNA-binding-protein-SSB1
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGEQKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGALQTRKWADQAGVERYTTEVVVNVGGTMQMLGGRQGGGAPAGGNAGGGQQQGGWGQPQQPQGGNQFSGGAQAQQRPAQNSAPAQSNEPPMDFDDDIPF
>CP026982.1|AYH17693.1|877541_879383_-|amidohydrolase
MEKNSTRRIATKNRSQNTVNNTSSTQAKHAVTGRYSFRLAALAVTVSGLFFSSPGLMAAETAATADLVLRNGNIYTVNQGQPWAEAVAVRDGRYVFIGSNAQAAEFIGPKTQVVDLNGSMAMPGINDVHAHPLDGGYEDIYSCNFAQTSSLDGILNQVSECAQKAGPGEWVVGSAWGSPHMAELSTAEALAKLDKVSNGRPVILRDDSYHNRWINSEAMRLATITAQSVSPAGGVIVKDAKTGEPTGLLQEFPAFQHVQSLVPVPTEEQRLTSGRRAAKTMVSLGITGVQEAVSSEVNLRIWSKIDRAEGLPLRIIGSIVSTPLLDEGAAGLELVARRDVYRTTNFFPDRFKFVLDGVPPAHTAKLIDPYLPTKTHGDHYHGDTHYTTEQVVEILSKLDKQGISTKLHAAGDGSLRLALDAVEQVRKINGPNGPMHQIAHTHLISPQDMPRFAQLRVAADLSPMLWFPSDMTNASVVTIGEERMKDFVPTVKLLRSGAVVAGGSDWPAGGPTPSPWIGIEGLVTRQNPLDDAPGTLAPEEAVDLPEAIRIYTINSAKTMGIEKETGSVELGKSADLIVLDRHLFNVPIKQVHRANVVKTYFKGQLVYSAPEKS
>CP026982.1|AYH21236.1|876854_877313_-|N-acetyltransferase
MMNLDREIMINSAEPEDYDQWLPYWESYQAFYNVQLTDDVTKTTWDRFFKAEIPVHCAIAREGAHIIGFAHFVFHDSTWGVNPYCYLEDLFVAPTARGKCVGKKLIEYVREKAQEKHCDRLYWHTQETNKTAQRLYNWVAEKPGIIEYRMPL
>CP026982.1|AYH17692.1|876196_876787_-|hypothetical-protein
MNYQSTSLFIYTTRIFFAICLCGALAVAGISAPVFYLLAMKLAYPVILSLRLHRLSEKGIAFLPKEKSEWMVYVHGIPVRETRTSLTNPYFFSAESIRTFSLRAYIGKLLVQICAVILLVQQTITVNWPWLYLGVVVAALWFAYAIAMTIIELVSIMRDRWFIEKLVSPSQSEWFGGYIDFRGYRVTVLERLLSLK
>CP026982.1|AYH17691.1|875653_876085_+|carboxymuconolactone-decarboxylase-family-protein
MSTLRLPYQTLSPEAYQGLGMTKKALNKSSLGKQLIELVYLRVSQINGCAFCLEMHASALRADGVPDTKLDSLAGWRVSAQFNERERVALAWTESLVDVAHSHAPDEDFEPLKVHFSDAEIADLSFAVALMSAFNRLAIGMRQ
>CP026982.1|AYH17690.1|875081_875513_+|N-acetyltransferase
MGTFRLSLIDSDRDYLACFDVMRELRPHLPDAAGFTAQARRQAGQGYHLLAAWQGDRVMGLAGYRIQENLLYGRFLYVDDLVVAVAVRDKGLGGLLIEAMREEAQRQDCAHLVLDTALGNALAQRFYFRQGLLSKGLHFSLAL
>CP026982.1|AYH17689.1|873571_874990_-|PLP-dependent-aminotransferase-family-protein
MDMQHLKPSREHDAPLYLQLYRRYRDAITAGKLHPGDRVPSVRSLASELNLARGTVEMAYQMLAGEGYFLTRGPAGTIVSPQLEKLTESGYITPSRSQIPSRPQTEAAQVQPFQLGLPALDAFPRKTWARLAGKNLRTLDTAAMIYPDPAGYEPLRRAIATYLGISRGITCTYEQVFITAGYRGALELVCRTLLQPGDIGWFEDPGYLFARQFLERAGMHLAPVPVDEEGLNVDMGQQRAAEARFAVVTPTHQSPMGVALSLPRRLQLLEWASHRRSWIIEDDYDSEFRYHGRPLPALKSLDRDGRVLYTGTFSKVLFPGLRLAYLVVPEPQIERFKETTNHFGYSGSILPQATVADFMEQGHFARHLRKMRSLYAMRRSYLVDELLQTLGSHLTVQPQAGGIHVLATLATRGDDQSLAAAAQSHGLAIQALNDWRMCGPSHGGLLMGFTNVAEPAMAKVLVHQLAAAIGLS
>CP026982.1|AYH17688.1|872480_873530_+|LacI-family-transcriptional-regulator
MATLKDIADRAGVSISTVSRALNGTAPISAKVRQHIMAIATEQGYPLHKVGKATVTQTEPLRHILLATPRNLMLESEYNLVSLTLINALKTLCLQRNIQLRPFLGEHDTINEQQLLRELQGGKESGILIVNDDHPTLLNAVAESGIPAVLINGEDPSMRLSSVTPANHYAAAAAVRYLIDQGHTRILHLTWTSRMTIKQRERGYRDALAQAGIAVDDDLILSLPDFHPRTARDALLRWLTANPDRLGVTAIFCAADNQAIGVIDALYQHGLRVPDDMSVMGMDDILPFDMLPVSLTTVHLPFETIARAALQLLAQQMTPSQALGIAQRTELAGKVVVRESVRRIESNTD
>CP026982.1|AYH17697.1|885620_886601_+|type-I-F-CRISPR-associated-endonuclease-Cas1
MDNAFSPSDLKTILHSKRANVYYLQHCRILVNGGRVEYVTEEGSQSLYWNIPIANTSVVMLGTGTSVTQAAMREFARAGVMVGFCGGGGTPLFAANEAEIAVSWLSPQSEYRPTEYLQDWVSFWFDDEKRLAAAVAFQQVRITQIRQHWLSSRLSRESRFTFKADHLQALLDRYEKGLTNCRTSNDVLVQEAMMTKALYKLAANAVSYGDFTRAKRGGGTDLANRFLDHGNYLAYGLAAVSTWVLGLPHGLAVLHGKTRRGGLVFDVADLIKDALVLPQAFIAAMEGEDEQEFRQRCLTAFQQSEALDVMIGSLQDVASKLSQVAR
>CP026982.1|AYH17698.1|886597_889894_+|type-I-F-CRISPR-associated-helicase-Cas3
MNILLISECNKRALVETRRILDQFAERKGERSWQTAITLEGLNTLRKLLRKTARRNTAVACHWIRSTNHTELLWVVGNLRRFNAQGSVPTNTTSRDVLRTKDENPWHSAEVFSLLAAIAGLFHDVGKANALFQAGLSGTGPHSQPYRHEWVSLRLFQAFVGEQDDKAWLTMLSTITPEAEVALLATLQHDKPTFSDSPFRTLPPLAQTVAWLIVSHHRLPVFNKAVELAPNSSEPQLSFAETWLTDHTSAQWNAINHYKTHWTSSEREQNWQFPNGTPLRSAVWREKARKFAGRALKLPAFMYFSQLDQRLTVHLARLALMLADHHYSAGAATLGWQDITYPVWANTDRKTREYKQRLDEHCVGVGQNALLLGRSLPHLRDTLPAITRHKGFRQRSTHPRFRWQDRAFDLAGSIRETTKQHGFFGINMASTGRGKTFANARIMYGLSDEAIGCRFSVALGLRTLTLQTGDALRQRLKLDEDDLAVLIGSQAVQDLHEMRKENQQRQQNTPQTGSESADPLFSEHQYVRYDGSLDDGRLKAWLERSPTLHQLLSAPVLITTIDHLMPATEGLRGGHQIAPMLRLLTSDLVLDEPDDFGLEDLPALCRLVNWAGMLGSRVLLSSATLPPALIRALFDAYLDGRAAWQQAYGTPNAPLNVCCGWFDEFDCQHAQYGDVKDFMIKHDAFVHQRLKNLTKDELPLRFATIVPVSSPSKNADDVHLAVAQAIHPRILDLHSQHHQQHESGKTVSLGLVRMANIDPLVAATRQLLSIPSPPDTCIHYCVYHSQHPLAMRSYIEQRLDAALMRNDADALWQVEEIRQAIEKAPQQHHVFVVLATSVAEVGRDHDYDWAIVEPSSMRSLIQLAGRILRHRQDERYVPKTPNIYLLSHNIRALRGEDIAYCKPGFESQDDSLDTHDLHQLLQEKEYRHLSAAPRIVQPASFTKPLSLVALEHAVLGKTLLGLKNKKLDDLKRPPAAFWWRAHPHWNGELQRRTPFRQSAKDEAYTLWIADDDEEPVFMVQDDGPSGWKPNDIARPVTLNMAEGVSAWIEPDYHALYQRLAEEKQWELSWVSARFGEIRLREEKDWYWHPLLGVFGALS
>CP026982.1|AYH17699.1|890044_890281_+|hypothetical-protein
MSFLRLNEIFSYHARIVQALSRSQHMKRLNVIGLAVLLAAILVVILCMKPITMYINNQADSSAKGQQFSIFSITINRN
>CP026982.1|AYH17700.1|890321_891656_+|type-I-F-CRISPR-associated-protein-Csy1
MRGEKLKTFILSYISTRKQAKLDAFDKDAEKKRAALSGEALAVTELELAQVRREIEQKHEVQNWLTDAASRAGQISLVTHALKFTHSDARGSSIFSADTVADAKTLSTATLAQPAIDAVGNAAALDVAKLLQTEYDGDSLVAALQRGDHSALEALAESPEQLAQWLAGFQQVFTDRQPSSHKLAKQIYFPLANGEYHLLSPLYSSSLAQALHQRINAVRFGDEAKAIRQAQKASQWHDQLSISYPNLAVQNMGGTKPQNISALNSSRSGRSYLLSSAPPQWNSIEKPPQQHESIFRPRGEVDYYTRATLAQMQRFLLSVKEVENNRDIRQQRLRYLDQLIDQLFFYVASVQNLPAGWSAESELKRTQQLWLDPYRAETDTVFRREREAGDWQQAVAYDFGRWLNRRLKHENLIFGEVERREWSTAALFKRRMREMEGTLKEELA
>CP026982.1|AYH17701.1|891652_892585_+|type-I-F-CRISPR-associated-protein-Csy2
MSTLIILRRIQVENANAIAGLTYGFPAITHFLGFTHALSRKLQASHGLTLDGCGVVSHQHQLHAYGSSWERSFALTRNPLTKEAKTAAFNEEGRMHMTVSLLIRCDGQIPADTTALCEHLKQQAQCQRLAGGTVIDIERVTIQSLPVDEVENRGVMRRLLPGFVLRDRTSLLHRHFQALQQDNPQAEMIDAWLDFAALKMQAERDPSDNAVQWKYLPKPGDGGFLTPLMIGYRAISPLYAPGEVDKTRDPHTSFCFAEAAYGIGEWQGAHRINDIRQILWEYDHQNGDYHCRQLADTDSAAEDTSYEFDY
>CP026982.1|AYH17702.1|892598_893612_+|type-I-F-CRISPR-associated-protein-Csy3
MAKATTALKTASVLAFERKLANSDALMYAGNWTQQDNWTAIAIQEKSVRGTISNRLKNALTSDTTKLDAEIQKANLQKVDVAALPFDADTLKVVFTLRVLGNLAQPSVCNDQDYQTALGNIITGYAQDQGFGTLAARYAENIANGRFLWRNRVGAEAIRVVVTRKGEKSWEFNGEDYSLRQFSQPTGDLAALAQAIEEGLAGDASALFTVEAYVQLGNGQEVFPSQELVLDEKARNGKSKILYQVNDVAAIHSQKIGNALRTIDDWYPAADEAGPIAVEPYGSVTSRGKAYRQPKEKMDFYTLLDNWVIKGDVPVPEQQHYVIATLIRGGVFGEKGE
>CP026982.1|AYH17703.1|893621_894176_+|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4
MDHYIDIRVQPDPEFTAPQLLNALFAKLHRALGQLADGKIGISFPEVGKTLGECLRLHGTADALSTLEKTSWLKGLRDYTQVSECKAVPNNVKFRTVRRVQLKTSAERLRRRSVNKGWLTEAEAAARIPDAVEKRSTLPFVQIKSLSNGQMFFVFVEHGPLQNAPATGRFSSYGLSAEATVPWF
>CP026982.1|AYH17704.1|894580_895441_+|hypothetical-protein
MKYDPVLKTLVDDDYRLEDHLDFKKQHADINDQKLRAQLNEINDDNIHAILTAQEATYFLKTLCTPNPNQSWKTAIFGCTDPVSSFAGNIAEAVSVSRILMEIKGFGVKATEYIGKDGNKYIKLSGYPGVRKYLNATRYLNISHKIVDIGIGTKGIESGIAAGARLCIIFSAAYRTIELMFKDEYALTDFFVNLTMDAAKLAISIGVAWGAKTAATSVMVATGGSVIIIACGVFALGVIVSFSLLWLDDRYKISETIINNLKSHRSQYTPYHPDQFFNTWGRYSRG
>CP026982.1|AYH17705.1|895433_895838_+|DUF1240-domain-containing-protein
MVKVNRPLVGAFAIFIFLLTCFTGWFSFNSYLDFLQLTDVIVFSWKVGLMVFCSPLLFYFSYLFLYSVVNNEVARINNKLGGGLVIIMIIGGVISLFSSLYISYSLNELGYEVCPKTSWMSPNKYVKNIDLCKE
>CP026982.1|AYH17706.1|895862_896291_+|DUF1240-domain-containing-protein
MPGGDTAVVKVNRPLIGSFALFLFLASCWGCWFSLSGYLAFFESNDVIIFSWKVGVLIFAAPLLFYFSYLAFYSVIKNEPAKMNNKLANILAMIAIFGAVVSLFLSIYVSYDLNIQSYKMCPKISWMDPNKYVKDIVFCDKW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_3

902540-904601

TypeI-F

I-F

Consensus_repeat	Method
TTTCTAAGCTGCCTATACGGCAGTGAAC	CRISPRCasFinder
TTTCTAAGCTGCCTATACGGCAGTGAAC	CRT
TTTCTAAGCTGCCTATACGGCAGTGAAC	PILER-CR

34 spacers

The CRISPR arrays of CP026982_3

>merge|CP026982|3|902540-904601|CRISPRCasFinder,CRT,PILER-CR
TCTTTAAGCTGCCTGCACGGCAGTGAATGCTGGCTCGATGCGCAGCATGACAGCGCGCCCTTTCTAAGCTGCCTATACGGCAGTGAACTTCTTTCAATACCATGCCGCCCCACGCATTGCTTTCTAAGCTGCCTATACGGCAGTGAACCCTTTCCGCCATAAATTTTTATCTGCTTACCGTTTCTAAGCTGCCTATACGGCAGTGAACTCAGCTAGACGTAATTTATGGTATGTAGGCAATTTCTAAGCTGCCTATACGGCAGTGAACAAGGTTGGGCGCTGGTGCCAATTGAGCCGACTTTTCTAAGCTGCCTATACGGCAGTGAACGACAGGGCGGTGGATCACATCGTTCCGCTCTCTTTCTAAGCTGCCTATACGGCAGTGAACTGGTATTCGTCGCCGGTCACTCGGTCATCCGTTTTCTAAGCTGCCTATACGGCAGTGAACTTTTTGTCAGGACTCAAACCGGCGTAATTTATTTTCTAAGCTGCCTATACGGCAGTGAACGATTCGCGGGTTAGCGTGGGTGGTTCTGCGCTTTTCTAAGCTGCCTATACGGCAGTGAACATTTAAGCTTCAGAATGTGATTGGCCTCAAAATTTCTAAGCTGCCTATACGGCAGTGAACTTGGTTTCATGACGCTGTGGCTTTCGCACCTTTTTCTAAGCTGCCTATACGGCAGTGAACATTCAGGTCATCTGGTATCGGAGAACGCAGCCTTTCTAAGCTGCCTATACGGCAGTGAACCATCGCTGGCGTATTCAGTGTGGTCGAAAGAGTTTCTAAGCTGCCTATACGGCAGTGAACCATTTCAACCGGAGAGGTCAGTACTAGACTGTTTTCTAAGCTGCCTATACGGCAGTGAACATAGGATATCAATGTATGCCTCACGCGTAAGATTTCTAAGCTGCCTATACGGCAGTGAACATACAAAGGATACAATGCCCGTCGAGATAAACTTTCTAAGCTGCCTATACGGCAGTGAACTGGTGCGTGTCGCGGCGGCGGTAGAGGGTGATTTTCTAAGCTGCCTATACGGCAGTGAACTTGATAAACACGCACACGGCGCAGTGATGAGCTTTCTAAGCTGCCTATACGGCAGTGAACCTTTAGTGCAGGCAGCGGGGCGCTATTTCTAAGCTGCCTATACGGCAGTGAACGACGAGCAACGGGCGCACTGCCCATTGCCCAATTTCTAAGCTGCCTATACGGCAGTGAACTCAGATGCCGTTGATCTGGCACATGCCGTTATTTTCTAAGCTGCCTATACGGCAGTGAACTTAATTAACTGCATAACAGCCTGGGAAACGGTTTTCTAAGCTGCCTATACGGCAGTGAACGCAGCAACTTCACGCTGACGGGTTTGCATGTCTTTCTAAGCTGCCTATACGGCAGTGAACCGACTCACTTAACGAATTTGCATACGACCCGTTTTCTAAGCTGCCTATACGGCAGTGAACACTTCTAACACGCCTTTATGGTCATCATATACTTTCTAAGCTGCCTATACGGCAGTGAACGAATAACGTCGAGCGTGACGTCATCCAGCACTTTTCTAAGCTGCCTATACGGCAGTGAACAAATCCAAGAGAGTACGAGCGCCGTTAGCATATTTCTAAGCTGCCTATACGGCAGTGAACACTCTGATAGTTCTATATTGGGTCACGTGGAATTTCTAAGCTGCCTATACGGCAGTGAACACTATTACCGTGACGGTGAATTTACTGTTAACTTTCTAAGCTGCCTATACGGCAGTGAACATCCTATTATTAATTAGCGTTGCAGTCGCTAATTTCTAAGCTGCCTATACGGCAGTGAACTTAGTGCACGTTACGCCGTTTAGCGTTTCAGATTTCTAAGCTGCCTATACGGCAGTGAACATTGGAATAAGGCAATTAATAGCCGTGCTTAGTTTCTAAGCTGCCTATACGGCAGTGAACGCTAAACTGCTGGGCGTGCTCGATGAAGTTAATTTCTAAGCTGCCTATACGGCAGTGAACATTCTGTTTATGTTATAAAAGATTCTTCCTGCGTTTCTAAGCTGCCTATACGGCAGTGAAC

>CP026982|3|3|902540-904601|CRISPRCasFinder
TCTTTAAGCTGCCTGCACGGCAGTGAAT	GCTGGCTCGATGCGCAGCATGACAGCGCGCCC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTCTTTCAATACCATGCCGCCCCACGCATTGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CCTTTCCGCCATAAATTTTTATCTGCTTACCG
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGCTAGACGTAATTTATGGTATGTAGGCAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	AAGGTTGGGCGCTGGTGCCAATTGAGCCGACT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GACAGGGCGGTGGATCACATCGTTCCGCTCTC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TGGTATTCGTCGCCGGTCACTCGGTCATCCGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTTTTGTCAGGACTCAAACCGGCGTAATTTAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GATTCGCGGGTTAGCGTGGGTGGTTCTGCGCT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTTAAGCTTCAGAATGTGATTGGCCTCAAAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTGGTTTCATGACGCTGTGGCTTTCGCACCTT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTCAGGTCATCTGGTATCGGAGAACGCAGCC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CATCGCTGGCGTATTCAGTGTGGTCGAAAGAG
TTTCTAAGCTGCCTATACGGCAGTGAAC	CATTTCAACCGGAGAGGTCAGTACTAGACTGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATAGGATATCAATGTATGCCTCACGCGTAAGA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATACAAAGGATACAATGCCCGTCGAGATAAAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TGGTGCGTGTCGCGGCGGCGGTAGAGGGTGAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTGATAAACACGCACACGGCGCAGTGATGAGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CTTTAGTGCAGGCAGCGGGGCGCTA
TTTCTAAGCTGCCTATACGGCAGTGAAC	GACGAGCAACGGGCGCACTGCCCATTGCCCAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGATGCCGTTGATCTGGCACATGCCGTTAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTAATTAACTGCATAACAGCCTGGGAAACGGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCAGCAACTTCACGCTGACGGGTTTGCATGTC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CGACTCACTTAACGAATTTGCATACGACCCGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTTCTAACACGCCTTTATGGTCATCATATAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	GAATAACGTCGAGCGTGACGTCATCCAGCACT
TTTCTAAGCTGCCTATACGGCAGTGAAC	AAATCCAAGAGAGTACGAGCGCCGTTAGCATA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTCTGATAGTTCTATATTGGGTCACGTGGAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTATTACCGTGACGGTGAATTTACTGTTAAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATCCTATTATTAATTAGCGTTGCAGTCGCTAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTAGTGCACGTTACGCCGTTTAGCGTTTCAGA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTGGAATAAGGCAATTAATAGCCGTGCTTAG
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCTAAACTGCTGGGCGTGCTCGATGAAGTTAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTCTGTTTATGTTATAAAAGATTCTTCCTGCG
TTTCTAAGCTGCCTATACGGCAGTGAAC

>CP026982|3|2|902540-904601|CRT
TCTTTAAGCTGCCTGCACGGCAGTGAAT	GCTGGCTCGATGCGCAGCATGACAGCGCGCCC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTCTTTCAATACCATGCCGCCCCACGCATTGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CCTTTCCGCCATAAATTTTTATCTGCTTACCG
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGCTAGACGTAATTTATGGTATGTAGGCAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	AAGGTTGGGCGCTGGTGCCAATTGAGCCGACT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GACAGGGCGGTGGATCACATCGTTCCGCTCTC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TGGTATTCGTCGCCGGTCACTCGGTCATCCGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTTTTGTCAGGACTCAAACCGGCGTAATTTAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GATTCGCGGGTTAGCGTGGGTGGTTCTGCGCT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTTAAGCTTCAGAATGTGATTGGCCTCAAAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTGGTTTCATGACGCTGTGGCTTTCGCACCTT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTCAGGTCATCTGGTATCGGAGAACGCAGCC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CATCGCTGGCGTATTCAGTGTGGTCGAAAGAG
TTTCTAAGCTGCCTATACGGCAGTGAAC	CATTTCAACCGGAGAGGTCAGTACTAGACTGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATAGGATATCAATGTATGCCTCACGCGTAAGA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATACAAAGGATACAATGCCCGTCGAGATAAAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TGGTGCGTGTCGCGGCGGCGGTAGAGGGTGAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTGATAAACACGCACACGGCGCAGTGATGAGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CTTTAGTGCAGGCAGCGGGGCGCTA
TTTCTAAGCTGCCTATACGGCAGTGAAC	GACGAGCAACGGGCGCACTGCCCATTGCCCAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGATGCCGTTGATCTGGCACATGCCGTTAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTAATTAACTGCATAACAGCCTGGGAAACGGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCAGCAACTTCACGCTGACGGGTTTGCATGTC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CGACTCACTTAACGAATTTGCATACGACCCGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTTCTAACACGCCTTTATGGTCATCATATAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	GAATAACGTCGAGCGTGACGTCATCCAGCACT
TTTCTAAGCTGCCTATACGGCAGTGAAC	AAATCCAAGAGAGTACGAGCGCCGTTAGCATA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTCTGATAGTTCTATATTGGGTCACGTGGAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTATTACCGTGACGGTGAATTTACTGTTAAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATCCTATTATTAATTAGCGTTGCAGTCGCTAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTAGTGCACGTTACGCCGTTTAGCGTTTCAGA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTGGAATAAGGCAATTAATAGCCGTGCTTAG
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCTAAACTGCTGGGCGTGCTCGATGAAGTTAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTCTGTTTATGTTATAAAAGATTCTTCCTGCG
TTTCTAAGCTGCCTATACGGCAGTGAAC

>CP026982|3|2|902600-904601|PILER-CR
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTCTTTCAATACCATGCCGCCCCACGCATTGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CCTTTCCGCCATAAATTTTTATCTGCTTACCG
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGCTAGACGTAATTTATGGTATGTAGGCAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	AAGGTTGGGCGCTGGTGCCAATTGAGCCGACT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GACAGGGCGGTGGATCACATCGTTCCGCTCTC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TGGTATTCGTCGCCGGTCACTCGGTCATCCGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTTTTGTCAGGACTCAAACCGGCGTAATTTAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GATTCGCGGGTTAGCGTGGGTGGTTCTGCGCT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTTAAGCTTCAGAATGTGATTGGCCTCAAAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTGGTTTCATGACGCTGTGGCTTTCGCACCTT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTCAGGTCATCTGGTATCGGAGAACGCAGCC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CATCGCTGGCGTATTCAGTGTGGTCGAAAGAG
TTTCTAAGCTGCCTATACGGCAGTGAAC	CATTTCAACCGGAGAGGTCAGTACTAGACTGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATAGGATATCAATGTATGCCTCACGCGTAAGA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATACAAAGGATACAATGCCCGTCGAGATAAAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	TGGTGCGTGTCGCGGCGGCGGTAGAGGGTGAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTGATAAACACGCACACGGCGCAGTGATGAGC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CTTTAGTGCAGGCAGCGGGGCGCTA
TTTCTAAGCTGCCTATACGGCAGTGAAC	GACGAGCAACGGGCGCACTGCCCATTGCCCAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TCAGATGCCGTTGATCTGGCACATGCCGTTAT
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTAATTAACTGCATAACAGCCTGGGAAACGGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCAGCAACTTCACGCTGACGGGTTTGCATGTC
TTTCTAAGCTGCCTATACGGCAGTGAAC	CGACTCACTTAACGAATTTGCATACGACCCGT
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTTCTAACACGCCTTTATGGTCATCATATAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	GAATAACGTCGAGCGTGACGTCATCCAGCACT
TTTCTAAGCTGCCTATACGGCAGTGAAC	AAATCCAAGAGAGTACGAGCGCCGTTAGCATA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTCTGATAGTTCTATATTGGGTCACGTGGAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ACTATTACCGTGACGGTGAATTTACTGTTAAC
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATCCTATTATTAATTAGCGTTGCAGTCGCTAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	TTAGTGCACGTTACGCCGTTTAGCGTTTCAGA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTGGAATAAGGCAATTAATAGCCGTGCTTAG
TTTCTAAGCTGCCTATACGGCAGTGAAC	GCTAAACTGCTGGGCGTGCTCGATGAAGTTAA
TTTCTAAGCTGCCTATACGGCAGTGAAC	ATTCTGTTTATGTTATAAAAGATTCTTCCTGCG
TTTCTAAGCTGCCTATACGGCAGTGAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH17722.1\|911892_912915_-\|tRNA-dihydrouridine(20/20a)-synthase-DusA	unknown	unknown	gnl\|CDD\|236991
CP026982.1\|AYH17720.1\|909586_910975_+\|cytochrome-P450	unknown	unknown	gnl\|CDD\|365848
CP026982.1\|AYH17716.1\|904787_905438_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH17712.1\|899197_899701_-\|M48-family-peptidase	unknown	unknown	gnl\|CDD\|224368
CP026982.1\|AYH17710.1\|898130_898547_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17718.1\|906734_908141_-\|replicative-DNA-helicase-DnaB	unknown	unknown	gnl\|CDD\|181193
CP026982.1\|AYH17724.1\|914339_915221_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293825
CP026982.1\|AYH17719.1\|908268_909255_+\|quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|182701
CP026982.1\|AYH17707.1\|896337_896745_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17711.1\|898599_899079_-\|type-VI-secretion-system-tube-protein-Hcp	unknown	unknown	gnl\|CDD\|213799
CP026982.1\|AYH17713.1\|899834_901028_-\|aspartate/tyrosine/aromatic-aminotransferase	unknown	unknown	gnl\|CDD\|181731
CP026982.1\|AYH17714.1\|901091_901706_-\|YitT-family-protein	unknown	unknown	gnl\|CDD\|224203
CP026982.1\|AYH17715.1\|901957_902437_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
CP026982.1\|AYH21238.1\|913111_913405_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH17708.1\|896796_897201_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17717.1\|905613_906693_-\|alanine-racemase	unknown	unknown	gnl\|CDD\|143500
CP026982.1\|AYH17721.1\|911453_911726_-\|envelope-stress-response-protein-PspG	unknown	unknown	gnl\|CDD\|181875
CP026982.1\|AYH21237.1\|897248_897656_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17709.1\|897736_898105_+\|DUF1240-domain-containing-protein	unknown	unknown	gnl\|CDD\|336520
CP026982.1\|AYH17723.1\|913695_914352_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|226062

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH17720.1\|909586_910975_+\|cytochrome-P450	gnl\|CDD\|365848	pfam00067, p450, Cytochrome P450. Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures.	1.11281e-61
CP026982.1\|AYH17712.1\|899197_899701_-\|M48-family-peptidase	gnl\|CDD\|224368	COG1451, COG1451, Predicted metal-dependent hydrolase [General function prediction only].	3.13831e-28
CP026982.1\|AYH17710.1\|898130_898547_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	1.72883e-33
CP026982.1\|AYH17722.1\|911892_912915_-\|tRNA-dihydrouridine(20/20a)-synthase-DusA	gnl\|CDD\|236991	PRK11815, PRK11815, tRNA dihydrouridine(20/20a) synthase DusA.	0
CP026982.1\|AYH17724.1\|914339_915221_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293825	cd07739, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.61076e-104
CP026982.1\|AYH17719.1\|908268_909255_+\|quinone-oxidoreductase	gnl\|CDD\|182701	PRK10754, PRK10754, NADPH:quinone reductase.	0
CP026982.1\|AYH21237.1\|897248_897656_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	3.62924e-40
CP026982.1\|AYH17711.1\|898599_899079_-\|type-VI-secretion-system-tube-protein-Hcp	gnl\|CDD\|213799	TIGR03344, VI_effect_Hcp1, type VI secretion system effector, Hcp1 family. This family includes Hcp1 (hemolysin coregulated protein 1), an exported, homohexameric ring-forming virulence protein from Pseudomonas aeruginosa. Hcp1 lacks a conventional signal sequence and is instead exported by means of the type VI secretion system, encoded by a pathogenicity cluster of a class previously designated IAHP (IcmF-associated homologous protein). Homologs of Hcp1, in this protein family, are found in various bacteria of which most but not all are known pathogens. Pathogens may have many multiple members of this family, with three to ten in Erwinia carotovora, Yersinia pestis, uropathogenic Escherichia coli, and the insect pathogen Photorhabdus luminescens. [Cellular processes, Pathogenesis].	6.38488e-80
CP026982.1\|AYH17713.1\|899834_901028_-\|aspartate/tyrosine/aromatic-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0
CP026982.1\|AYH17714.1\|901091_901706_-\|YitT-family-protein	gnl\|CDD\|224203	COG1284, COG1284, Uncharacterized conserved protein [Function unknown].	3.42456e-38
CP026982.1\|AYH17715.1\|901957_902437_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	2.16085e-34
CP026982.1\|AYH17707.1\|896337_896745_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	9.42849e-30
CP026982.1\|AYH17708.1\|896796_897201_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	1.6661e-31
CP026982.1\|AYH17718.1\|906734_908141_-\|replicative-DNA-helicase-DnaB	gnl\|CDD\|181193	PRK08006, PRK08006, replicative DNA helicase DnaB.	0
CP026982.1\|AYH17721.1\|911453_911726_-\|envelope-stress-response-protein-PspG	gnl\|CDD\|181875	PRK09459, pspG, envelope stress response protein PspG.	8.76907e-26
CP026982.1\|AYH17717.1\|905613_906693_-\|alanine-racemase	gnl\|CDD\|143500	cd06827, PLPDE_III_AR_proteobact, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases. This subfamily is composed mainly of proteobacterial alanine racemases (EC 5.1.1.1), fold type III PLP-dependent enzymes that catalyze the interconversion between L- and D-alanine, which is an essential component of the peptidoglycan layer of bacterial cell walls. hese proteins are similar to other bacterial ARs and are fold type III PLP-dependent enzymes containing contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.	0
CP026982.1\|AYH17709.1\|897736_898105_+\|DUF1240-domain-containing-protein	gnl\|CDD\|336520	pfam06836, DUF1240, Protein of unknown function (DUF1240). This family consists of a number of hypothetical putative membrane proteins which seem to be specific to Yersinia pestis. The function of this family is unknown.	4.66923e-27
CP026982.1\|AYH17723.1\|913695_914352_-\|DsbA-family-protein	gnl\|CDD\|226062	COG3531, COG3531, Predicted protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones].	9.97206e-75

>CP026982.1|AYH17715.1|901957_902437_-|Lrp/AsnC-family-transcriptional-regulator
MYNIDDFDLKILTLLQTNGRLTNQELSELVGLSASQCSRRRIALEQAQLILGYHARLSPNAVGLECLGLIEVRLINHTSEYVERFHQMLGEVDAIIDAYKTTGDADYLLKVAVADLPGLSTLISQILSQNKSVAHLKTSVVLNRLKENGLVTPEPPVLP
>CP026982.1|AYH17714.1|901091_901706_-|YitT-family-protein
MDNVIPTQKISHTRLEDVLAILIGTLMASFGIILLRQAGALTGGTAGIAFLVHYLTNISFGVAFFLLNLPFYYLAVRRMGWEFTVKTFSAVGLVSLFSDLHPLFVHFDRLNPFYATLFGNIITGIGFIVLFRHKASLGGVNVLALYLQDKYGLRAGKFQMGVDVVIVLTSLFVVSISMLIVSILGATILNLIIAMNHRPGRYAA
>CP026982.1|AYH17713.1|899834_901028_-|aspartate/tyrosine/aromatic-aminotransferase
MFQNVDTYAGDPILSLMEKFKQDPRADKINLSIGLYYNEQNIIPQLRAVSAAENSLRQPVQSANSYLPMEGLQPYRSAIQHLLFGESHAALAADRIATIQTLGGSGALKIGADFLKRYFPDSEVWVSDPTWENHIAIFEGAGFNVHTYPYFDGESLGVKFDAMLATLQTLPARSIVLLHPCCHNPTGSDLTTEQWDRVIEVVIARELIPFMDIAYQGFGLGIEQDAYAIRAIASAGVPALIANSFSKIFSLYSERVGGLSVVCDDTDSALRVLGQLKATVRRNYSSPPNFGAQVVSKVLNDAQLNADWKAEVEEMRTRILSMRQELVSALKNALPNRNFDYLLTQRGMFSYTGFSPEQVDRLREEFGVYLIASGRMCMAGLNHSNVQRVAAAFAAIQ
>CP026982.1|AYH17712.1|899197_899701_-|M48-family-peptidase
MTTLRYLNGYPPAIVAQAQTLVEQGKLGLWLEKRYPDRHHIQSDKLLYQFVAELKQRYLKNAPAISKVLYDNKQNPIKGTLGTNTFVARVQGGKLKSNNEIRIATLFRDGPEDFLRMIVIHELAHLKEKDHNKAFYQLCCHMDPDYHQLEFDMRIWLNWREMNTTSA
>CP026982.1|AYH17711.1|898599_899079_-|type-VI-secretion-system-tube-protein-Hcp
MANLIYASINGQKQGLISSGCSTLDSIGNRYQTGHEDQIQVLGLNHSISRDQNVAHHPINFVKPIDKSSPLLGMAISYNEKVDVTFYFYRVNSAGQLELYYEVTLTDANIVDVTCVYPHVIDNNEIMPYEKVQLKYKTIAWNHKIAGTSGYSIWEEMSL
>CP026982.1|AYH17710.1|898130_898547_+|DUF1240-domain-containing-protein
MELFVVKVNRPFIGAFSVFILCLSCWGTWFSLSEYLSFFKSNDVIVFSWRVGVAIFGVPLSFYFSYACFFSAIKNEHVKINNKLGEWLVKFLIFGAVVSLFSSSYISYSLSHQGYKTCPKISWMDPNKYVKDITLCDK
>CP026982.1|AYH17709.1|897736_898105_+|DUF1240-domain-containing-protein
MYSVFIISCWGGWFSLRGYIDFFNLSHVVSFSWKLGVIIFLVPIVFQFSCFGFFSAMKNRPIKMNDKISNALVIFAIFGAVVSLILSMYISYSLHVQGYKVCPKNSWIAPSKYVRDIILCKE
>CP026982.1|AYH21237.1|897248_897656_+|DUF1240-domain-containing-protein
MVKVNRPLVGAFAIFIFLLTCFTGWFSFNSYLDFLQLNDTIVFSWKVGLMVFGSPLLFYFSYLFFYSAINNEVAKINNKLGGGLFIIMIVGAIISLFSSFYISYNFRSYGYELCPKNSWMAPNKYVKKITLCDEW
>CP026982.1|AYH17708.1|896796_897201_+|DUF1240-domain-containing-protein
MVKINRPLFFSFSLFAFILSCWGGWFSLSGYIDFFNLSDVVLFSWKLGGMIFLVPIVLQFSHFSLFSAIKNKPIKMNNKISNVLVIFAILGAVISFFSSLYISYSLNELGYEVCPKTSWMSPNKYVKNIVLCKE
>CP026982.1|AYH17707.1|896337_896745_+|DUF1240-domain-containing-protein
MFKINRPLFFSFSVLVFIITCWGIWFSFNGYWGLFRLSDIIIFSWKVGILIFGSPMLFYFSYLGFYMAIKNKPIGMYGTLTNVCGYLFFIGVVISFIASMYISFNFRSYGYELCPKNSWMDPNKYVKSIVLCDEW
>CP026982.1|AYH17716.1|904787_905438_-|hypothetical-protein
MPQPPRFFGPILYYAASWLAASAILTLFALINFYTLEPTDVGGTLFGGMFGAIFDLIYWSCAALGFCFLALFRLSGWRVALILAGLVQIGISALWRIQYWQDYENEELILSPTPGELHVSILVGVAMTTIGIVKYRHAQHNSRPHSPVRSKTVTQKTRSTNTITAKTIAAFVLIALYLVLPLHLYLREPLPYCAFSPSGQQLSICLGEDDERIIVE
>CP026982.1|AYH17717.1|905613_906693_-|alanine-racemase
MKTATAVISRRALRHNLQRIRQLAPGSQVVAVVKANAYGHGMIESAHTFCDADCYGVARLSEALALRAAGITKPIVLLEGFFSADDLPLLVEHQLETAVHSPEQLAALEQATLSQPVRVWMKLDTGMHRLGVLPEQADAFWQRLTECRNVVQPVNIMSHFCRADEPEAGTTERQLACFDAFTQGKPGAQSIAASGGILLWPQAHRDRVRPGIILYGVSPLDNEDAAHFGFQPAMTFTSHLIAVREHKAGEAVGYGSTWTSPRDTRLGVVAVGYGDGYPRCAPAGTPVLINGREVPLSGRVSMDMITVDLGPEAQDKVGDEAILWGPALSVERIAAHTGVSAYELITRLTQRATLEYTDN
>CP026982.1|AYH17718.1|906734_908141_-|replicative-DNA-helicase-DnaB
MAEKRPTNKSNEPRDRQMEGLKLPPHSLEAEQSVLGGLMLDNERWDNVAERVVANDFYNRAHRLIFTEMHRLLEMSRPIDLITLSESLELQGSLESAGGFAYLAELAKNTPSAANIGAYADIVRERAVVREMISVANEIADAGYDPQGRSSEDLLDLAESRVFQIAENRASKDEGPKSIDRILEDTVSRIEQLYQRPHDGVTGVSTGYQDLDKKTAGLQKSDLIIVAARPSMGKTTFAMNLCENAAMMQDKPVLIFSLEMPGEQIMMRMLASLSRVDQTRIRTGQLDDEDWARISSTMGILLEKRNMYIDDSSGLTPTDVRSRARRVFREHDGLSLIMIDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELQVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIILGKQRNGPIGSVRLTFNGQWSRFDNYAGPQYDDE
>CP026982.1|AYH17719.1|908268_909255_+|quinone-oxidoreductase
MAKRVQFRAYGGPEVLQYGDFMPAEPAAGEVQVENRAIGINFIDTYIRSGLYPVPDLPSGLGTEAAGVVTKVGAGVSVLKVGDRVVYAQSGLGAYSEVHNVVAEKVALLPDAISFEQAAASFLKGLTVYYLLRQTYDIKPNDVFLFHAAAGGVGLIACQWAKALGAKLIGTVGSDEKAERAKQAGAWATINYRSENIAQRVAELTDGKKVPVVYDSVGKDTWEASLDSLCRRGLMVSFGNASGPVTGVNLGILNQKGSLYVTRPSLFGYVTNRAELEQASNELFSLIVSGAITVDVPQNQKFALADAQAAHRALESRSTQGSCLLIPG
>CP026982.1|AYH17720.1|909586_910975_+|cytochrome-P450
MRSIKRLPMPPTRGVLGHVDYLKRSDIHLQMLRWKAQYGRFYRLRLGLTPAVVIADTEWIRTIMKSRPGEFRRISSIESVFQEAGLNGVFSSEGERWENQRKLTEPMFQPAHLKYFYSSLRKVTSRLSNRFTMLAETGETIALVDEFKRYTVDITSLLAFGEDVNTLEQGDNPLSQSLRHLFPIINERCESPLPVWRYIRRARDKQFDASLNLIREYVDGFIYRQRQRIQLNPQLLDAPENMLQVMLAEQQKDGMLKDDDIVANAITLLIAGEDTTANTLTWMSFLLCSAPSVEACVFQECKEVTDSVEAILPWPLPRMPWLTAVMYESMRLKPVAPLLYLEPTKNTVIDDFLIKKGTPLLLMLNASGFDDELFQQPYDFMPERWLERGKAAFSDLQPFGGGPRMCPGRSLALMEIKLGFHALCSGFRVEAQQAASAVTESFAFTMTPSGFCVKLHKREQTQ
>CP026982.1|AYH17721.1|911453_911726_-|envelope-stress-response-protein-PspG
MLEIFFVIGFFIMLMLTGVSLLGVIAALFVASLFMLIGGLFSMAIKVLPWLILAVAAVWLWRKFSGRPVYNSHRYTYQKYTYRQRNGNQW
>CP026982.1|AYH17722.1|911892_912915_-|tRNA-dihydrouridine(20/20a)-synthase-DusA
MTDVKSDKSNTVSADSRASSLNRFSVAPMLDWTDRHCRYFLRQLTSQTLLYTEMVTTGAILHGKGDYLAYSEDEHPLALQLGGSDPAALAQCAKLAEQRGYDEINLNVGCPSDRVQNGRFGACLMGETALVADCIKAMKDSTSIPITVKTRIGIDDQDSYEFLCEFIQTVAGRGECDTFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPALTIAINGGVKTLEEAKTHLQHLDGVMMGREAYQNPGILAQVDRELFGIDAVAPDLAGVVRAMYPYIERELSGGASLGHITRHMLGMFQGITGARQWRRYLSENAHKPGADAAVVERALTLVNLV
>CP026982.1|AYH21238.1|913111_913405_-|hypothetical-protein
MKLSHNFSSALRTFAYFMASGTQNTLEGIDYLSLYGKEPSAFEQVFAIYANVLELDEDGNVLNAKYAEKRATDYLRQYCDPSFTVEPPYEDWEVELH
>CP026982.1|AYH17723.1|913695_914352_-|DsbA-family-protein
MAAVRLHYIYDPLCGWCYGAAPLALAAQEIDGLDLILHGGGMMTGSNSRTITPEWHDYVIPHDRRIAQLTGQTFGEAYYEGLLRDTSVVLDSAPPTAAVLAAEAMDDKGMAMLYQIEQAHYVSGLKIVDTAVLRQCAEAIGLDGDAFCTELAFVRAETLSQHINASRELLAKVRGQGFPTFALEDANGNFQQIPAANYLGQVEAWRNMLTQMVNHATA
>CP026982.1|AYH17724.1|914339_915221_-|MBL-fold-metallo-hydrolase
MSKSIAFTVSLLAASLGLASAANAAELKIDVFNPGEASVFPVSSEIISGDKEVALIDAQFQRNDAQTLVDRIKATGKKLTTVYISHSDPDYYFGLDVIKAAFPDAKIIATQATIDAINASKDGKVAHWGPVLKENAPKEIVVPQLLAGDSFTVDGKKLEVKGLKGPTPDRTYVWIPSLKAVVGGIPVSANIHVWLADTQTPESRVHWRETLKSIEALKPTTVVPGHFIAPTDYTLKNVTFTLQYLETVEKELAKSKNSAELIAAMKKHYPTLKEESGLELSAQVLKGEMKWPQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_4

1451361-1451456

Orphan

Consensus_repeat	Method
GGCAGGGATAGCCCGCCATAAAAAAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026982_4

>merge|CP026982|4|1451361-1451456|CRISPRCasFinder
GGCAGGGATAGCCCGCCATAAAAAACTGGAGCAATTTTTAACGCCGCTCGCGGCGGCCCGAAGGGTGGCTGGCAGGGATAGCCCGCCGTAAAAAAC

>CP026982|4|4|1451361-1451456|CRISPRCasFinder
GGCAGGGATAGCCCGCCATAAAAAAC	TGGAGCAATTTTTAACGCCGCTCGCGGCGGCCCGAAGGGTGGCT
GGCAGGGATAGCCCGCCGTAAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH18134.1\|1448549_1450013_-\|M48-family-peptidase	unknown	unknown	gnl\|CDD\|227122
CP026982.1\|AYH18140.1\|1455096_1457160_+\|tRNA(Met)-cytidine-acetyltransferase	unknown	unknown	gnl\|CDD\|224361
CP026982.1\|AYH18137.1\|1452531_1453569_+\|outer-membrane-protein-assembly-factor-BamC	unknown	unknown	gnl\|CDD\|236955
CP026982.1\|AYH18130.1\|1445154_1445781_+\|uracil-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234653
CP026982.1\|AYH18132.1\|1447385_1448093_+\|DnaA-inactivator-Hda	unknown	unknown	gnl\|CDD\|181224
CP026982.1\|AYH18138.1\|1453711_1454425_+\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	unknown	unknown	gnl\|CDD\|181800
CP026982.1\|AYH18127.1\|1440658_1442956_+\|ligand-gated-channel	unknown	unknown	gnl\|CDD\|273808
CP026982.1\|AYH18129.1\|1443764_1444802_-\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP026982.1\|AYH18128.1\|1443129_1443765_-\|phosphoribosylglycinamide-formyltransferase	unknown	unknown	gnl\|CDD\|235544
CP026982.1\|AYH18144.1\|1460907_1462086_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|180261
CP026982.1\|AYH18136.1\|1451636_1452515_+\|4-hydroxy-tetrahydrodipicolinate-synthase	unknown	unknown	gnl\|CDD\|235107
CP026982.1\|AYH21263.1\|1450712_1451261_-\|glycine-cleavage-system-transcriptional-repressor	unknown	unknown	gnl\|CDD\|236935
CP026982.1\|AYH18145.1\|1462097_1462745_-\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
CP026982.1\|AYH18143.1\|1459001_1460672_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|185001
CP026982.1\|AYH18135.1\|1450182_1450650_-\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|181857
CP026982.1\|AYH18141.1\|1457654_1457882_+\|DUF1272-domain-containing-protein	unknown	unknown	gnl\|CDD\|226334
CP026982.1\|AYH18131.1\|1445996_1447286_+\|uracil-permease	unknown	unknown	gnl\|CDD\|236744
CP026982.1\|AYH18142.1\|1458046_1458664_+\|esterase	unknown	unknown	gnl\|CDD\|183144
CP026982.1\|AYH18133.1\|1448157_1448535_-\|arsenate-reductase-(glutaredoxin)	unknown	unknown	gnl\|CDD\|239332
CP026982.1\|AYH18139.1\|1454626_1455079_+\|DUF441-domain-containing-protein	unknown	unknown	gnl\|CDD\|225334

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH18134.1\|1448549_1450013_-\|M48-family-peptidase	gnl\|CDD\|227122	COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only].	0
CP026982.1\|AYH18140.1\|1455096_1457160_+\|tRNA(Met)-cytidine-acetyltransferase	gnl\|CDD\|224361	COG1444, COG1444, Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only].	0
CP026982.1\|AYH18137.1\|1452531_1453569_+\|outer-membrane-protein-assembly-factor-BamC	gnl\|CDD\|236955	PRK11679, PRK11679, outer membrane protein assembly factor BamC.	0
CP026982.1\|AYH18130.1\|1445154_1445781_+\|uracil-phosphoribosyltransferase	gnl\|CDD\|234653	PRK00129, upp, uracil phosphoribosyltransferase; Reviewed.	5.63341e-132
CP026982.1\|AYH18132.1\|1447385_1448093_+\|DnaA-inactivator-Hda	gnl\|CDD\|181224	PRK08084, PRK08084, DnaA inactivator Hda.	2.2074e-173
CP026982.1\|AYH18138.1\|1453711_1454425_+\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	gnl\|CDD\|181800	PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed.	1.07083e-142
CP026982.1\|AYH18127.1\|1440658_1442956_+\|ligand-gated-channel	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	6.25162e-54
CP026982.1\|AYH18129.1\|1443764_1444802_-\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP026982.1\|AYH18128.1\|1443129_1443765_-\|phosphoribosylglycinamide-formyltransferase	gnl\|CDD\|235544	PRK05647, purN, phosphoribosylglycinamide formyltransferase; Reviewed.	7.80415e-129
CP026982.1\|AYH18144.1\|1460907_1462086_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|180261	PRK05790, PRK05790, putative acyltransferase; Provisional.	0
CP026982.1\|AYH18136.1\|1451636_1452515_+\|4-hydroxy-tetrahydrodipicolinate-synthase	gnl\|CDD\|235107	PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional.	0
CP026982.1\|AYH21263.1\|1450712_1451261_-\|glycine-cleavage-system-transcriptional-repressor	gnl\|CDD\|236935	PRK11589, gcvR, glycine cleavage system transcriptional repressor; Provisional.	2.92414e-132
CP026982.1\|AYH18145.1\|1462097_1462745_-\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	1.15703e-114
CP026982.1\|AYH18143.1\|1459001_1460672_+\|HAMP-domain-containing-protein	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	3.59598e-174
CP026982.1\|AYH18135.1\|1450182_1450650_-\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|181857	PRK09437, bcp, thioredoxin-dependent thiol peroxidase; Reviewed.	1.89815e-122
CP026982.1\|AYH18141.1\|1457654_1457882_+\|DUF1272-domain-containing-protein	gnl\|CDD\|226334	COG3813, COG3813, Uncharacterized protein conserved in bacteria [Function unknown].	3.76421e-27
CP026982.1\|AYH18131.1\|1445996_1447286_+\|uracil-permease	gnl\|CDD\|236744	PRK10720, PRK10720, uracil transporter; Provisional.	0
CP026982.1\|AYH18142.1\|1458046_1458664_+\|esterase	gnl\|CDD\|183144	PRK11460, PRK11460, putative hydrolase; Provisional.	3.06914e-119
CP026982.1\|AYH18133.1\|1448157_1448535_-\|arsenate-reductase-(glutaredoxin)	gnl\|CDD\|239332	cd03034, ArsC_ArsC, Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.	1.96995e-55
CP026982.1\|AYH18139.1\|1454626_1455079_+\|DUF441-domain-containing-protein	gnl\|CDD\|225334	COG2707, COG2707, Predicted membrane protein [Function unknown].	1.25048e-50

>CP026982.1|AYH21263.1|1450712_1451261_-|glycine-cleavage-system-transcriptional-repressor
MPSSQEHYLVITALGVDRPGIVNAITRHVSSCGCNIEDSRLAMLGKEFTFIMLLSGSWNAITLIESTLPLKGAEMDLLIVMKRTESQASQPTPSTVWVKVDVADSPHIIERFTDLFDSHQLNIAELVSKTQPAEGEKPPQLYIQIAAHSSATLDSSIIEPAFHQLCTELHAQGSISVVNYAR
>CP026982.1|AYH18135.1|1450182_1450650_-|thioredoxin-dependent-thiol-peroxidase
MNTLKAGDIAPKFSLPDQDGEQVNLTDFQGQKVLVYFYPKAMTPGCTVQACGLRDNMDDLKKHGVEVLGISTDKSEKLSRFAEKEVLNFTLLSDEDHQVSEGFGVWGEKTFMGKTYDGIHRISFLIDENGKVEKVFDDFKTSNHHDIVLDYLKSA
>CP026982.1|AYH18134.1|1448549_1450013_-|M48-family-peptidase
MSIRLRKTLMSVLLGALLAGSQLPAQADTLDRLPDIGTTAGGTLSINQELAMGDFYVRQLRAGAPLINDPLLSNYINQLGNRLVKQADSVRTPFHFYLIRNDDINAFAFFGGNVVLHSALFRYADSESELASVLAHEISHVTQRHLARSMESQQRSAPLTWVGALGSILLAMANPQLGMAALSGTLAGAQQGMITFTQSNEQEADRIGIQVLQRAGFDPQAMPNFLQKLADQSRYASRPPEMLLTHPLPESRLSDARNRANQMRSTPVQSSQDFLFAKMRTFGMYGAPDRPLNDDLLVQWEKGNVREQLAAKYGRAIQLYQAKKYDEARNVLQPLLSSTPDNPWFLDMMTDIDLGQNRATQAIARLQNVSGMQANPVLQLNLANAYVEGKQPAAAGKILYRYTYAHPDDPNGWDLLAQAAAAQGQRAEELAARAESLALNGQLDQSIRLLSNASSLVKLGSLEQARYDARIDQFRQLQQRFRQYQKS
>CP026982.1|AYH18133.1|1448157_1448535_-|arsenate-reductase-(glutaredoxin)
MTLLSTKASVTIYHNPRCSKSRETLALLQEHKIAPDVVLYLDTPPDAATLAQLIQQLGFSSARELMRTNEESYQQLGLSDAALTEAQLIQAMIDNPKLIERPIVVAQGQARIGRPPEQVLEILSL
>CP026982.1|AYH18132.1|1447385_1448093_+|DnaA-inactivator-Hda
MILNTPAQLSLPLYLPDDETFASFYPGENASLLAAVNNALYQEHGSYIYFWSREGGGRSHLLHAACAELSRQERAVGYVPLDKRAYFVPGVLEGMEQLALVCIDNIESIAGDEEWEMAVFNLYNRIQETGRARLLITGDRPPRQLNLRLPDLASRLDWGQIYKLQPLSDDEKGEALQLRARLRGFELPEDVSRFLLKRLDREMRTLFMTLDQLDHASITAQRKLTIPFVKEILGL
>CP026982.1|AYH18131.1|1445996_1447286_+|uracil-permease
MTRRAIGVSERPPLLQTIPLSFQHLFAMFGATVLVPILFKINPATVLLFNGVGTLLYLFICKGKIPAYLGSSFAFISPVLLLLPLGYEVALGGFIMCGVLFCLVALIVQKAGTGWLNVLFPPAAMGAIVAVIGLELAGVAAGMAGLLPADGTSVDSTAVTISLATLAITILGSVLFRGFLAIIPILIGVLAGYALSFALGVVDLTPIREAHWFAMPTFYTPRFEWFAILTILPAALVVIAEHVGHLVVTANIVKKDLMREPGLHRSMFANGISTVLSGFFGSTPNTTYGENIGVLAITKVYSTWVIGGAAILAILLSCVGKLAAAIQAVPVPVMGGVSLLLYGVIGASGIRVLIESKVDYNKAQNLILTSVILIIGVSGAKVHLGSTELKGMALATVVGIGMSLVFKVISLFRKEEEILDAPEENDVRS
>CP026982.1|AYH18130.1|1445154_1445781_+|uracil-phosphoribosyltransferase
MKIVEVKHPLVKHKLGLMRENDISTKRFRELASEVGSLLTYEATADLATEKVTIDGWCGPVEVDQIKGKKITVVPILRAGLGMMEGVLENVPSARISVVGIYRNEETLEPVPYFQKLVSNIEERMALVVDPMLATGGSMIATIDLLKKAGCHSIKVLVLVAAPEGIAALEKAHPDIELYTASIDKGLNEQGYIMPGLGDAGDKIFGTK
>CP026982.1|AYH18129.1|1443764_1444802_-|phosphoribosylformylglycinamidine-cyclo-ligase
MTDKTSLSYKDAGVDIDAGNALVDRIKGVVKQTRRPEVMGGLGGFGALCALPQKYREPILVSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTAASVITGIAEGCKQSGCALVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVQHGDVLVALAASGPHSNGYSLVRKVLEVSKTNPEQFELEGKPLADHLLAPTKIYVKSVLSLIEKVDVHAISHLTGGGFWENIPRVLPEGMQATIDESSWQWPAVFNWLQQAGNVSRHEMYRTFNCGVGMIIALPAEQADEAVALLNSSGENAWKIGVITQTDAGDAVVIN
>CP026982.1|AYH18128.1|1443129_1443765_-|phosphoribosylglycinamide-formyltransferase
MKNIVVLISGHGSNLQALIDACKNGRLKGKIAAVFSNNAEAYGLERAQNAEIPTCVLNPEDFADRAAFDAALANEIEQYQPALVILAGYMRILSPEFVATFAGKMLNIHPSLLPKYPGLHTHRKALENGDNEHGTSVHFVTDELDGGPLILQAKVPVFTDDTEESLSERVKTHEHTIYPMVINWFLNGRLVMRDNEAWLDSVRIPPQGYAA
>CP026982.1|AYH18127.1|1440658_1442956_+|ligand-gated-channel
MVIKVKFNKYHLCACIPMLCSYENSYAKEDIPTNEDTMIVKASRDGGDAKKIKREDITSIRRTNNADVFGNETSLQINNSRNEAGAIDVGIRGLQGNGRVPIVIDGSLQSTNTWRGYQGSSDRTYIDIDLINSIDIEKGVSKGKFSGGAIGGTIRMKTLSAEDIVPAGENLGFLFKASTFNNNRIPNVSSDDGEQLSYTLSNGVKNSHFNNGSTTFGLAYIDMDFDFVFAHSDRAQGNYFAGKGGADKYKKESPISPGQEVVNTSYESHSSLLKTGFNLNPYNRVEFNFRRHEQKAGEVLAAYWYKYKKEDANGHQTERMPQWGLGSALVNTAAANYTYKPDNLFVDMDLGVWWTKGRFEQRNGISDNVHAVNAGQYLHRFSDERAGFNLANTSSLPTTAIDVTYGLEFMTQRIVPRSKRYQPVWQPGGIIQGEELLPAARNSKGVSKSLFVNAEYNGDVISILTGWRGHDFEANDLNEHKKINYSAKNDFFGTLTYHLSRNIDIYTKYSDAYRNPSLFESSSSGQTFSYSPKFPLKSEHAKSLELGVEIKKKNLLVTEDSASLRMAYFNNNIKDYLSQGVNPNKETDTESYIIMKNYDSFKLSGYEIEASYDSKYVFGRIDTTLYNATELCSRHEMTLNELSSPCNSVGFNWSLSPSRIPPKKNLSTSVGIKLFDQRLQLGTRIRYNSGKEYPTSWLQGTAATPVERQYASTTIDLFGKYNVEKNINVYFNIDNLTNRYAFDPGTVIYMPIPGRTFRLGVEAKF
>CP026982.1|AYH18136.1|1451636_1452515_+|4-hydroxy-tetrahydrodipicolinate-synthase
MFTGSIVALVTPMDAKGAVDRASLKKLIDYHVASGTSAIVSVGTTGESATLSHDEHGDVVLLTLELSDGRIPVIAGTGANATAEGVSLTKRFHGTGVVGCLTVTPYYNKPTQEGLFQHFKAIAEHTDLPQILYNVPSRTGCDMLPETVARLSEVKNIVAIKEATGNLSRVSQIQELVSEDFILLSGDDASGLDFMQLGGKGVISVTANIAAREMAELCKLAAQGNFAEARRLNQRLMPLHQKLFVEPNPIPVKWACKELGLIATDTLRLPMTPLTDSGRAVMGQALKQAGLL
>CP026982.1|AYH18137.1|1452531_1453569_+|outer-membrane-protein-assembly-factor-BamC
MRYSLQKSMVAKVVGLSLVMLLAACSSDQRYKRQVSGDESYLKAPEHHALNTPAGMILPLQNGAYEIPPVTLNGAVGKALDIRPPVQPLALLNGSRTQVSGDTATLLLENSAQNSQLWSQVIRVLQDKAFTIASRQDASQTLTTDWITWPREDEDVPYQGRYQISVQQQGYQVALIVKLLGLQLNGQPVTAGDQAQRYASLMLNALANGLDSQATARENALANRTIGSLDVQSGADDTGLPLLVVRGSYTVVWDRLPVALDKIGMKVNDRSRPQGSVSVTYRAPSGGTWDDLGAKNPELPNGDYKLQVGDLDNRSSLQFIDSKGHTLTQSQNDALVAVFQAAFGK
>CP026982.1|AYH18138.1|1453711_1454425_+|phosphoribosylaminoimidazolesuccinocarboxamide-synthase
MQKLAELYRGKAKTVYTTEDPDLLVLEFRNDTSAGDGARIEQFDRKGMVNNKFNHFIMSKLEEAGIPTQMVSLLSDNEVLVKKLEMVPVECVVRNRAAGSLVKRLGIEEGIALNPPLFDLFLKNDAMHDPMVNESYCKTFGWVSEENLARMKELSYKANDVLSKLFGDAGLILVDFKLEFGLFKGEVVLGDEFSPDGSRLWDKETLNKMDKDRFRQSLGGLIEAYEEVAHRIGVKLD
>CP026982.1|AYH18139.1|1454626_1455079_+|DUF441-domain-containing-protein
MAYFDPTLLILLVLAGLGIISHNMTVTLAILVLLAIRITPLNSYFPWVEKYGLSIGIVVLTIGVMAPIASGKITASEVMHSFLHWKSLLAILIGVVVSWLGGRGVSLMSSQPSVVAGLLVGTVMGVALFRGVPVGPLIAAGLLSLLIGKT
>CP026982.1|AYH18140.1|1455096_1457160_+|tRNA(Met)-cytidine-acetyltransferase
MMLRDFLHCQHQQQRYGIRRLLVLSGEPNWCEAQALALSCQSTGDWLWVSEDAPGSVTSLSTSRVRTLLGREFLHAVFDARKGVDVEALAMLSGTLQAGSWLIMLVPSWPSWPTLPDEDSLRWSEQQQPIATPHFIQHFQCQLLADKDVVLWQQGTELAIRSLAERPDWQPAHGEPTVRQQHILHELSAAESGIFVITAPRGRGKSTLAGMLTQRSRGTCWITAPSRVATDILQQHARADAQFWAPDSLLAHCRLHGVPDIDWLLIDEAAAIPSAVLAALLPYFSRILMTTTVQGYEGTGRGFLLKFCAVLPQWRAFTLDDPLRWAVNDPLERVLDQALLFNEPTSFHSPLSPVVGSLVLPSVELDIRTERAADWLTHPERLTWCYALLCSAHYRTSPLDLRRLMDAPGMHIASAQVAGEMCGVLWLVEEGGLSASLAHEVWAGRRRPRGNLVAQSLAAHAGLWNAPTLRSRRISRIAVTSSSRRQGIGRALTAEQTREAQKQGMDYLSVSFGYQPELWAFWQSCGFQLVRIGSHLEASSGCYSAMAILPLSDAGHKLMAQGSQQLARDWYWLQRMIPLNLALPQTENTALDTESITLHDDDWRELAGFAFAHRPMEASFAAICRLLVHTSLPLPALRLLAEKPGDGEQMSTMLGLTGKKALLKRWREETASALIDLDVQRCERWRQ
>CP026982.1|AYH18141.1|1457654_1457882_+|DUF1272-domain-containing-protein
MLELRPNCEHCDCDLPPDAETYICSYECTFCPDCADSVFHHVCPNCGGGLVKRPVRPARCLVNDPASTIRIIKPH
>CP026982.1|AYH18142.1|1458046_1458664_+|esterase
MNQDYIVVQQPSEVNRLILLFHGVGDTAAGMAQIGRYFAAALPQAMVVSIGGPFSTGYGDGRQWFSVQGVTEDNRLSRIEANLPRFIETVRDWQEQTGISAEQTVLVGFSQGSIMSLEALKSEASLAGHIIAFSGRFAVLPETAFADVVVHLIHGEADGVIVVGHAHAASRRFQELGTLFTLDSVPGVGHGIDERMLKQALAYLK
>CP026982.1|AYH18143.1|1459001_1460672_+|HAMP-domain-containing-protein
MFKRIKVITILVILLFVLGVSQFLTGALSVRALMNDKDSFLVSQRSNQNVAAFTDAWIMMNQTRIAIGSIIQNMMMGNADKEAMQALLQQAKSQLVASESSYKYYLSLPNTPGLDESLSKKLEESYTAYDKLLNDIVDSLSGGLAGAAMKLSSGATPFNVAMQDAYITWRAAQNQLSDDGLQENHVAFETMLWLLGALSVVVVLVIILSWIGLQRILLHPLRTLMRHISAIAEGNLTLHIDASGRNEMSQLAAGLHHMQQSLTRTVSLVRDSSHSIHSGASEISAGSHDLSSRTEQQAASLQETAASMEQLTSTVRQNSDNARQATLLAKSASETANKGGVVVNNVVKTMDEISDSSRKIAHITSVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLAQRSAQAAKEIKVLIDDSVSRSNTGSLQVKDAGETMKEIVSAVSRVTDIMGEIASASDEQSRGIDQVGQAVNEMDRVTQQNASLVEESASAAAALEEQARFLQNAVEVFKINQSAAQEPRVASAPSPAALPKSLLPKPTSAGSSNANWETF
>CP026982.1|AYH18144.1|1460907_1462086_-|acetyl-CoA-C-acetyltransferase
MNDSIVIVNAKRTAIGKFAGSLANTSAIEMASATIRDCLSTLPDTLAIDEVILGNVLQAGLGQNPAHQASQAAGLSFETPSLTISKVCGSGLKAVVLGAQSILSGDNQVCVTGGMENMSAAPYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDRVALASQQKAVAAIEAGRFKVEITPLSLRSKKETRIFDRDEFPRADTTLASLTALRPAFSANGTVTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKALIKAGLTIGDIDLIEANEAFAAQFLAVQRDLQLDPEKVNVNGGAIALGHPIGASGARILVTLVHALHSYNKTLGLATLCIGGGQGIAMIVERV
>CP026982.1|AYH18145.1|1462097_1462745_-|CoA-transferase-subunit-B
MDAKELIARRVALELKNGDVVNLGIGLPTKVANYVPHGIEVTFQSENGFLGLGAVTEPDGNLVNAGGQACGMVPGAAMFDSAFSFALIRGGHVDVCVLGGLQVDEHGSLANWMVPGKMVPGMGGAMDLVVGAKKVIIALEHCAKNGDAKLLHQCTYPLTAANKVSMVVTELAVFQFIDRQMVLTEISPDITVDELRQKTEANFIVSADVKPFSIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_5

3572902-3573005

Orphan

Consensus_repeat	Method
AACGTCGCTTGCGACGGCCCGCAGGGTGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026982_5

>merge|CP026982|5|3572902-3573005|CRISPRCasFinder
AACGTCGCTTGCGACGGCCCGCAGGGTGGCTGCCAGAGATGGAACGCCATAAAAAAACGTGGGGAACGTTTTTCAACGTCGCTTGCGACGGCCCTCAGGGTGGC

>CP026982|5|5|3572902-3573005|CRISPRCasFinder
AACGTCGCTTGCGACGGCCCGCAGGGTGGC	TGCCAGAGATGGAACGCCATAAAAAAACGTGGGGAACGTTTTTC
AACGTCGCTTGCGACGGCCCTCAGGGTGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH19994.1\|3578169_3579276_+\|pectinesterase-A	unknown	unknown	gnl\|CDD\|227022
CP026982.1\|AYH19987.1\|3568494_3569622_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238559
CP026982.1\|AYH19992.1\|3574707_3575898_+\|NO-inducible-flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
CP026982.1\|AYH19991.1\|3573093_3574347_-\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234571
CP026982.1\|AYH19981.1\|3561937_3562741_+\|inositol-1-monophosphatase	unknown	unknown	gnl\|CDD\|236753
CP026982.1\|AYH19998.1\|3582221_3583673_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
CP026982.1\|AYH19997.1\|3581364_3582201_-\|two-component-system-QseEF-associated-lipoprotein-QseG	unknown	unknown	gnl\|CDD\|236745
CP026982.1\|AYH19999.1\|3584377_3588265_-\|phosphoribosylformylglycinamidine-synthase	unknown	unknown	gnl\|CDD\|235394
CP026982.1\|AYH19989.1\|3570805_3571465_-\|DUF1007-domain-containing-protein	unknown	unknown	gnl\|CDD\|368801
CP026982.1\|AYH19982.1\|3562933_3564052_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238559
CP026982.1\|AYH19983.1\|3564058_3565141_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223682
CP026982.1\|AYH19995.1\|3579403_3579742_-\|nitrogen-regulatory-protein-P-II	unknown	unknown	gnl\|CDD\|182784
CP026982.1\|AYH19990.1\|3571496_3572657_-\|3-phenylpropionate-MFS-transporter	unknown	unknown	gnl\|CDD\|236856
CP026982.1\|AYH20000.1\|3588481_3589990_+\|membrane-bound-lytic-murein-transglycosylase-MltF	unknown	unknown	gnl\|CDD\|236778
CP026982.1\|AYH19996.1\|3580030_3581368_-\|two-component-system-response-regulator-GlrR	unknown	unknown	gnl\|CDD\|185070
CP026982.1\|AYH19985.1\|3565994_3566318_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH19986.1\|3566405_3568073_-\|methyl-accepting-chemotaxis-protein-I	unknown	unknown	gnl\|CDD\|185001
CP026982.1\|AYH19993.1\|3576409_3578068_+\|pectin-acetylesterase	unknown	unknown	gnl\|CDD\|238859
CP026982.1\|AYH19988.1\|3569741_3570815_-\|nickel-transporter	unknown	unknown	gnl\|CDD\|225125
CP026982.1\|AYH19984.1\|3565137_3565938_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH19994.1\|3578169_3579276_+\|pectinesterase-A	gnl\|CDD\|227022	COG4677, PemB, Pectin methylesterase [Carbohydrate transport and metabolism].	1.67067e-78
CP026982.1\|AYH19987.1\|3568494_3569622_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238559	cd01139, TroA_f, Periplasmic binding protein TroA_f. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	4.2494e-154
CP026982.1\|AYH19992.1\|3574707_3575898_+\|NO-inducible-flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	0
CP026982.1\|AYH19991.1\|3573093_3574347_-\|serine-hydroxymethyltransferase	gnl\|CDD\|234571	PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.	0
CP026982.1\|AYH19981.1\|3561937_3562741_+\|inositol-1-monophosphatase	gnl\|CDD\|236753	PRK10757, PRK10757, inositol-1-monophosphatase.	0
CP026982.1\|AYH19998.1\|3582221_3583673_-\|sensor-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.19662e-46
CP026982.1\|AYH19997.1\|3581364_3582201_-\|two-component-system-QseEF-associated-lipoprotein-QseG	gnl\|CDD\|236745	PRK10722, PRK10722, two-component system QseEF-associated lipoprotein QseG.	7.99272e-122
CP026982.1\|AYH19999.1\|3584377_3588265_-\|phosphoribosylformylglycinamidine-synthase	gnl\|CDD\|235394	PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional.	0
CP026982.1\|AYH19989.1\|3570805_3571465_-\|DUF1007-domain-containing-protein	gnl\|CDD\|368801	pfam06226, DUF1007, Protein of unknown function (DUF1007). Family of conserved bacterial proteins with unknown function.	2.18516e-89
CP026982.1\|AYH19982.1\|3562933_3564052_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238559	cd01139, TroA_f, Periplasmic binding protein TroA_f. These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	5.48081e-102
CP026982.1\|AYH19983.1\|3564058_3565141_+\|iron-ABC-transporter-permease	gnl\|CDD\|223682	COG0609, FepD, ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism].	2.09771e-76
CP026982.1\|AYH19995.1\|3579403_3579742_-\|nitrogen-regulatory-protein-P-II	gnl\|CDD\|182784	PRK10858, PRK10858, nitrogen regulatory protein P-II.	4.41835e-62
CP026982.1\|AYH19990.1\|3571496_3572657_-\|3-phenylpropionate-MFS-transporter	gnl\|CDD\|236856	PRK11128, PRK11128, 3-phenylpropionate MFS transporter.	0
CP026982.1\|AYH20000.1\|3588481_3589990_+\|membrane-bound-lytic-murein-transglycosylase-MltF	gnl\|CDD\|236778	PRK10859, PRK10859, membrane-bound lytic murein transglycosylase MltF.	0
CP026982.1\|AYH19996.1\|3580030_3581368_-\|two-component-system-response-regulator-GlrR	gnl\|CDD\|185070	PRK15115, PRK15115, response regulator GlrR; Provisional.	0
CP026982.1\|AYH19986.1\|3566405_3568073_-\|methyl-accepting-chemotaxis-protein-I	gnl\|CDD\|185001	PRK15041, PRK15041, methyl-accepting chemotaxis protein.	5.59344e-87
CP026982.1\|AYH19993.1\|3576409_3578068_+\|pectin-acetylesterase	gnl\|CDD\|238859	cd01821, Rhamnogalacturan_acetylesterase_like, Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.	1.87026e-60
CP026982.1\|AYH19988.1\|3569741_3570815_-\|nickel-transporter	gnl\|CDD\|225125	COG2215, COG2215, ABC-type uncharacterized transport system, permease component [General function prediction only].	1.67234e-80
CP026982.1\|AYH19984.1\|3565137_3565938_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.94609e-88

>CP026982.1|AYH19990.1|3571496_3572657_-|3-phenylpropionate-MFS-transporter
MVLQSTRWLALSYFTYFFCYGIFLPFWGGWLKGEGLSAESIGMLLGAGLVARFVGSLVITPSVKDPSKLITVLRGLALLSLALAVGFWLGNAWLWLMIVMIGFNLFFAPLVPLTDALAATWQKQVAMDYGKVRVWGSIAFVIASAVTGELVAIWGHSAILAILSAGLITMLLGMLFRPSVMPQTAASTAQSASVTPWKKLLSEPAVWRFLLCVSLLQGAHAAYYGFSVIYWQDSGYSASIIGYLWSLGVVAEIVIFTFSQRLFRRWSARQLLLLSAVCGVVRWGLMGATVALPWLIVIQILHCGTFTVCHLAAMRFIAARSGGGDVLRLQAVYSALAMGGSIAVMTMVSGFLFDHLQGGTFWVMALLAVPALFIRPSVSHHTVAKT
>CP026982.1|AYH19989.1|3570805_3571465_-|DUF1007-domain-containing-protein
MLHYNALKRRVGRITLLMTGLALCQPVFAHPHSFIDMQTTVESQNDNITGLRMQWTMDPITSADLLYDAGKATKDSEVWKKLAAEVMANVLGQHYFTDIYRDNQPVKYARLPTEYHLSRKGNQAVLEFVLPLSHPQPLAGKPLLISTYDPTYFVDMSYQDDKAVKLAPELVSRCKTTLVTPKPNAELQSYALSLDKNDAPDEDMDLGKQFAQRVTLQCQ
>CP026982.1|AYH19988.1|3569741_3570815_-|nickel-transporter
MSVNLGSLSRQRPLLSRLRDLWPLWLFLALLAAALYYIVGYWPQIVLQSAIWQKSLHQQMSHLLQMVEQQPRQAGLSLMMFSLVYGVLHAVGPGHGKVVIMTYLATHPSKLKSSLKLTLAASLVQGLMAVVLVTVVLGILQLSSRTLHNSSFWMEKGSFVLVAGLGLLLCFRALKQLYIALVWQPKPATILRMTPLNVSVHGRMTLSPISAPSHSLHQHDADCGCGHRHLPSQEELERDSRWRTRLMIVLAMGMRPCSGAILVLLFSKVIGVYVWGVASALVMAAGTAITISALAVLVFYCRRAVERLGANRASPVWQRTTFSLLAFAGGLILVGSGILLYLSAQPAMMGGIRPFSG
>CP026982.1|AYH19987.1|3568494_3569622_-|ABC-transporter-substrate-binding-protein
MKKWLFSVVMLLGLSASVAASANPIVIEDVSGRKVEIKSEVKRIILGEGRQIYLLAAFDTESPFQRVVGWRDDLPKADYDGYLAYEKKYPEITKLPTFGGAKDGTFNVEQALTLKPDLVLMNLESKAATDEGKLIEKLSSLGIPVVFIDFREKPFENAEKSIHIMGQLVGKPQRAEEIIKFRREQIEIVTDRLKNYQGPRPKVMIDRAGGYDEECCMSFGDENFGRMVEAAGGDNIAKNIIPGTFGTLNPEQIISSRPDVVVVTGANWKNYNTANGWVGVGPGADQKEALQRLQKLMERSAFKTLPVATDGNAHAIWHQFYDSPYQFVAIQVLAKWMHPELFKDLDPDATFRTFHEKFLPLPYQPGYWVTLPAKK
>CP026982.1|AYH19986.1|3566405_3568073_-|methyl-accepting-chemotaxis-protein-I
MNITQRLLLTFSLMSLALIALVIVTLSLLSGFQSRFEYVQDNAIPSIKDLNSLVDKSNSLVLFLYRHQTTDDDRKLPAIEQDINRTIEEIKKLNEYYLINDASSEADRQLTNTAIDQTQKLQASLPVFINASKANQNDIALGLLQGMDGPGKAVRDLLANYRKQFDLNVKMGDDLRQVNKQVYDQTWFGLLSGTLLVVLLIGFFAVRTILGIRKSLNNMNQTMEDVSNHLDLTIQADDRRKDEVGNTARAFNSLMHRVSAALASVNASSQSVSSAATQIAAGNEDLSARTEEQAASLEQTAASMTEISETVRQNAENTQQASLLAGNASRISVNSADSVSTMLSTMEHIRTSSGKITDIIALIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRTLAQRSSTAAREIKDLIGASNSLVSAGVEQASDVGKNMAAMKDAIQQVTDLVNEIAAATEEQSQGISQVHQAVNQMDDVTQQNASLVEEASAASQSLQEQASTLSQLVGQFIVGQMTPAALTPALASVPSGLSVPRLAPAKKKSAAAQDEGDWQRF
>CP026982.1|AYH19985.1|3565994_3566318_-|hypothetical-protein
MKSTEHSAENLGDYASLLAEFEHMTTLLTQLMNSDYRTLDLYLNNCRHLILRFTEIYKLIGKPEFEHYLKHHDAALYYNVNSVGLALRLFENMLTNMRDMLGTERLD
>CP026982.1|AYH19984.1|3565137_3565938_+|ABC-transporter-ATP-binding-protein
MSQQTPSGLRLSHFRAGYPKRQVIRDLSVPQLPRGKITVLLGPNGSGKSTLLRAMAGLNPSEGELWLDDTNLMTLPFAQRAEKVVYLPQSLPAGVHLHVLESIIVAQRASGGMHNAEKQDEVMTLLRQLGIEHLALSYLDQLSGGQKQLVGLAQSLIRQPSLLLLDEPLSALDLNYQFHVMDLVRKETRKRNIITVVVVHDINIALRHGDHVLMLQNGNLIADGAPAEVISPESLSAVYGVRGRIERCSQGVPQVIIDGLVSEPTI
>CP026982.1|AYH19983.1|3564058_3565141_+|iron-ABC-transporter-permease
MSTTTEPGIRNTATDANTIMDNYRGIIRRRVGVMAILLLIIIGSLLLDFTMGPSGLTLDVLWNTLTDPASADAGTRVIVWDIRLPYALMAIIVGLALGLAGAEMQTILNNPLASPFTLGVSSAAAFGAALAIVLGIGIPGIPAQWFISANAFIFALLAALLLDGITRWTQVATSGVVLFGIALVFTFNALVSMLQFIANEDTLQGLVFWTMGSLARASWEKLGILLLVLVIVMPISLMSSWKLTALRLGEDRAVSFGINVRRLRLATLLRISILSAISVAFVGPIGFIGLVAPHIARMIFGEDHRFYLPASALTGALVLSMASVASKNLIPGVIIPVGIVTSLVGVPFFLSIILRHRGNV
>CP026982.1|AYH19982.1|3562933_3564052_+|ABC-transporter-substrate-binding-protein
MLRKSVRSLFLTALLSAPLFSYATQYPLTVTDFDGRSVTIQQEPQRIILQDGRDIMAMALLDRDNPFQRLVAWNNLAKKQDTATWEMLKGKWPQSVGILDMGFSDKGNVDLESVLSKQPDLMIAQLRAKAALKESGVIDKLSTLNIPVLFVDYEVNPAKDTAPSIDLLGKVLNREANAKAYTDFYRQHFDAIQQKTTAITPKPSVFVEPIAGNSDSCCFTHSNSGWGGLIEAVGAKNIGSDLLPGATGFVSLEKIISMKPDVYIMTGSKRGNSQVLPLGYGASVEGVRTQANVLLNRTGISQIPAVQAKHVYGVYHHFYNHPYNIVGMEYLAKDIYPQAFASLDPDDTYHHIIQNFTSLPDSDFIFAWKQGE
>CP026982.1|AYH19981.1|3561937_3562741_+|inositol-1-monophosphatase
MHPMLNIAIRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDRDAERLIIEVIRKSYPQHTIIGEECGELAGEDPAVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFSATRGQGAQLNGYRLRSSTARDLDGTVLATGFPFKLKQHSKSYIDIISALFTQCADFRRTGSAALDLAYVAAGRVDGFFEIGLKPWDFAGGELLVREAGGIVTDFVGAHNYMTSGNLVAGNPRVVKAILGTIREELSDALKR
>CP026982.1|AYH19991.1|3573093_3574347_-|serine-hydroxymethyltransferase
MLKREMNIADYDADLWQAMEQEVVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKALFGADYANVQPHSGSQANFAVYTALLQPGDTILGMNLAHGGHLTHGSPVNLSGKLYNVIPYGIDESGKIDYDEMAELARTHKPKMIVGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAADVYPNPVPHAHIVTTTTHKTLAGPRGGLILAKGGDEDLYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLSRGFNVVSGATSNHLFLLDLVSKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGTPAATRRGFKEAEVRELAGWICDVLDNINDEATIERVKQKVLDICARFPVYA
>CP026982.1|AYH19992.1|3574707_3575898_+|NO-inducible-flavohemoprotein
MLDNHTIAIVKSTIPLLAETGPKLTAHFYDRMFTHNPELKDIFNMSNQRNGDQREALFNAICAYATNIENLAALLPAVERIAQKHASFNIQADQYQIVGSHLLATLDEMFSPGQEVLDAWGKAYGVLANVFIQRENDIYRSTETKNGGWSGVRAFRIVNKQPQSSVITSFTLEPTDGQPIADFQPGQYLAVYIKHDSFANQEIRQYSLTHAPNGQSYRIAVKREAQGTVSGYLHDTAREGDIIHLAAPHGDFFLDIPATTPVALISGGVGQTPMLGMLHTLKQQSHQAKVLWLHAAENGATHAFADEIEQTGQSLPQFQNHIWYREPQQTDRPGEDYHHSGLMQLSSLQDELTTPAMHYYLCGPVVFMQFVAQQLLAIGIPAEQLHYECFGPHKVV
>CP026982.1|AYH19993.1|3576409_3578068_+|pectin-acetylesterase
MAKRFSESMALALILSAPFTCVHAKAPAAAHQTATPESAKLLSGSTLGEKTGLSGNVTVRDIHLPATIIIRDQQGQKRQTQTDEQGKYHLDVSGLTPPLRVLAIESGGNNCLLNNISRAICLSAVAPSLHDGKENIANINPLTDRITSDIAVAAGYIGPQQLTDDTASPKLDAAAWKTAYADFHAGFNGALKQAGISVPARFDPLTYPASQQEAVTKIVNVINHNRNYHNNTGYSGHTVLTDSAFHPIVGLNDKGDYEPLDYRSARQSLDAIQKAQTRIFLVGDSTAATYEKMRFPRMGWGQVFEQQFSKNSSVKVVNGTRAGRSSRDYFYEGWFRQMQPLMKEGDFLFIQMGHNDQNCNGAKEIRGPADVANLCTYPNDAAGKKQAPQGKADMSFQTSLERYITFARQHKLTPVLLTPTTRVKTAEGKNGTPAVHSHFTKQNADNGYAFVGDYSQTIKDTAANNKVVLLDIEPATIALANQGNSEHWKQYWLVIDPKKYPYYRDQAGSLSKPDTTHFQKKGAIAVAEIVANAIRQEPALASLAEKTVSKHK
>CP026982.1|AYH19994.1|3578169_3579276_+|pectinesterase-A
MINASHFGKTLTLAMLISSPWTLAQAADYNALVSTNATDAKAYKTITEAIASAPADSSPFVIYVKNGVYHERLTITRPNIHLQGESRDGTVIAATTAAGMLKPDGSKWGTYGSNTVKVDAPDFSARSLTISNDFDYPANQAKASDDPTKLKDSQAVALLVAENSDRAWFHDVSLTGYQDTLYVKGGRSFFSKCRISGTVDFIFGNGTALFDDCDIVARNRTDVKDQPLGYLTAPSTDIKQKYGLVIINSRVIKEKDVPAKSYGLGRPWHPTTTFEDGRYADPNAIGQTVILNTSMDNHIYGWDKMSGKDKQGEKIWFHPQDSRFFEYKSSGTGAEKNEQRRQLSEAEAAEYTTDKVLAGWVPTAPKGK
>CP026982.1|AYH19995.1|3579403_3579742_-|nitrogen-regulatory-protein-P-II
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVSDDIVDTCVETITQTAQTGKIGDGKIFVFDVARVVRIRTGEEDEEAI
>CP026982.1|AYH19996.1|3580030_3581368_-|two-component-system-response-regulator-GlrR
MTARKTASLLLVDDDPSLLKLLGMRLTSEGFSVMTAESGQEALRLLTRETFDLVISDLRMDEMDGMALFSEIQRYQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDRDALYKAIDDAMALSAPAGDESWRETIVTRSPIMLRLLEQARMVAQSDVSVLINGQSGTGKEVLAQAIHAASPRAKKAFIAINCGALPEPLLESELFGHAKGAFTGAVSSREGLFQAAEGGTLFLDEIGDMPLSLQVKLLRVLQERKVRPLGSNRDMDIDVRIISATHRDLPKAMEKNEFREDLYYRLNVVNMKLPALHERAEDIPLLANHLLRESANRHKPFVRTFSTDAMKRLMTASWPGNVRQLVNVIEQCVALTSAPVISDALVEQALEGENTALPTFVEARHQFELNYLRKLLQIAKGNVTQAARMAGRNRTEFYKLLGRHELDANDFKD
>CP026982.1|AYH19997.1|3581364_3582201_-|two-component-system-QseEF-associated-lipoprotein-QseG
MNVGFMKGWLANRQFSCLLKAAVLSSPLVLAACSSYVNSDSALLEIEGTPPKEQVADFRIAQCEHLWQIDDRESMNNALYWLRAMDCAGRLTQFQARDEAEQVAGDSWENAFKQGILLDNAGITQAERRQVLEQINLYRLAFPAALRPLMQTWRDRQTLFLALSDERLRYKRLQESSDKQLDALRVQQNHLQYQLETTTQKLENLTDIERQLSSRKQLSGEMPDNDADHRGSAGANKDGSRNSATKPRNEPVDADDTYTPPMESHTDKSTTKKEPARQ
>CP026982.1|AYH19998.1|3582221_3583673_-|sensor-histidine-kinase
MISLKRWRLFPRSLRQLVIMAFLLVLLPLLVLAYQAYQSLNMLSEQAADINRTTLADARRSEAMTSVALAMERSYRQYCVLDDQTLATLYQNQRKQYSQMLDSHARVLPDPRYYQTLRQLLTQLGEIRCHNSGPEQTASSLLEGFSRANGQMVQVTRDVVFSRGQQLQQAISERGQFFGWQALLLFLVSVLLVVLFTRMIIGPVNGVERMINRLGEGRSLGNTSTFKGPREIRTLAQRIIWLSERLSWLESQRHEFLRHISHELKTPLASLREGTELLADEVVGPLTADQKEVVEILDSSSRHLLQLIDQLLDYNRKLADTPTELERVETEEIVDIVVSSHSLPARAKMIHTDVVLAVGHCWAETTLLMRVIDNLYSNAVHYGKESGNIWIYSRQIGNRVQIDVANSGTPIPDAERSMIFEPFYQGSHQRRGAVKGSGLGLSIARDCIRRMRGELSLITVDYADVCFRIELPLLSDNEQSENE
>CP026982.1|AYH19999.1|3584377_3588265_-|phosphoribosylformylglycinamidine-synthase
MEILRGSPALSAFRINKLLVRCKEHVLPVSDIYAEYVHFADVSAPLNNDEQAKLTRLLKYGPSLAEHEPQGRLLLVTPRPGTISPWSSKATDIAHNCGLSNVLRLERGLAFYIHAPMLSDEQWQQLGALLHDRMMESVFSDLQQAEALFSHHQPAPFKRIEILLQGRQALEEANVRLGLALAEDEIDYLLEAFNNLGRNPTDIELYMFAQANSEHCRHKIFNADWVIDGVTQPKSLFKMIKNTFEHTPDHVLSAYKDNASVMEGSAVGRFYTDTNGQYAYHQEDAHILMKVETHNHPTAISPWPGAATGSGGEIRDEGATGRGSKPKAGLVGFSVSNLRIPGFIQPWEEEEFGKPDRIVSALDIMTEGPLGGAAFNNEFGRPALTGYFRTYEERVDSHNGAELRGYHKPIMLAGGIGNIRADHVKKGEISVGAKLIVLGGPSMNIGLGGGAASSMASGQSDADLDFASVQRDNPEMERRCQEVIDRCWQLGEANPILFIHDVGAGGLSNAMPELVSDGGRGGRFELRDILNDEPGMSPLEVWCNESQERYVLAVAPEQLAQFDEICRRERAPYAVIGEATEELHLTMNDRHFNNKPIDLPLDVLLGKTPKMLRDVERKQVEGTPLQRDDIYLAEAVERVLHLPVVAEKTFLITIGDRSVTGMVARDQMVGPWQVPVADCAVTTASLDSYYGEAMSIGERAPVALRNFAASARLAVGEALTNIAATHIGPLTRVKLSANWMAAAGHPGEDAGLYDAVKAVGEELCPALGLTIPVGKDSMSMKTRWQEDGEDRAVTSPMSLVISAFARVEDVRNTVTPQLRTGQDNALLLIDLGAGNKALGATALAQVYRQLGRKTADVRSPEQLAGFFNAIQELVAAKVLLAYHDRSDGGLLVTLAEMAFAGHCGVTVDIASQGEDTLATLFNEELGAVIQIPTARRAEVEAILALHGLAECVHYLGQAEEGTRFTINQGAEAVYQENRSTLRRWWAETSWQMQRLRDNPQCADQEHIARQDDNDPGLNVSLTFDPKEDIAAPYIAKHVRPKVAVLREQGVNSHVEMAAAFHRAGFDAIDIHMSDLLANRRNLQDFQALVACGGFSYGDVLGAGEGWAKSILFNSRVRDEFAEFFLRPQTLALGVCNGCQMMSNLRELIPGADLWPRFVRNKSDRFEARFSLVEVEKSPSLFMNDMAGSRMPIAVSHGEGQVEVRDDTHLAAIEEHGLVALRYINHYGQVTENYPANPNGSPNGITAVTSTSGRATVMMPHPERVFRTVSNSWHPEEWGEDGPWMRMFRNARRQLG
>CP026982.1|AYH20000.1|3588481_3589990_+|membrane-bound-lytic-murein-transglycosylase-MltF
MTYKKTAVTDSLATRPPRDNYLKPLKLNYFFIGIITLLLALALWPSIPWRSSQDVQLRQILSRGELRISTVNSPLTYAMSNGSPTGLDYELAKRFADYLGVKLVVSSRKNLDELFDDLDGDDADLLAAGLIYNHERLERFRAGPTYYSISQQMVYRLGSPRPKTLDKLQGRLVVTSGSAHAATLRDLKAEKYPQLSWESASDQSTQELLKQVADGKLDYALGDSVTIGLMQRIHPQLAVAFDLSDEEPVTWYMRRSHDDSLSAALLDFFSKIVEDGTLARLEEKYLGHVGEFDYVDTTTFLGAIDETLPDLRPLFEKYAINIDWKLLAAISYQESHWNPLATSPTGVRGLMMLTRNTAESLNVTDRIDPEQSIRGGAQYMSYMMQKMPDTIPEDEKIWFALASYNMGYAHLLDARKLTEKQKGNPDSWVDVKMRLPMLSQKRYYTQTTYGYARGQEAYNYVENIRRYMVSLEGYLIEKETKAQQQTQIAQSYPAVPLNKVPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_6

4150126-4150245

Orphan

Consensus_repeat	Method
TTTTTCAACGTTGCGCAGCAACGGCCCGAAGGGTGATGGACAAGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026982_6

>merge|CP026982|6|4150126-4150245|CRISPRCasFinder
TTTTTCAACGTTGCGCAGCAACGGCCCGAAGGGTGATGGACAAGGACGTCCGTCATAAAAAAACGTTGGGAGCGTTTTTCAACGTTGCGTAGCAACGGCCCGAAGGGTGATGGACAAGGA

>CP026982|6|6|4150126-4150245|CRISPRCasFinder
TTTTTCAACGTTGCGCAGCAACGGCCCGAAGGGTGATGGACAAGGA	CGTCCGTCATAAAAAAACGTTGGGAGCG
TTTTTCAACGTTGCGTAGCAACGGCCCGAAGGGTGATGGACAAGGA

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH20441.1\|4143227_4143716_-\|ATP-independent-periplasmic-protein-refolding-chaperone	unknown	unknown	gnl\|CDD\|182473
CP026982.1\|AYH20452.1\|4155542_4156952_-\|glucuronate-isomerase	unknown	unknown	gnl\|CDD\|376859
CP026982.1\|AYH20449.1\|4151740_4152271_-\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
CP026982.1\|AYH20442.1\|4143903_4144200_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH20456.1\|4160829_4161225_+\|modulator-protein	unknown	unknown	gnl\|CDD\|236728
CP026982.1\|AYH20445.1\|4147790_4148789_+\|gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
CP026982.1\|AYH21390.1\|4139300_4141262_-\|PTS-beta-glucoside-transporter-subunit-EIIBCA	unknown	unknown	gnl\|CDD\|273919
CP026982.1\|AYH20451.1\|4153870_4155337_-\|tagaturonate-reductase	unknown	unknown	gnl\|CDD\|235147
CP026982.1\|AYH20440.1\|4141556_4143026_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
CP026982.1\|AYH20448.1\|4150410_4151658_+\|serine/threonine-transporter-SstT	unknown	unknown	gnl\|CDD\|184190
CP026982.1\|AYH20450.1\|4152360_4153851_-\|altronate-dehydratase	unknown	unknown	gnl\|CDD\|377287
CP026982.1\|AYH20439.1\|4138408_4139245_-\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|170086
CP026982.1\|AYH20443.1\|4144415_4146473_+\|NADPH-dependent-2,4-dienoyl-CoA-reductase	unknown	unknown	gnl\|CDD\|239240
CP026982.1\|AYH20453.1\|4157372_4158674_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|273326
CP026982.1\|AYH20444.1\|4146489_4147629_-\|23S-rRNA-(guanine(1835)-N(2))-methyltransferase-RlmG	unknown	unknown	gnl\|CDD\|184963
CP026982.1\|AYH20447.1\|4149168_4150122_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|274743
CP026982.1\|AYH20457.1\|4161501_4161807_+\|DUF883-domain-containing-protein	unknown	unknown	gnl\|CDD\|226941
CP026982.1\|AYH20455.1\|4160143_4160827_+\|DedA-family-protein	unknown	unknown	gnl\|CDD\|223659
CP026982.1\|AYH20454.1\|4158881_4159658_+\|transcriptional-regulator-ExuR	unknown	unknown	gnl\|CDD\|183176
CP026982.1\|AYH20446.1\|4148826_4149015_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH20441.1\|4143227_4143716_-\|ATP-independent-periplasmic-protein-refolding-chaperone	gnl\|CDD\|182473	PRK10455, PRK10455, periplasmic protein; Reviewed.	1.87458e-71
CP026982.1\|AYH20452.1\|4155542_4156952_-\|glucuronate-isomerase	gnl\|CDD\|376859	pfam02614, UxaC, Glucuronate isomerase. This is a family of Glucuronate isomerases also known as D-glucuronate isomerase, uronic isomerase, uronate isomerase, or uronic acid isomerase, EC:5.3.1.12. This enzyme catalyzes the reactions: D-glucuronate <=> D-fructuronate and D-galacturonate <=> D-tagaturonate. It is not however clear where the experimental evidence for this functional assignment came from and thus this family has no literature reference.	0
CP026982.1\|AYH20449.1\|4151740_4152271_-\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	2.08231e-53
CP026982.1\|AYH20456.1\|4160829_4161225_+\|modulator-protein	gnl\|CDD\|236728	PRK10629, PRK10629, EnvZ/OmpR regulon moderator MzrA.	1.18745e-47
CP026982.1\|AYH20445.1\|4147790_4148789_+\|gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	3.0948e-57
CP026982.1\|AYH21390.1\|4139300_4141262_-\|PTS-beta-glucoside-transporter-subunit-EIIBCA	gnl\|CDD\|273919	TIGR01995, beta-glucosides_PTS_EIIBCA, PTS system, beta-glucoside-specific IIABC component. This model represents a family of PTS enzyme II proteins in which all three domains are found in the same polypeptide chain and which appear to have a broad specificity for beta-glucosides including salicin (beta-D-glucose-1-salicylate) and arbutin (Hydroquinone-O-beta-D-glucopyranoside). These are distinct from the closely related sucrose-specific and trehalose-specific PTS transporters.	0
CP026982.1\|AYH20451.1\|4153870_4155337_-\|tagaturonate-reductase	gnl\|CDD\|235147	PRK03643, PRK03643, tagaturonate reductase.	0
CP026982.1\|AYH20440.1\|4141556_4143026_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	4.2621e-57
CP026982.1\|AYH20448.1\|4150410_4151658_+\|serine/threonine-transporter-SstT	gnl\|CDD\|184190	PRK13628, PRK13628, serine/threonine transporter SstT; Provisional.	0
CP026982.1\|AYH20450.1\|4152360_4153851_-\|altronate-dehydratase	gnl\|CDD\|377287	pfam04295, GD_AH_C, D-galactarate dehydratase / Altronate hydrolase, C-terminus. Family members include the C termini of D-galactarate dehydratase (EC:4.2.1.42) which is thought to catalyze the reaction D-galactarate = 5-keto-4-deoxy-D-glucarate + H2O, and altronate hydrolase (altronic acid hydratase, EC:4.2.1.7), which catalyzes D-altronate = 2-keto-2-deoxygluconate + H2O. As purified, both enzymes are catalytically inactive in the absence of added Fe2+, Mn2+, and beta-mercaptoethanol. Synergistic activation of altronate hydrolase activity is seen in the presence of both iron and manganese ions, suggesting that the enzyme may have two ion binding sites. Mn2+ appears to be part of the enzyme active centre, but the function of the single bound Fe2+ ion is unknown. The hydratase has no Fe-S core.	0
CP026982.1\|AYH20439.1\|4138408_4139245_-\|PRD-domain-containing-protein	gnl\|CDD\|170086	PRK09772, PRK09772, transcriptional antiterminator BglG; Provisional.	4.84252e-74
CP026982.1\|AYH20443.1\|4144415_4146473_+\|NADPH-dependent-2,4-dienoyl-CoA-reductase	gnl\|CDD\|239240	cd02930, DCR_FMN, 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain. DCR in E. coli is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provides a hydrid ion to the C5 atom of substrate, and Tyr and His are proposed to form a catalytic dyad that protonates the C4 atom of the substrate and completes the reaction.	0
CP026982.1\|AYH20453.1\|4157372_4158674_+\|MFS-transporter	gnl\|CDD\|273326	TIGR00893, Probable_glucarate_transporter, D-galactonate transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	1.28836e-119
CP026982.1\|AYH20444.1\|4146489_4147629_-\|23S-rRNA-(guanine(1835)-N(2))-methyltransferase-RlmG	gnl\|CDD\|184963	PRK15001, PRK15001, 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG.	0
CP026982.1\|AYH20447.1\|4149168_4150122_+\|TerC-family-protein	gnl\|CDD\|274743	TIGR03718, R_switched_Alx, integral membrane protein, TerC family. Rfam model RF00080 describes a structured RNA element called the yybP-ykoY leader, or SraF, which may precede one or several genes in a genome. Members of this highly hydrophobic protein family often are preceded by a yybP-ykoY leader, which may serve as a riboswitch. From the larger group of TerC homologs (pfam03741), this subfamily contains TerC itself from Alcaligenes sp. plasmid IncHI2 pMER610 and from Proteus mirabilis. It also contains the alkaline-inducible E. coli protein Alx, which unlike the two TerC examples is preceded by a yybP-ykoY leader.	1.23559e-141
CP026982.1\|AYH20457.1\|4161501_4161807_+\|DUF883-domain-containing-protein	gnl\|CDD\|226941	COG4575, ElaB, Uncharacterized conserved protein [Function unknown].	9.5444e-37
CP026982.1\|AYH20455.1\|4160143_4160827_+\|DedA-family-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.11554e-46
CP026982.1\|AYH20454.1\|4158881_4159658_+\|transcriptional-regulator-ExuR	gnl\|CDD\|183176	PRK11523, PRK11523, transcriptional regulator ExuR.	0

>CP026982.1|AYH20447.1|4149168_4150122_+|TerC-family-protein
MHTIGTPWLWGSFAAIVIVMLAIDLLYQGRKGSTVMTFKQAAVWSVIWVTLSLLFNAGFWWYLDGTLGRDVANAQSLAFLTGYLIEKALAVDNVFVWLMLFGYFAVPAQYQRRVLIYGVLGAIVLRTLMVFGGSWLVTQFQWLLYVFGAFLLFTGIKMALAKDGDGAIGDKPLVRWLRSHLRMTDSIENERFFVRRNGLLYATPLFLVLIMVEISDVIFAVDSIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAERFSLLKYGLAVILIFIGIKMLLIDIFHIPVAISLGVVASILVITMLINIWVNKRAER
>CP026982.1|AYH20446.1|4148826_4149015_-|hypothetical-protein
MTLHLSHSRCVGCSYSPESLTYVSSSGLARLPPSCNVKSIGYISIVMTISWRKSYSPLPDRR
>CP026982.1|AYH20445.1|4147790_4148789_+|gfo/Idh/MocA-family-oxidoreductase
MIRFAIVGTSWITRQFVDAAHETGQLKLAAIYSRTAEKAQPFQTDYMVDTLFDSLEAMAKSDLIDAVYLASPNSLHCEQALLFLSHGKHVICEKPLASNRYEVEQMIACARENQVVLFEAFKTASLPNFSVIQQSLPKVGRLRKVVLNYCQYSSRYPRYLAGENPNTFNPAFSNGSIMDIGYYCLAFAVALWGEPCTTQASATLLESGVDAHGSIILNYGDFDVAIIHSKVSHSAIPSEIQGEDGSLVIEKVSECHNVKFIPREGKQLDLSQPQHINSMLYEAEVFAALVNDNDINHAELARSRTVAGLLTEIRRQTGVVFPADAATPGNAE
>CP026982.1|AYH20444.1|4146489_4147629_-|23S-rRNA-(guanine(1835)-N(2))-methyltransferase-RlmG
MSQLELETCNLTLVRYPQVAENSALQAWDAADEYLLRELASMEIAPGPRLIFNDTFGALACGLQAQSPVSISDSYLSQLATRHNLELNGYDADAVTLLDSMAELPDAPALVVMRIPKTIALLEQQLRMLRQVVTPQTRIIAGAKARDIHTSTLQLFERVMGPTKTSLAWKKARLVHCEWAELKVSEQSLTTEWELDGYGYRIQNHANVYSRNGLDIGARFFMQHLPEQIDGKIVDLGCGNGVIGLAALKANPEATVGFFDESYMAVASSQMNVEVNCPQDIERCSFVVNNGLVRVKRDTLQAVLCNPPFHQQQAVTDEIAWQMFMDARRCLQVGGELRIVGNRHLDYFHKLKRLFGNCETIASNTKFAVLRAVKTNSSR
>CP026982.1|AYH20443.1|4144415_4146473_+|NADPH-dependent-2,4-dienoyl-CoA-reductase
MTAYPMLLAPLDLGFTTLKNRVVMGSMHTGLEEHPEGAERLAAFYRERARGGVGLIVTGGIAPNAKGAVAKGGATLHDEVQVAHHQVLTQAVHDAGGKIALQILHAGRYSYQPDPVAPSAIQAPINRFAPRAMSTQDIMQTIDDFAHCAVLAQRAGYDGVEIMGSEGYLINQFLVTHTNHRDDEWGGDFQHRCRFALEIVRAVRERTGPDFILIYRLSMLDLIEEGSSWQEIVQLAQAIEQAGATLINTGIGWHEARIPTIATLVPRGAFGWVTKKLMGKVRIPLITTNRINDPGVAEQLLAEGCADMISMARPFLADAELVAKAQSGRADEINTCIGCNQACLDQIFAGKVTSCLVNPRACHETELPIQLARVSKRFAVVGAGPAGMAFAVNAAARGHHVTLFESSSYIGGQFNIAKQIPGKTEFYETLRYYRRQLELLGVTLRLSTQATPTDLLGFDDVILASGIVPRIPAIAGIDHPSVLSYLDVLRDKKPVGKRVAIVGAGGIGFDTAHYLLTEKHLIGSNHHHLSPSSSQSERNDFYAEWGIDKQLQHRGGLLPHQSGELPHQRDITLLQRKAGKPGENLGKTTGWIHRTTLLRHGVTMLSGVEYHHIDDEGLHIIHDQQIRCLPVDNIIICAGQEPNRKLYDPLLAAGCHVHLIGGADVAQELDARRAIDQATRLALTL
>CP026982.1|AYH20442.1|4143903_4144200_-|hypothetical-protein
MRVEELEYRLDSALRALEQSVQRQQQAWRQEHQSLQQQLLQAKERDAYLCTQIERLSAQLSAMDSSPERNPLIQKMKVIHTHLDVLAQEATAFRRSLR
>CP026982.1|AYH20441.1|4143227_4143716_-|ATP-independent-periplasmic-protein-refolding-chaperone
MRKLTAMLVASSLALGAAGLAHANDAPKGPASEHKMMMKEGREHRGMMGPDAMFKELNLTEAQKQQIKDIMKDSREKMHKAMQDDRRDMHSLVASDTFDAAKAQAQLDKADAAHKARMLNGLETKNKIYNVLTPEQKKQYNDSFEKRLTQPQKPDGKLTPAE
>CP026982.1|AYH20440.1|4141556_4143026_-|GGDEF-domain-containing-protein
MNNDWVLKTKKFMLFLFVTTLIVSCMGFRFRVLDELSLFWPANILVFCLMVSFRDRKGTIKEKTLSICMVFLVSYAAMLLAALLMDNNSPLKTKVLLCLCNMVFVVTAWCAFCLMCRFTGKWSTFEKFSKYYVYIIFASTFLGAFSSGVAYGFYAYVYDTGNRYDEFMDWFSEQLGTGIILAFFFLRGKDILRALRNIPLCPKHIRENIFPFQVFIIFLLVSLFFLDASLITLSVIPLTLCAFNYSFPVMSLLCAITGVILNYLYINQVGILINSNSEAYINSFLTTARLNIAMLIMAMLSVSHFVSMNRRLIKIIESNSLKDALTNTFNRRAFLSMLNGKQNVPAHKKKRQLTLLFLDIDYFKQVNDTYGHACGDELIVNFARMLSANIRPSDILCRWGGEEFIIAAYGLTVEQSEAVAEALRRLTESTPLTLHDGREIHFTISIGVAIFSQYEGGNIYDLIGLADEQLYKAKTQGRNRVCVRSTEGL
>CP026982.1|AYH21390.1|4139300_4141262_-|PTS-beta-glucoside-transporter-subunit-EIIBCA
MNSKVLAENILRLVGGEANVSTLVHCATRLRFKIVDHSKVDVAALEAEDGVITVLNASGQLQVVIGNRVPEVYRAFGFISGLLDDGANKQKPVENEKSVSMMGRLIDLVAGIFTPLLGAMAAAGVLKGALAIVIACGWLGPKESTYVILHAASDSLFYFLPMLLAITSARKFDTNIFVAVSIAGALVYPSIQGLFEAGQPVTFLGLPVVMMKYTSSVLPIIFSIWLMSYLERFLNRHIHESVRNILTPFFLLTLMVPLTLMTIGPIGITASKLVASLFVSIYSFNPIIAGALIAASWQILVIFGIHWGFVTVFINDISVMGHSYLKAASSPSVFAQSGALLGVMVRTKDKKLKALAGSSLIASLFGITEPGVYGVTLKLKKPFICAVIAAAMGGAVAGYAKSSAISMGMPGLLTLPIFYGEGFVGFLIGCAIAFVASFVLTIVVGFDDPTPSAGKDPAPVTAPTATSTSTTTSTSTTTSSTSATSASAANVMLSTIPLAEVPAAAEQLGSPAKGELIPLEEVNDKVFSSGIVGQGVAIVPNEGRIYSPVDGVIASTFASGHAVGIRSQNGAEILIHVGINTVQLEGLHYQMRVEEGDEVKKGQLLLEFDLEAIKKAGYDIATPVIVTNPENYRVFGLSSVRHPQAGDTIIALA
>CP026982.1|AYH20439.1|4138408_4139245_-|PRD-domain-containing-protein
MKIIRILSNNAVLAVTDKGEECVALGRGIGFGKKDGDSVNEDQIDSRFLKTSNGLNAFFAEILADIPPVYLSITEKIIMLAREVLGIELQDTLFLALNDHINFSVKRHNEGIKINNQLLWEVKLFYPKEFSVGLRALDIIEEKLQVRLPEDEAGFIAFHLANAANNSNMESTMQSATLIKDILTIVKYDLNINYDENSIDYQRFITHLKFFSLRLFNRTPVSHADDSIYDGIKELMQVAYACAMRVFYYVEKHYQYKLTTDEIMFLTIHINRLNRNPK
>CP026982.1|AYH20448.1|4150410_4151658_+|serine/threonine-transporter-SstT
METQQSRFLQYITRGSLVQQILLGLVAGIILASLSTQAALAAGLLGTLFVGALKAVAPILVLVLVMASIANHQQGQKTNIRPILFLYLIGTFSAALIAVVLSVIFPSTLALNAQATDITPPSGIVEVLEGLLMSVIANPIHALLNANYIGILVWAVGLGIAFRHGSDSTKSMINDASNAVTMIVRVVIRFAPLGIFGLVASTLAETGFGALWGYAHLLMVLIGGMLLVALVVNPLIVYWKIRSNPYPLVLRCLRESGVTAFFTRSSAANIPVNMELCRKLNLDEDTYSVAIPLGATINMAGAAITITVLTLAAAHTLGIQIDVPTALLLSVVASLCACGASGVAGGSLLLIPLACSMFGISNDIAMQVVAVGFIIGVLQDSAETAVNSSTDVMFIAAVCHAEDAKLAEKDRLNLL
>CP026982.1|AYH20449.1|4151740_4152271_-|YgjV-family-protein
MTHYWVAQSVGVLAFLVGITMFFNRNDKKFKIQLSAYSAVIGLHFFLMGANAAGASALLNSARTLISLKTHSIIVMFVFISLTLVFGLSGMHHAMELLPIAGTVVSTWALFRTSGLTTRCVMWCSTAGWVAHNIWLGSIGGSLIEGSFLLMNGFNIIRFWRMQQRGIDPFSVEKKA
>CP026982.1|AYH20450.1|4152360_4153851_-|altronate-dehydratase
MQSIIKIHSLDNVAVALRDVEQGETVSVDSYTVTLQQPVVRGHKFALETIAPGEMITKYGLPIGHALVSIAPGEHIHSQNAKTNLSDLDEYQYQPEFLELPAQMGDREVQLYRRKNGDVGIRNELWILPTVGCVNGIARQIQQRFLKETNDAEGIDGVYLFSHTFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVDAFRSTLGGFDSDRVTFMVCQQQDDEVEAGLERLHTLYEAMRHDKREPGKLSELKFGLECGGSDGLSGITANPLLGRFSDYLIANGGTTVLTEVPEMFGAERILMSRCRDEATFEKTVHMVNDFKQYFIAHNQPIYENPSPGNKAGGITTLEEKSLGCTQKAGQSKVVDVLKYGERLHTPGLNLLSAPGNDAVATSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNSELAKKKPHWIDFDAGRLIHDMPMDELLSQFVELIVETADGKRTKNEVNDFRELAIFKSGVTL
>CP026982.1|AYH20451.1|4153870_4155337_-|tagaturonate-reductase
MQTLNRRNFPGRQHPDRVIQFGEGNFLRAFVDWQLDLLNEHTDLDAGVVIVRPIDSDFPPALDTQDGLYTTIIRGLNEQGEAVREPRLIRSVNREINVYRQFDDYLALAHDPNIRFVFSNTTEAGISYHAEDRLSDAPPVSFPAKLTRLLYERFCHFDGAADKGWVLLPCELIDYNGVALKELVLRYAAQWELTPTFTAWLNDHNTFCSTLVDRIVTGYPRAEVEALQQEMGYQDTFWDTAEHFYLFVIQGPQWLAEELRLNKLDLNIRIVDDIKPYKERKVAILNGAHTALVPVAFLAGLDTVGESMDDALIGKFVEKTIAEEIVPVLDLPHDELTSFAQAVLSRFRNPFIQHQLLSISLNGMTKFRTRILPQLLTYRERHGELPARLTFALAALIAFYRGERSGEGDALQTYPLQDDAHWLERYSSLWAGVKENTVSLAELVNVVLRDADHWEQDLTQVPGLAAQVTEQLQTIVDRGMRAAVEGYC
>CP026982.1|AYH20452.1|4155542_4156952_-|glucuronate-isomerase
MPQFLSEDFLLDTEFARRLYHEYAVDQPIFDYHCHLPPEQIAENYRFKNLYDIWLKGDHYKWRAMRTNGVPERLCTGDASDWEKFEAWAATVPHTIGNPLYHWTHLELRRPFGVTGTLLSPSTAKDIWDRCNAMLERDDFTARGIMQQMNVKMVGTTDDPIDDLRHHKTVAQDSSFSIKVLPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFSDLQTALTKRLDHFAAHGCKVSDHALDVVLFAEADDATLDNILARRLAGETLSEHEVAQFKTGVLVWLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDRPMAQELSRLLSKQNEENLLPKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQLGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVEDGEAPADLPLLGEMVKNISFDNAKNYFAIEL
>CP026982.1|AYH20453.1|4157372_4158674_+|MFS-transporter
MRKIKGLRWYMIGLVTIGTVLGYLTRNAISVAAPTLQDQLHITTQQYSYIVAAYSACYTIMQPIAGYVLDLLGTKVGYAMFAIIWAICCMGTALANSWGGLAIARGAVGMAEAAMIPAGLKASSEWFPAKERSIAVGYFNVGSSIGAMIAPPLVVWAIVAHSWEMAFIITGALSMVWAICWLIFYKHPKDQKKLSDEERDYILNGQEAQHQTNNAKKMSAWQILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADIGCILGGYLPMLFQKHFKVNLIVSRKLVVTMGAVLMIGPGMIGLFSSPYVAIALLCVGGFAHQSLSGALITLSSDVFGRNEVATANGLTGMAAWMASTMFALVVGALADTMGFSPLFAALAVFDLLGAVVIWTVLKNQPASEVAAATETLKEANQH
>CP026982.1|AYH20454.1|4158881_4159658_+|transcriptional-regulator-ExuR
MALTEPRRLYQQLAAELKQRIESGMYQVGEKLPAERYISEEMNVSRTVVREAIIMLEVEGYVEVRKGSGIHVISNQQKNPFVSSGDIEFVAAGPFELLQARQLIESNIAEFAATQVTRQDIIQLMEIQEYARQEDRFRDSQWDLKFHVQVALATQNSAMATIVEKMWSQRIHNPYWRKLHEHIDDKSIESWCEEHDRILKALIRKDPYAAKLAMWQHLENTKQMLFRATTDDFEFNVDRYMFAENPVVHLDQIHAGKP
>CP026982.1|AYH20455.1|4160143_4160827_+|DedA-family-protein
MELIKELLNALWHQDFDILADPKLVWTIYILLFLIIFLENGLLPAAFLPGDSLLILVGVLVAKGTMNYPFTIFLLTTAASLGCWASYIQGKWLGNTGIVQGWLSHLPAHYHQRAHQLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLNNARFQFFNWMSGFLWVFILVTLGFALGKTTIFLKYEDELMFCLMMLPLVLLFVGLFGSLFVLWRKKRDANANNAEKGR
>CP026982.1|AYH20456.1|4160829_4161225_+|modulator-protein
MSIRGLFPKLSPRKVGRILLLLALPLIALTQSQSLRHSQDDAMLHIKPYEGSALPDGFYVYQRLNEKGIAIKSITPEQDSLIVRLASPEQSIAARDVLRLSLPKVSVTAQQATTPTPFWQQKLTQKQSKLG
>CP026982.1|AYH20457.1|4161501_4161807_+|DUF883-domain-containing-protein
MAKDQNSEYLRAELKSLADTLEEVLSTSSDKSKAELDKLRNKAESALKETRSRLSDTGERIASQTKEAVESADDYVRQNPWTGVGIGAAVGVVLGVLLSRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_7

4412541-4413297

TypeI-E

I-E

Consensus_repeat	Method
NNCGGTTTATCCCCGCTGGCGCGGGGAACAC	CRT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAACAC	PILER-CR

12 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11

The CRISPR arrays of CP026982_7

>merge|CP026982|7|4412541-4413297|CRT,CRISPRCasFinder,PILER-CR
AGCGGGATTTGTCCGCATGCGGGGAATATTTAGACCAACATGCAACAAGGGGTATAACCGTTTATCCCCGCTGGCGCGGGGAACACGATCTGATTCCGGCAATCACAACATTCAATAACGGTTTATCCCCGCTGGCGCGGGGAACACGCAACTTGCCACGGCAATGCGGCTTTTCCGCCCGGTTTATCCCCGCTGGCGCGGGGAACACTTCTAGATAAATCACGGTATCTGTCTTTCATGCGGTTTATCCCCGCTGGCGCGGGGAACACATATCGCCAAAAAATATGGTTGGATGATGTTCCGGTTTATCCCCGCTGGCGCGGGGAACACTCAGTTAAATCCATAGCGTTAACTCAACAGGACGGTTTATCCCCGCTGGCGCGGGGAACACTGCATTGGTAGATTCCGAGAGATCAAAAAAACCGGTTTATCCCCGCTGGCGCGGGGAACACTTGATGAATCCAGTCTTAGCCAGTCTAGCGCCCGGTTTATCCCCGCTGGCGCGGGGAACACCGGTAGGACATTACCTGAACGGCAGGATCGCGCGGTTTATCCCCGCTGGCGCGGGGAACACTCGCGGACGTATTCTTGCAAACCGCGAACCTGCGGTTTATCCCCGCTGGCGCGGGGAACACGCGCTCCCATCTCCACCAAGGGCTCTGATTTCCGGTTTATCCCCGCTGGCGCGGGGAACACTCTCCAGACGTAAAAAAACCCTCCGGAGAGGGCGGTTTATCCCCGCTGGCGCGGGGAACAC

>CP026982|7|3|4412541-4413297|CRT
AGCGGGATTTGTCCGCATGCGGGGAATAT	TTAGACCAACATGCAACAAGGGGTATAA
CCGTTTATCCCCGCTGGCGCGGGGAACAC	GATCTGATTCCGGCAATCACAACATTCAATAA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GCAACTTGCCACGGCAATGCGGCTTTTCCGCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TTCTAGATAAATCACGGTATCTGTCTTTCATG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ATATCGCCAAAAAATATGGTTGGATGATGTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCAGTTAAATCCATAGCGTTAACTCAACAGGA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TGCATTGGTAGATTCCGAGAGATCAAAAAAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TTGATGAATCCAGTCTTAGCCAGTCTAGCGCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CGGTAGGACATTACCTGAACGGCAGGATCGCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCGCGGACGTATTCTTGCAAACCGCGAACCTG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GCGCTCCCATCTCCACCAAGGGCTCTGATTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCTCCAGACGTAAAAAAACCCTCCGGAGAGGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>CP026982|7|7|4412598-4413297|CRISPRCasFinder
CCGTTTATCCCCGCTGGCGCGGGGAACAC	GATCTGATTCCGGCAATCACAACATTCAATAA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GCAACTTGCCACGGCAATGCGGCTTTTCCGCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TTCTAGATAAATCACGGTATCTGTCTTTCATG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ATATCGCCAAAAAATATGGTTGGATGATGTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCAGTTAAATCCATAGCGTTAACTCAACAGGA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TGCATTGGTAGATTCCGAGAGATCAAAAAAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TTGATGAATCCAGTCTTAGCCAGTCTAGCGCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CGGTAGGACATTACCTGAACGGCAGGATCGCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCGCGGACGTATTCTTGCAAACCGCGAACCTG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GCGCTCCCATCTCCACCAAGGGCTCTGATTTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCTCCAGACGTAAAAAAACCCTCCGGAGAGGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>CP026982|7|3|4412600-4413297|PILER-CR
GTTTATCCCCGCTGGCGCGGGGAACACGA	TCTGATTCCGGCAATCACAACATTCAATAACG
GTTTATCCCCGCTGGCGCGGGGAACACGC	AACTTGCCACGGCAATGCGGCTTTTCCGCCCG
GTTTATCCCCGCTGGCGCGGGGAACACTT	CTAGATAAATCACGGTATCTGTCTTTCATGCG
GTTTATCCCCGCTGGCGCGGGGAACACAT	ATCGCCAAAAAATATGGTTGGATGATGTTCCG
GTTTATCCCCGCTGGCGCGGGGAACACTC	AGTTAAATCCATAGCGTTAACTCAACAGGACG
GTTTATCCCCGCTGGCGCGGGGAACACTG	CATTGGTAGATTCCGAGAGATCAAAAAAACCG
GTTTATCCCCGCTGGCGCGGGGAACACTT	GATGAATCCAGTCTTAGCCAGTCTAGCGCCCG
GTTTATCCCCGCTGGCGCGGGGAACACCG	GTAGGACATTACCTGAACGGCAGGATCGCGCG
GTTTATCCCCGCTGGCGCGGGGAACACTC	GCGGACGTATTCTTGCAAACCGCGAACCTGCG
GTTTATCCCCGCTGGCGCGGGGAACACGC	GCTCCCATCTCCACCAAGGGCTCTGATTTCCG
GTTTATCCCCGCTGGCGCGGGGAACACTC	TCCAGACGTAAAAAAACCCTCCGGAGAGGGCG
GTTTATCCCCGCTGGCGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH20661.1\|4411957_4412416_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH21401.1\|4413987_4414293_-\|type-II-toxin-antitoxin-system-HigB-family-toxin	unknown	unknown	gnl\|CDD\|378301
CP026982.1\|AYH20663.1\|4414444_4414705_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
CP026982.1\|AYH20659.1\|4408621_4409068_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP026982.1\|AYH20667.1\|4418203_4418938_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
CP026982.1\|AYH20655.1\|4404738_4406877_+\|anaerobic-ribonucleoside-triphosphate-reductase	unknown	unknown	gnl\|CDD\|236436
CP026982.1\|AYH20658.1\|4408114_4408612_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235127
CP026982.1\|AYH20660.1\|4410524_4411877_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223154
CP026982.1\|AYH20665.1\|4416611_4417529_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
CP026982.1\|AYH20664.1\|4416317_4416611_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
CP026982.1\|AYH20653.1\|4403388_4403853_+\|aspartate-carbamoyltransferase-regulatory-subunit	unknown	unknown	gnl\|CDD\|234859
CP026982.1\|AYH20656.1\|4406958_4407423_+\|anaerobic-ribonucleoside-triphosphate-reductase-activating-protein	unknown	unknown	gnl\|CDD\|236853
CP026982.1\|AYH20662.1\|4413574_4413991_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|227786
CP026982.1\|AYH20668.1\|4418947_4420015_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP026982.1\|AYH20669.1\|4420018_4420654_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|187862
CP026982.1\|AYH21400.1\|4409222_4410494_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP026982.1\|AYH21402.1\|4414778_4415150_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP026982.1\|AYH20666.1\|4417556_4418204_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|215025
CP026982.1\|AYH20654.1\|4403951_4404338_+\|2-iminobutanoate/2-iminopropanoate-deaminase	unknown	unknown	gnl\|CDD\|105214
CP026982.1\|AYH20657.1\|4407434_4408088_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187560

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH21401.1\|4413987_4414293_-\|type-II-toxin-antitoxin-system-HigB-family-toxin	gnl\|CDD\|378301	pfam09907, HigB_toxin, HigB_toxin, RelE-like toxic component of a toxin-antitoxin system. HigB_toxin is a family of RelE-like prokaryotic proteins that function as mRNA interferases. HigB cleaves translated mRNA only, and cleavage depended on translation of the target RNAs. HigB belongs to the RelE super-family of RNases. The toxin-antitoxin gene-pair is induced by environmental stress factors.	4.49918e-23
CP026982.1\|AYH20663.1\|4414444_4414705_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	4.05062e-10
CP026982.1\|AYH20659.1\|4408621_4409068_-\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	4.40537e-34
CP026982.1\|AYH20667.1\|4418203_4418938_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.51659e-43
CP026982.1\|AYH20655.1\|4404738_4406877_+\|anaerobic-ribonucleoside-triphosphate-reductase	gnl\|CDD\|236436	PRK09263, PRK09263, anaerobic ribonucleoside triphosphate reductase; Provisional.	0
CP026982.1\|AYH20658.1\|4408114_4408612_-\|hypothetical-protein	gnl\|CDD\|235127	PRK03467, PRK03467, hypothetical protein; Provisional.	1.11565e-96
CP026982.1\|AYH20660.1\|4410524_4411877_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|223154	COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism].	7.78396e-53
CP026982.1\|AYH20665.1\|4416611_4417529_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.85831e-155
CP026982.1\|AYH20664.1\|4416317_4416611_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	1.07396e-61
CP026982.1\|AYH20653.1\|4403388_4403853_+\|aspartate-carbamoyltransferase-regulatory-subunit	gnl\|CDD\|234859	PRK00893, PRK00893, aspartate carbamoyltransferase regulatory subunit; Reviewed.	7.05383e-84
CP026982.1\|AYH20656.1\|4406958_4407423_+\|anaerobic-ribonucleoside-triphosphate-reductase-activating-protein	gnl\|CDD\|236853	PRK11121, nrdG, anaerobic ribonucleoside-triphosphate reductase-activating protein.	2.24728e-119
CP026982.1\|AYH20662.1\|4413574_4413991_-\|transcriptional-regulator	gnl\|CDD\|227786	COG5499, COG5499, Predicted transcription regulator containing HTH domain [Transcription].	2.95668e-32
CP026982.1\|AYH20668.1\|4418947_4420015_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	9.02207e-118
CP026982.1\|AYH20669.1\|4420018_4420654_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	1.08644e-20
CP026982.1\|AYH21400.1\|4409222_4410494_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.36501e-66
CP026982.1\|AYH21402.1\|4414778_4415150_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.19118e-08
CP026982.1\|AYH20666.1\|4417556_4418204_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|215025	smart01101, CRISPR_assoc, This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	2.11153e-62
CP026982.1\|AYH20654.1\|4403951_4404338_+\|2-iminobutanoate/2-iminopropanoate-deaminase	gnl\|CDD\|105214	PRK11401, PRK11401, enamine/imine deaminase.	9.09297e-63
CP026982.1\|AYH20657.1\|4407434_4408088_-\|hypothetical-protein	gnl\|CDD\|187560	cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs. Atypical SDRs in this subgroup include CC3 (also known as TIP30) which is implicated in tumor suppression. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine rich NAD(P)-binding motif that resembles the extended SDRs, and have an active site triad of the SDRs (YXXXK and upstream Ser), although the upstream Asn of the usual SDR active site is substituted with Asp. For CC3, the Tyr of the triad is displaced compared to the usual SDRs and the protein is monomeric, both these observations suggest that the usual SDR catalytic activity is not present. NADP appears to serve an important role as a ligand, and may be important in the interaction with other macromolecules. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.68285e-61

>CP026982.1|AYH20661.1|4411957_4412416_-|hypothetical-protein
MKVEAAESSVFASQQVMAKRSTEHAEKVALSEQLQPYQAGSGAVPAGQTTRYDFTRISPAELYETVEGLVSSGQLGREEGSALLGFISSPRENIGSVPPSNVFQPINVFDTIQQGAAGASSRSEVQNTESLQRAAEALNRFQGQVSSISVYV
>CP026982.1|AYH20660.1|4410524_4411877_+|aspartate-aminotransferase-family-protein
MSELTLLADADERGRRYLVENAQRRVFPDAEALAALARFDEALPQQGFSAEDTLTLLDEVGSPATTASNGPNYFGFVIGAALPIAAASERLMIAWDQCASTFDNSPISATLERLTSRWVLDALNLPKESAVGFGTSATACTLSCLAAARRALLAKQGWDFDNDGLIGAPEIKVVISELTHITVKKALRVLGFGLRHIIVTPVNAFGQIDVTQLPPLNERMILCLQAGEVNTGEFDDFAQIIPTAKAAGAWVHVDGAFGLWARASSHSALTEGIELADSWTTDAHKWLNTPYDCAMAICRSADVLAEAMNADAVYSSAARDAQKNLTLEFSRRPRGIPVWAVLRTLGRDGVAEMIERHCQQATLIAEGLRHAGFEILNRVVLNQVLLRGETDGQTTAIRETLQASGKAWFGGSVWQGRPALRISVSSWRTQDDNVQALITLLTEIKAQTQR
>CP026982.1|AYH21400.1|4409222_4410494_+|MFS-transporter
MKNSPIHTTSSVTEYDLYSKRLPAQTGLPRALVLLFACASALSVANVYYAQPLLDALSVDFHISIAAVGGVMTATQLGCALALILLVPLGDILNRRYLMLAQLSLLIVALIAVGLATTSLYLLIGMLAVGMFGTAMTQGLIAYAATAAAPQERGRVVGAAQGGVVIGLLLARVLSGFIADIAGWRSVYFFSALLMLLLAVFLWRALPHQPPAQQRPHYSALLLSMLILLRKERVLQIRGIIALLMFAALSIFWSALVLLLSREPYFFSHTVIGAFGLVGILGALAAVKAGSLADKGREQWLSGIALLLLLASWLPLWLAPYSLFALVVGIIALDLGGQAIHVTNQSMIFKTHPDAHSRLVGCYMLFYSIGSGLGAMATTVAYDAAGWSGVCFLGAAVSLLALLFWKITRHISASPPAAFTPSR
>CP026982.1|AYH20659.1|4408621_4409068_-|transcriptional-regulator
MVKRKSLKEDVCPVARALDAVGDRWTLLIIRDAFDNRRRFSDFQRSLGVAKNILTDRLRTLVDEGILSVQPVSESSAYQEYVLTPKGEQLFPLVVALRQWGEQQLFAEGESHSLLLDKRTGQPLQAMLPHSAQGQRLVGQDTFVQKID
>CP026982.1|AYH20658.1|4408114_4408612_-|hypothetical-protein
MQTESRETDSDLEAITRYLKKSHVLTLCVGENSELWCASCFYTYDDQQIAFYLMTELHTRHGEIMARLPQVAGTVSGQPKSVMLIKGVQFRAQAVQLEGDDALQARARYNARFPIARASQAPIWRLDLIEVKMTDNMLGFGKKRYWQRDEQTGQKAHDKHEKMRE
>CP026982.1|AYH20657.1|4407434_4408088_-|hypothetical-protein
MSQVLLLGATGLVGHELLELLKVNNRVETIYAPTRKPLMLSDKVVNPYNTDLSAALAQLTEPVDIAFCCLGSTLKTAGSKQAFRYVDYTLVVEGSKVALALGATHLLVVSSLSANATSPFFYSRVKGETEKSLRQQGWQHLTLAQPSMLLGEREDSRTLESLAAPLFRLFPAKWRAIEGKTVAQALLNQAFSPEPKARVTVLESDQLRSLGQWQPLQ
>CP026982.1|AYH20656.1|4406958_4407423_+|anaerobic-ribonucleoside-triphosphate-reductase-activating-protein
MNYHQYYPVDVVNGPGTRCTLFVAGCVHECVGCYNKSTWRLNSGQPFTQEQEDQIIADLQDTAVPRQGISLSGGDPLHPQNVPDILRLVERIRAECPGKDIWVWTGYVLADITPEQQQVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHRLR
>CP026982.1|AYH20655.1|4404738_4406877_+|anaerobic-ribonucleoside-triphosphate-reductase
MKPVVIKRDGCQVPFDEVRIKEAVERAARAADVNDADYCATVACAVAQQMQDKSRVDIRDIQDAVENLLMSGNYKQLARTYIEYRHDRDIARERHGRLNQEIRGLVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQYILPRDVVLAHERGEIHYHDLDYSPFFPMFNCMLIDLNGMLTNGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGGTTINRIDEILAPFVTASHAKHKAVAEEWKIPDAENYARTRTEKECYDAFQSLEYEVNTLHTANGQTPFVTFGFGLGTCWESRLIQESILRNRIAGLGKNHKTAVFPKLVFAIRDGLNHKAGDANYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEEDGQQIHDGRNNLGVISLNLPRIALEAEGNEDRFWTLLDQRLTLAKKALMTRIARLESVKARVAPILYMEGACGVRLNADDSIADIFKNGRASISLGYIGLHETINALFGSQTHVFDDEALRAKAVAVIARLKAATEQWKDETGYGFSLYSTPSENLCDRFCRLDTAEFGVVQGVTDKGYYTNSFHLDVEKKVNPYQKIDFELPYPPMANGGFICYGEYPNLQHNLKALEDVWDYSYTRVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDSARVSVTRRVCGYLGSPDARPFNAGKQEEVKRRIKHLGNGQLG
>CP026982.1|AYH20654.1|4403951_4404338_+|2-iminobutanoate/2-iminopropanoate-deaminase
MSRIISTEHAPAAIGPYVQGVDLGSMIFTSGQIPVNPKSGLVADNITAQTRQSLENVQAIVEAAGLKVSDIVKMTVFVKDLHDFTLVNTAYEAFFKEHDAPFPARSCVEVARLPKDVKIEIEAIAVRR
>CP026982.1|AYH20653.1|4403388_4403853_+|aspartate-carbamoyltransferase-regulatory-subunit
MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITIGLNLPSNHLGRKDLIKIENIFLTEQQANQLAIYAPQATVNQIDEYDVVRKLVPTLPDHITGVLTCPNSNCISRSEPVSSSFSVKQRDGDVHLKCKYCEKEFERQAVLQDR
>CP026982.1|AYH20662.1|4413574_4413991_-|transcriptional-regulator
MMYADAIKAANNLTSIVPLLGGSTSCKDYEDALKLIEYLLESEPDSPLIDMLTAKIDKYEEDAPEFVAFNERIKALPAGIALLRILMDQHGLTQSDFEAEIGKKSLVSRILNGERTLTVDHMSALAKRFDIPVSAFVD
>CP026982.1|AYH21401.1|4413987_4414293_-|type-II-toxin-antitoxin-system-HigB-family-toxin
MFSRAPFDTAIAQFPNQAAALADLYRTIKREIYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKIFIKHITSHAEYGSLTEYYRRNKE
>CP026982.1|AYH20663.1|4414444_4414705_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MLKVSWSKRALKQLGTIDTRYRKRIKEKVGELSTFPDVNLDLKKLESSGKQYRLRVGDYRIIFELINDVPQVCEILEIKRRTTTTY
>CP026982.1|AYH21402.1|4414778_4415150_+|XRE-family-transcriptional-regulator
MSIQVIRDKSGKPEYAVVPYELYQKLIENADDPALYESIPYDHSAEDDVSIPHEVVSIHIDQDVSLQAAWRIFRGFSQQEVATALGMTQAAVSQLESPDSRPQKRTREKLAKLYHCEPEQLIL
>CP026982.1|AYH20664.1|4416317_4416611_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSMLVVVTENVPPRLRGRLAVWLLEVRAGVYVGDTSQRVREMVWQQIIELAEQGNVVMAWATNTESGFEFQTWGENRRMPVDLDGLRLVSFSPIENQ
>CP026982.1|AYH20665.1|4416611_4417529_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MYVPLNPIPLKDRVSLIFLQYGQIDVIDGAFVLVDKTGVRTHIPVGSVACIMLEPGTRVSHAAVRLAATVGTLLVWVGEAGVRLYASGQPGGARSDKLLYQAKLALDEELRLKVVRKMFELRFGEPAPSRRSVDQLRGIEGARVRQTYTLLAQQYGVKWNGRRYDPKDWERGDKVNQCISAATSCLYGITEAAVLAAGYAPAIGFVHSGKPLSFVYDIADIIKFEGVVAKAFEIAARNPAEPDREVRLACRDIFRSQKTLSKLIPLIEEVLSAGGITPPLPPDDAQPPAIPEPKPFGDSGHRGQG
>CP026982.1|AYH20666.1|4417556_4418204_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYFSRITLNLNALPHAMATKRLHAGGYASHQWLWQLFPDQPQRSFLFREEEQETKSLFYLLSEQAPQVDHNLFRVETKPYQPQWRDGMTLAFSLRANPVVTRDGKRSDVLMDARHQAKAAGLSGVELWLHQQQRARDWLVRQGENAGFTLSSCCVDGYQRHRLNKPGQSAAIVFSSVDYDGMLHITDAERFAASVQQGLGKSKALGCGLLLLKRA
>CP026982.1|AYH20667.1|4418203_4418938_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MDNYLVFQIYAPLVSWGEAAVGEVRHTSTVPSRSALLGLLAAALGIRRDDRAALTAFNQHYSVAVRPLSDRETWLNDYHTVQMPKENRKVPRYTRRDELRPEAGQSLETMLTSREYRCDAYYHIAISVTPDAPYSLTALRDALLSPVFALYFGRKSCPPALPLAPHLFSGSLAEVWQQARQTPALNDLALQLIGRAEGLCYWEQESDTGLTPQYRVVRNDQPADRRRWQFTSRVQYVGSEKGEE
>CP026982.1|AYH20668.1|4418947_4420015_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTFIQLHFLTAYPSSNLNRDDAGRPKTAMVGGVERLRVSSQSLKRAWRTSEVFEDALDGHIGTRSRRVGREVYNALIARGMVEKLADKAALSIAAQFGKPKKEEKDSKDPLEKYDIEQLAHISVQEKARIDRLIAQLATESREPNSEELKLLRKDAASVDIALFGRMLASSPEFNIEAACQVAHALGVSAVTIEDDFFTAVDDLNTAADSGSAHMGEQSFASALFYHYVCINRDLLLENLNNDEDLVARTLRALTETALTVSPGGKQNSFASRALATYALAEKGTDQPRTLSVAFFKPIRSADQVNDAIDLLCQQKAKFDRVYASGGCVPSYELNVEATNEGGSLQGLLDFISQ
>CP026982.1|AYH20669.1|4420018_4420654_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MANTADFLVITKDDAKKINDWFDGLQNRHGTPGNGRARRAELRRAKQPPYGVLTCQGYHDLAGKLAARLTQEHHIVALAMFVSVAAHAEKNMLKTSFAAQLGEKQGGDRPFLSPLRFERLQRAQTPEELHRQLFRAVQIRGEAGVNLPSLADGIFLWVEEWQARQENRAPNLHPLRRNAVRWACEYARASQNITPDEPDTTETSTTASDKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP026982_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026982_8

4415167-4416233

TypeI-E

I-E

Consensus_repeat	Method
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRISPRCasFinder
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CRT
GGTTTATCCCCGCTGGCGCGGGGAACAC	PILER-CR

17 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP026982_8

>merge|CP026982|8|4415167-4416233|CRISPRCasFinder,CRT,PILER-CR
GGGTTTATCCCCGCTGGCGCGGGGAACACTACTCAGGTAGAGCTTGCTGAAAGGGTTGGAACGGTTTATCCCCGCTGGCGCGGGGAACACTCTCCGGTAATACCGGAAGGTTACAAATTAGCACGGTTTATCCCCGCTGGCGCGGGGAACACCGATCACCTCCGTTACGAGAGAGCTATCTAACCGGTTTATCCCCGCTGGCGCGGGGAACACTCTGGCCCCGCCTCTCCAAACACACCAGCCCCCGGTTTATCCCCGCTGGCGCGGGGAACACGACGTGTTGTTATCAGCGATCGATACATACGACGGTTTATCCCCGCTGGCGCGGGGAACACAATTAAAACCAGATGAATAGCCTCTTCGGAGGCGGTTTATCCCCGCTGGCGCGGGGAACACAAGTTTCTTTGATCTGCAAACTCAGTTGCAGCCGGTTTATCCCCGCTGGCGCGGGGAACACCTCCTTTCTTGGCACCGATTCGCCATTAAACCAGGTTTATCCCCGCTGGCGCGGGGAACACTCCGTAAACATGGGCGTCCCTGATAACGATTTCGGTTTATCCCCGCTGGCGCGGGGAACACCAATGAATCGACCTATTGGGCTTATTTGCGATCGGTTTATCCCCGCTGGCGCGGGGAACACAGGTATCCACCAGTGGCGAATGATCCACGAACCGGTTTATCCCCGCTGGCGCGGGGAACACACACGTCAATGTCAGGGCAAATCGGTGCCGCTCGGTTTATCCCCGCTGGCGCGGGGAACACCAGCGCCAGACGGCAGCAGAGTTAAGCAGTCTCGGTTTATCCCCGCTGGCGCGGGGAACACATCCAAACAAGGTTCTTGATGTTCTCCATGTCCGGTTTATCCCCGCTGGCGCGGGGAACACGATTCATCCCCTCCAGACTTGAGGCCCAACTGCGGTTTATCCCCGCTGGCGCGGGGAACACACACTAAATCAGACTTCGACCTTGCGATGCGCCGGTTTATCCCCGCTGGCGCGGGGAACACGTCCAGCATATAGAGCCTGCTGCTGCCGAGCGCGGTTTATCCCCGCTGGCGCGGGGAACAC

>CP026982|8|8|4415167-4416233|CRISPRCasFinder
GGGTTTATCCCCGCTGGCGCGGGGAACAC	TACTCAGGTAGAGCTTGCTGAAAGGGTTGGAA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCTCCGGTAATACCGGAAGGTTACAAATTAGCA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CGATCACCTCCGTTACGAGAGAGCTATCTAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCTGGCCCCGCCTCTCCAAACACACCAGCCCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GACGTGTTGTTATCAGCGATCGATACATACGA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	AATTAAAACCAGATGAATAGCCTCTTCGGAGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	AAGTTTCTTTGATCTGCAAACTCAGTTGCAGC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CTCCTTTCTTGGCACCGATTCGCCATTAAACC
AGGTTTATCCCCGCTGGCGCGGGGAACAC	TCCGTAAACATGGGCGTCCCTGATAACGATTT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CAATGAATCGACCTATTGGGCTTATTTGCGAT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	AGGTATCCACCAGTGGCGAATGATCCACGAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ACACGTCAATGTCAGGGCAAATCGGTGCCGCT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CAGCGCCAGACGGCAGCAGAGTTAAGCAGTCT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ATCCAAACAAGGTTCTTGATGTTCTCCATGTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GATTCATCCCCTCCAGACTTGAGGCCCAACTG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ACACTAAATCAGACTTCGACCTTGCGATGCGC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GTCCAGCATATAGAGCCTGCTGCTGCCGAGCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>CP026982|8|4|4415167-4416233|CRT
GGGTTTATCCCCGCTGGCGCGGGGAACAC	TACTCAGGTAGAGCTTGCTGAAAGGGTTGGAA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCTCCGGTAATACCGGAAGGTTACAAATTAGCA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CGATCACCTCCGTTACGAGAGAGCTATCTAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	TCTGGCCCCGCCTCTCCAAACACACCAGCCCC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GACGTGTTGTTATCAGCGATCGATACATACGA
CGGTTTATCCCCGCTGGCGCGGGGAACAC	AATTAAAACCAGATGAATAGCCTCTTCGGAGG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	AAGTTTCTTTGATCTGCAAACTCAGTTGCAGC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CTCCTTTCTTGGCACCGATTCGCCATTAAACC
AGGTTTATCCCCGCTGGCGCGGGGAACAC	TCCGTAAACATGGGCGTCCCTGATAACGATTT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CAATGAATCGACCTATTGGGCTTATTTGCGAT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	AGGTATCCACCAGTGGCGAATGATCCACGAAC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ACACGTCAATGTCAGGGCAAATCGGTGCCGCT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	CAGCGCCAGACGGCAGCAGAGTTAAGCAGTCT
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ATCCAAACAAGGTTCTTGATGTTCTCCATGTC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GATTCATCCCCTCCAGACTTGAGGCCCAACTG
CGGTTTATCCCCGCTGGCGCGGGGAACAC	ACACTAAATCAGACTTCGACCTTGCGATGCGC
CGGTTTATCCCCGCTGGCGCGGGGAACAC	GTCCAGCATATAGAGCCTGCTGCTGCCGAGCG
CGGTTTATCCCCGCTGGCGCGGGGAACAC

>CP026982|8|4|4415229-4416233|PILER-CR
GGTTTATCCCCGCTGGCGCGGGGAACAC	TCTCCGGTAATACCGGAAGGTTACAAATTAGCAC
GGTTTATCCCCGCTGGCGCGGGGAACAC	CGATCACCTCCGTTACGAGAGAGCTATCTAACC
GGTTTATCCCCGCTGGCGCGGGGAACAC	TCTGGCCCCGCCTCTCCAAACACACCAGCCCCC
GGTTTATCCCCGCTGGCGCGGGGAACAC	GACGTGTTGTTATCAGCGATCGATACATACGAC
GGTTTATCCCCGCTGGCGCGGGGAACAC	AATTAAAACCAGATGAATAGCCTCTTCGGAGGC
GGTTTATCCCCGCTGGCGCGGGGAACAC	AAGTTTCTTTGATCTGCAAACTCAGTTGCAGCC
GGTTTATCCCCGCTGGCGCGGGGAACAC	CTCCTTTCTTGGCACCGATTCGCCATTAAACCA
GGTTTATCCCCGCTGGCGCGGGGAACAC	TCCGTAAACATGGGCGTCCCTGATAACGATTTC
GGTTTATCCCCGCTGGCGCGGGGAACAC	CAATGAATCGACCTATTGGGCTTATTTGCGATC
GGTTTATCCCCGCTGGCGCGGGGAACAC	AGGTATCCACCAGTGGCGAATGATCCACGAACC
GGTTTATCCCCGCTGGCGCGGGGAACAC	ACACGTCAATGTCAGGGCAAATCGGTGCCGCTC
GGTTTATCCCCGCTGGCGCGGGGAACAC	CAGCGCCAGACGGCAGCAGAGTTAAGCAGTCTC
GGTTTATCCCCGCTGGCGCGGGGAACAC	ATCCAAACAAGGTTCTTGATGTTCTCCATGTCC
GGTTTATCCCCGCTGGCGCGGGGAACAC	GATTCATCCCCTCCAGACTTGAGGCCCAACTGC
GGTTTATCCCCGCTGGCGCGGGGAACAC	ACACTAAATCAGACTTCGACCTTGCGATGCGCC
GGTTTATCCCCGCTGGCGCGGGGAACAC	GTCCAGCATATAGAGCCTGCTGCTGCCGAGCGC
GGTTTATCCCCGCTGGCGCGGGGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
CP026982.1\|AYH20661.1\|4411957_4412416_-\|hypothetical-protein	unknown	unknown	unknown
CP026982.1\|AYH20663.1\|4414444_4414705_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|224937
CP026982.1\|AYH20659.1\|4408621_4409068_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP026982.1\|AYH20667.1\|4418203_4418938_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|187776
CP026982.1\|AYH20658.1\|4408114_4408612_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235127
CP026982.1\|AYH20660.1\|4410524_4411877_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223154
CP026982.1\|AYH20665.1\|4416611_4417529_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
CP026982.1\|AYH20672.1\|4422739_4425463_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	COG1203_cas3_CAS-I	gnl\|CDD\|182031
CP026982.1\|AYH20664.1\|4416317_4416611_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	cd09648_cas2_CAS-I-E	gnl\|CDD\|236930
CP026982.1\|AYH21401.1\|4413987_4414293_-\|type-II-toxin-antitoxin-system-HigB-family-toxin	unknown	unknown	gnl\|CDD\|378301
CP026982.1\|AYH20662.1\|4413574_4413991_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|227786
CP026982.1\|AYH20668.1\|4418947_4420015_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP026982.1\|AYH20670.1\|4420637_4422206_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	pfam09481_cas8e_CAS-I-E	gnl\|CDD\|187860
CP026982.1\|AYH20669.1\|4420018_4420654_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	cd09731_cse2gr11_CAS-I-E	gnl\|CDD\|187862
CP026982.1\|AYH21400.1\|4409222_4410494_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
CP026982.1\|AYH21402.1\|4414778_4415150_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP026982.1\|AYH20666.1\|4417556_4418204_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09664_cas6e_CAS-I-E	gnl\|CDD\|215025
CP026982.1\|AYH20673.1\|4425490_4426042_-\|polymer-forming-cytoskeletal-protein	unknown	unknown	gnl\|CDD\|377376
CP026982.1\|AYH20657.1\|4407434_4408088_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187560
CP026982.1\|AYH20671.1\|4422469_4422685_-\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl\|CDD\|226679

Protein	Function_ID	Function_description	E-value
CP026982.1\|AYH20663.1\|4414444_4414705_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|224937	COG2026, RelE, Cytotoxic translational repressor of toxin-antitoxin stability system [Translation, ribosomal structure and biogenesis / Cell division and chromosome partitioning].	4.05062e-10
CP026982.1\|AYH20659.1\|4408621_4409068_-\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	4.40537e-34
CP026982.1\|AYH20667.1\|4418203_4418938_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187776	cd09645, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	1.51659e-43
CP026982.1\|AYH20658.1\|4408114_4408612_-\|hypothetical-protein	gnl\|CDD\|235127	PRK03467, PRK03467, hypothetical protein; Provisional.	1.11565e-96
CP026982.1\|AYH20660.1\|4410524_4411877_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|223154	COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism].	7.78396e-53
CP026982.1\|AYH20665.1\|4416611_4417529_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	1.85831e-155
CP026982.1\|AYH20672.1\|4422739_4425463_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	7.0149e-127
CP026982.1\|AYH20664.1\|4416317_4416611_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|236930	PRK11558, PRK11558, putative ssRNA endonuclease; Provisional.	1.07396e-61
CP026982.1\|AYH21401.1\|4413987_4414293_-\|type-II-toxin-antitoxin-system-HigB-family-toxin	gnl\|CDD\|378301	pfam09907, HigB_toxin, HigB_toxin, RelE-like toxic component of a toxin-antitoxin system. HigB_toxin is a family of RelE-like prokaryotic proteins that function as mRNA interferases. HigB cleaves translated mRNA only, and cleavage depended on translation of the target RNAs. HigB belongs to the RelE super-family of RNases. The toxin-antitoxin gene-pair is induced by environmental stress factors.	4.49918e-23
CP026982.1\|AYH20662.1\|4413574_4413991_-\|transcriptional-regulator	gnl\|CDD\|227786	COG5499, COG5499, Predicted transcription regulator containing HTH domain [Transcription].	2.95668e-32
CP026982.1\|AYH20668.1\|4418947_4420015_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	9.02207e-118
CP026982.1\|AYH20670.1\|4420637_4422206_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	5.48509e-131
CP026982.1\|AYH20669.1\|4420018_4420654_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	1.08644e-20
CP026982.1\|AYH21400.1\|4409222_4410494_+\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.36501e-66
CP026982.1\|AYH21402.1\|4414778_4415150_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.19118e-08
CP026982.1\|AYH20666.1\|4417556_4418204_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|215025	smart01101, CRISPR_assoc, This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	2.11153e-62
CP026982.1\|AYH20673.1\|4425490_4426042_-\|polymer-forming-cytoskeletal-protein	gnl\|CDD\|377376	pfam04519, Bactofilin, Polymer-forming cytoskeletal. This is a family of bactofilins, a functionally diverse class of cytoskeletal, polymer-forming, proteins that is widely conserved among bacteria. In the example species C. crescentus, two bactofilins assemble into a membrane-associated laminar structure that shows cell-cycle-dependent polar localization and acts as a platform for the recruitment of a cell wall biosynthetic enzyme involved in polar morphogenesis. Bactofilins display distinct subcellular distributions and dynamics in different bacterial species, suggesting that they are versatile structural elements that have adopted a range of different cellular functions.	1.93745e-24
CP026982.1\|AYH20657.1\|4407434_4408088_-\|hypothetical-protein	gnl\|CDD\|187560	cd05250, CC3_like_SDR_a, CC3(TIP30)-like, atypical (a) SDRs. Atypical SDRs in this subgroup include CC3 (also known as TIP30) which is implicated in tumor suppression. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine rich NAD(P)-binding motif that resembles the extended SDRs, and have an active site triad of the SDRs (YXXXK and upstream Ser), although the upstream Asn of the usual SDR active site is substituted with Asp. For CC3, the Tyr of the triad is displaced compared to the usual SDRs and the protein is monomeric, both these observations suggest that the usual SDR catalytic activity is not present. NADP appears to serve an important role as a ligand, and may be important in the interaction with other macromolecules. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.68285e-61
CP026982.1\|AYH20671.1\|4422469_4422685_-\|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl\|CDD\|226679	COG4226, HicB, Predicted nuclease of the RNAse H fold, HicB family [General function prediction only].	1.00724e-18

>CP026982.1|AYH21402.1|4414778_4415150_+|XRE-family-transcriptional-regulator
MSIQVIRDKSGKPEYAVVPYELYQKLIENADDPALYESIPYDHSAEDDVSIPHEVVSIHIDQDVSLQAAWRIFRGFSQQEVATALGMTQAAVSQLESPDSRPQKRTREKLAKLYHCEPEQLIL
>CP026982.1|AYH20663.1|4414444_4414705_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MLKVSWSKRALKQLGTIDTRYRKRIKEKVGELSTFPDVNLDLKKLESSGKQYRLRVGDYRIIFELINDVPQVCEILEIKRRTTTTY
>CP026982.1|AYH21401.1|4413987_4414293_-|type-II-toxin-antitoxin-system-HigB-family-toxin
MFSRAPFDTAIAQFPNQAAALADLYRTIKREIYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKIFIKHITSHAEYGSLTEYYRRNKE
>CP026982.1|AYH20662.1|4413574_4413991_-|transcriptional-regulator
MMYADAIKAANNLTSIVPLLGGSTSCKDYEDALKLIEYLLESEPDSPLIDMLTAKIDKYEEDAPEFVAFNERIKALPAGIALLRILMDQHGLTQSDFEAEIGKKSLVSRILNGERTLTVDHMSALAKRFDIPVSAFVD
>CP026982.1|AYH20661.1|4411957_4412416_-|hypothetical-protein
MKVEAAESSVFASQQVMAKRSTEHAEKVALSEQLQPYQAGSGAVPAGQTTRYDFTRISPAELYETVEGLVSSGQLGREEGSALLGFISSPRENIGSVPPSNVFQPINVFDTIQQGAAGASSRSEVQNTESLQRAAEALNRFQGQVSSISVYV
>CP026982.1|AYH20660.1|4410524_4411877_+|aspartate-aminotransferase-family-protein
MSELTLLADADERGRRYLVENAQRRVFPDAEALAALARFDEALPQQGFSAEDTLTLLDEVGSPATTASNGPNYFGFVIGAALPIAAASERLMIAWDQCASTFDNSPISATLERLTSRWVLDALNLPKESAVGFGTSATACTLSCLAAARRALLAKQGWDFDNDGLIGAPEIKVVISELTHITVKKALRVLGFGLRHIIVTPVNAFGQIDVTQLPPLNERMILCLQAGEVNTGEFDDFAQIIPTAKAAGAWVHVDGAFGLWARASSHSALTEGIELADSWTTDAHKWLNTPYDCAMAICRSADVLAEAMNADAVYSSAARDAQKNLTLEFSRRPRGIPVWAVLRTLGRDGVAEMIERHCQQATLIAEGLRHAGFEILNRVVLNQVLLRGETDGQTTAIRETLQASGKAWFGGSVWQGRPALRISVSSWRTQDDNVQALITLLTEIKAQTQR
>CP026982.1|AYH21400.1|4409222_4410494_+|MFS-transporter
MKNSPIHTTSSVTEYDLYSKRLPAQTGLPRALVLLFACASALSVANVYYAQPLLDALSVDFHISIAAVGGVMTATQLGCALALILLVPLGDILNRRYLMLAQLSLLIVALIAVGLATTSLYLLIGMLAVGMFGTAMTQGLIAYAATAAAPQERGRVVGAAQGGVVIGLLLARVLSGFIADIAGWRSVYFFSALLMLLLAVFLWRALPHQPPAQQRPHYSALLLSMLILLRKERVLQIRGIIALLMFAALSIFWSALVLLLSREPYFFSHTVIGAFGLVGILGALAAVKAGSLADKGREQWLSGIALLLLLASWLPLWLAPYSLFALVVGIIALDLGGQAIHVTNQSMIFKTHPDAHSRLVGCYMLFYSIGSGLGAMATTVAYDAAGWSGVCFLGAAVSLLALLFWKITRHISASPPAAFTPSR
>CP026982.1|AYH20659.1|4408621_4409068_-|transcriptional-regulator
MVKRKSLKEDVCPVARALDAVGDRWTLLIIRDAFDNRRRFSDFQRSLGVAKNILTDRLRTLVDEGILSVQPVSESSAYQEYVLTPKGEQLFPLVVALRQWGEQQLFAEGESHSLLLDKRTGQPLQAMLPHSAQGQRLVGQDTFVQKID
>CP026982.1|AYH20658.1|4408114_4408612_-|hypothetical-protein
MQTESRETDSDLEAITRYLKKSHVLTLCVGENSELWCASCFYTYDDQQIAFYLMTELHTRHGEIMARLPQVAGTVSGQPKSVMLIKGVQFRAQAVQLEGDDALQARARYNARFPIARASQAPIWRLDLIEVKMTDNMLGFGKKRYWQRDEQTGQKAHDKHEKMRE
>CP026982.1|AYH20657.1|4407434_4408088_-|hypothetical-protein
MSQVLLLGATGLVGHELLELLKVNNRVETIYAPTRKPLMLSDKVVNPYNTDLSAALAQLTEPVDIAFCCLGSTLKTAGSKQAFRYVDYTLVVEGSKVALALGATHLLVVSSLSANATSPFFYSRVKGETEKSLRQQGWQHLTLAQPSMLLGEREDSRTLESLAAPLFRLFPAKWRAIEGKTVAQALLNQAFSPEPKARVTVLESDQLRSLGQWQPLQ
>CP026982.1|AYH20664.1|4416317_4416611_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MSMLVVVTENVPPRLRGRLAVWLLEVRAGVYVGDTSQRVREMVWQQIIELAEQGNVVMAWATNTESGFEFQTWGENRRMPVDLDGLRLVSFSPIENQ
>CP026982.1|AYH20665.1|4416611_4417529_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MYVPLNPIPLKDRVSLIFLQYGQIDVIDGAFVLVDKTGVRTHIPVGSVACIMLEPGTRVSHAAVRLAATVGTLLVWVGEAGVRLYASGQPGGARSDKLLYQAKLALDEELRLKVVRKMFELRFGEPAPSRRSVDQLRGIEGARVRQTYTLLAQQYGVKWNGRRYDPKDWERGDKVNQCISAATSCLYGITEAAVLAAGYAPAIGFVHSGKPLSFVYDIADIIKFEGVVAKAFEIAARNPAEPDREVRLACRDIFRSQKTLSKLIPLIEEVLSAGGITPPLPPDDAQPPAIPEPKPFGDSGHRGQG
>CP026982.1|AYH20666.1|4417556_4418204_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYFSRITLNLNALPHAMATKRLHAGGYASHQWLWQLFPDQPQRSFLFREEEQETKSLFYLLSEQAPQVDHNLFRVETKPYQPQWRDGMTLAFSLRANPVVTRDGKRSDVLMDARHQAKAAGLSGVELWLHQQQRARDWLVRQGENAGFTLSSCCVDGYQRHRLNKPGQSAAIVFSSVDYDGMLHITDAERFAASVQQGLGKSKALGCGLLLLKRA
>CP026982.1|AYH20667.1|4418203_4418938_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MDNYLVFQIYAPLVSWGEAAVGEVRHTSTVPSRSALLGLLAAALGIRRDDRAALTAFNQHYSVAVRPLSDRETWLNDYHTVQMPKENRKVPRYTRRDELRPEAGQSLETMLTSREYRCDAYYHIAISVTPDAPYSLTALRDALLSPVFALYFGRKSCPPALPLAPHLFSGSLAEVWQQARQTPALNDLALQLIGRAEGLCYWEQESDTGLTPQYRVVRNDQPADRRRWQFTSRVQYVGSEKGEE
>CP026982.1|AYH20668.1|4418947_4420015_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTFIQLHFLTAYPSSNLNRDDAGRPKTAMVGGVERLRVSSQSLKRAWRTSEVFEDALDGHIGTRSRRVGREVYNALIARGMVEKLADKAALSIAAQFGKPKKEEKDSKDPLEKYDIEQLAHISVQEKARIDRLIAQLATESREPNSEELKLLRKDAASVDIALFGRMLASSPEFNIEAACQVAHALGVSAVTIEDDFFTAVDDLNTAADSGSAHMGEQSFASALFYHYVCINRDLLLENLNNDEDLVARTLRALTETALTVSPGGKQNSFASRALATYALAEKGTDQPRTLSVAFFKPIRSADQVNDAIDLLCQQKAKFDRVYASGGCVPSYELNVEATNEGGSLQGLLDFISQ
>CP026982.1|AYH20669.1|4420018_4420654_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MANTADFLVITKDDAKKINDWFDGLQNRHGTPGNGRARRAELRRAKQPPYGVLTCQGYHDLAGKLAARLTQEHHIVALAMFVSVAAHAEKNMLKTSFAAQLGEKQGGDRPFLSPLRFERLQRAQTPEELHRQLFRAVQIRGEAGVNLPSLADGIFLWVEEWQARQENRAPNLHPLRRNAVRWACEYARASQNITPDEPDTTETSTTASDKE
>CP026982.1|AYH20670.1|4420637_4422206_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MFSLIEEPWLPAVFADGRMSNISPLQLPDDNIIDLAWTRADFQGASYQLLIGLLQTAYAPADDDDWDAIWEDGLGTDFSQALAALAPAMQFGAQKPAFMQDFATLDSDPTPISGLLIDAPGGNTLKLNKDHFIKRGTVNAICPHCAARALFTLQTNAPSGGQGHRTGMRGGGPITTLLMQEDARLPLWKKLWMNVLTQKVMPKGKPDATVFPWLAATPTSDGTHPPVTPENSHQLQAYWGMPRRIELDFTTLQTGECDLCGTESTALLTQYRTKNYGIQYDSWRHPLTPYRRALKGDDAPFLSVKGQPGGLAYRDWLGMMVSVEDKLNHTYPAAVVQHNAGKRALRNAGLWCFGYDMDNMKARCWYEHHVPLLFSPARFQSDALSLREYKDHLQLAVELARDSATLLRQMIKEAWFSRPKDAKGDFSAIDVAFWQETQPDFMRLCRSLAQGDTPATTLNIWKKSLYRYLLNNYDTRVFSNPDEHRDLAKAAETRKKLSVFFGKQKAAETIKQMQEAVDGEHG
>CP026982.1|AYH20671.1|4422469_4422685_-|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MRFFDGHPAVIAFDSEIEMFRGEFIGLNGGADFYAYSVDELKKEGATSLAIFLLAVCPRWRGERKKDLISS
>CP026982.1|AYH20672.1|4422739_4425463_-|CRISPR-associated-helicase/endonuclease-Cas3
MDKEGIIDRRYFHYWGKANRSTDALVGDDYHLLPYHCLDVAACGYFLLKGNYFQASHVLRELASGDDDVAPWFAYFLAWHDIGKFARGFQRKYINPDSPLVQSSGQVDTARHDALGFWLWQERDDFPDLLPFSADMLTSDSQKTLDIWLNIVTGHHGKPPEVVKKGSLAFHRDDYRAVQDYLHDVATCFPEVSVFPMCFANKSWRNRLKQQSWGLAGLTVLADWLGSRQQDFWYCSTPMPLETYWREHALPIAEKVVSRLPRTPSPASFHSIQRLFPFMQQPTPLQQKALEADISADGPQLFILEDVTGAGKTEAAMILAHRLMAQRKASGIYVGLPTMATANAMYKRLAQAYRALYSPEHNPSLMLAHGARHMSSAFMQSLWEGDSQGQAQYDKEENAASKDCNIWFADSRKKALLADIGVGTLDQALMAVMPFRHQSLRVLGLQNKLLILDEVHAYDAYMSKLIELLIGFHAQQGGSVIILTATLPLTLREKLTRAFAQGIACEAAPPDPNATYPWLTQLTREGLRETKLETRKEVRREVKIGWLTERLQGIDCVKAAVAAGQSIAWIRNTVDDAIAVYRQLIEAGVAEDNMLLFHSRFAFCDRMAIEERALAWFGKDSMPDERAGKVLIATQVVEQSLDIDVDNMISDLAPIDLLIQRAGRLQRHIRFLDGRRKTEADATPLTDERPAAVLHIMAPVWQPEAEADWLGDELRNSGYVYPDHAALWRTQAMLRECGAIKMPEAARLLINSVYEEQIAVPPALEAIANKVLGERYGQRSVASQSSLALVHGYCAQSSEAGWSDAVDISTRLGEETLDLYLAWKPENDGELPQPYAISDTFAWEQSRVQVRVSWWQKRKTGLPILEGEALERFRQQLHRPQAEVLLLHRGENHAFYSEQVGLMLLGS
>CP026982.1|AYH20673.1|4425490_4426042_-|polymer-forming-cytoskeletal-protein
MFSFDKNKKDVKEPQGRSEINNSPAISPSNELINSVNPVRVKKDTFISQGARMTGSLSVDGNITVEGQVEGDVQCDNTIKVEHTGQVNGEMKSQQIVINGRVEGRVVASVVAILAQGKVFGDIFTDELSIEKGGIFTGQSHPLTPPTQNQEKLTYVEKKKEKTSKAPAEQENVVALAGSTPTA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP026982_3	3.9\|903048\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903048-903079	32	NC_019522	Pectobacterium phage ZF40, complete genome	12920-12951	0	1.0
CP026982_8	8.5\|4415441\|32\|CP026982\|CRISPRCasFinder,CRT	4415441-4415472	32	NC_019522	Pectobacterium phage ZF40, complete genome	46233-46264	0	1.0
CP026982_8	8.21\|4415441\|33\|CP026982\|PILER-CR	4415441-4415473	33	NC_019522	Pectobacterium phage ZF40, complete genome	46232-46264	0	1.0
CP026982_2	2.17\|884721\|32\|CP026982\|CRISPRCasFinder,CRT	884721-884752	32	JX195166	Pectobacterium phage My1, complete genome	6017-6048	1	0.969
CP026982_2	2.17\|884721\|32\|CP026982\|CRISPRCasFinder,CRT	884721-884752	32	JX195166	Pectobacterium phage My1, complete genome	115187-115218	1	0.969
CP026982_2	2.41\|884724\|32\|CP026982\|PILER-CR	884724-884755	32	JX195166	Pectobacterium phage My1, complete genome	6017-6048	1	0.969
CP026982_2	2.41\|884724\|32\|CP026982\|PILER-CR	884724-884755	32	JX195166	Pectobacterium phage My1, complete genome	115187-115218	1	0.969
CP026982_3	3.7\|902928\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902928-902959	32	NZ_CP021004	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence	16192-16223	1	0.969
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026273	Klebsiella oxytoca strain KONIH4 plasmid pKOX-ea2b, complete sequence	66512-66539	1	0.964
CP026982_2	2.1\|883758\|32\|CP026982\|CRISPRCasFinder,CRT	883758-883789	32	NZ_CP026273	Klebsiella oxytoca strain KONIH4 plasmid pKOX-ea2b, complete sequence	174074-174105	2	0.938
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	JX195166	Pectobacterium phage My1, complete genome	5031-5062	2	0.938
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	JX195166	Pectobacterium phage My1, complete genome	114201-114232	2	0.938
CP026982_2	2.12\|884420\|32\|CP026982\|CRISPRCasFinder,CRT	884420-884451	32	JX195166	Pectobacterium phage My1, complete genome	2451-2482	2	0.938
CP026982_2	2.12\|884420\|32\|CP026982\|CRISPRCasFinder,CRT	884420-884451	32	JX195166	Pectobacterium phage My1, complete genome	111621-111652	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP015073	Escherichia coli strain Ecol_743 plasmid pEC743_4, complete sequence	22902-22933	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_KM670336	Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence	151675-151706	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP045255	Proteus mirabilis strain L90-1 plasmid pL902, complete sequence	20890-20921	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	AP018710	Uncultured bacterium plasmid pSN1216-29 DNA, complete sequence	31042-31073	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP021021	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence	21254-21285	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP046349	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed2, complete sequence	30003-30034	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP021004	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence	32856-32887	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	KC170285	Uncultured bacterium plasmid pMBUI2, complete sequence	6489-6520	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP014764	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-704, complete sequence	30592-30623	2	0.938
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	NZ_CP020602	Pseudomonas aeruginosa strain E6130952 plasmid pJHX613, complete sequence	32041-32072	2	0.938
CP026982_2	2.20\|884902\|32\|CP026982\|CRISPRCasFinder,CRT	884902-884933	32	JX195166	Pectobacterium phage My1, complete genome	2748-2779	2	0.938
CP026982_2	2.20\|884902\|32\|CP026982\|CRISPRCasFinder,CRT	884902-884933	32	JX195166	Pectobacterium phage My1, complete genome	111918-111949	2	0.938
CP026982_2	2.24\|885143\|33\|CP026982\|CRISPRCasFinder,CRT	885143-885175	33	JX195166	Pectobacterium phage My1, complete genome	2908-2940	2	0.939
CP026982_2	2.24\|885143\|33\|CP026982\|CRISPRCasFinder,CRT	885143-885175	33	JX195166	Pectobacterium phage My1, complete genome	112078-112110	2	0.939
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	JX195166	Pectobacterium phage My1, complete genome	7785-7816	2	0.938
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	JX195166	Pectobacterium phage My1, complete genome	116955-116986	2	0.938
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	JX195166	Pectobacterium phage My1, complete genome	5031-5062	2	0.938
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	JX195166	Pectobacterium phage My1, complete genome	114201-114232	2	0.938
CP026982_2	2.36\|884423\|32\|CP026982\|PILER-CR	884423-884454	32	JX195166	Pectobacterium phage My1, complete genome	2451-2482	2	0.938
CP026982_2	2.36\|884423\|32\|CP026982\|PILER-CR	884423-884454	32	JX195166	Pectobacterium phage My1, complete genome	111621-111652	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP015073	Escherichia coli strain Ecol_743 plasmid pEC743_4, complete sequence	22902-22933	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_KM670336	Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence	151675-151706	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP045255	Proteus mirabilis strain L90-1 plasmid pL902, complete sequence	20890-20921	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	AP018710	Uncultured bacterium plasmid pSN1216-29 DNA, complete sequence	31042-31073	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP021021	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence	21254-21285	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP046349	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed2, complete sequence	30003-30034	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP021004	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence	32856-32887	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	KC170285	Uncultured bacterium plasmid pMBUI2, complete sequence	6489-6520	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP014764	Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-704, complete sequence	30592-30623	2	0.938
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	NZ_CP020602	Pseudomonas aeruginosa strain E6130952 plasmid pJHX613, complete sequence	32041-32072	2	0.938
CP026982_2	2.44\|884905\|32\|CP026982\|PILER-CR	884905-884936	32	JX195166	Pectobacterium phage My1, complete genome	2748-2779	2	0.938
CP026982_2	2.44\|884905\|32\|CP026982\|PILER-CR	884905-884936	32	JX195166	Pectobacterium phage My1, complete genome	111918-111949	2	0.938
CP026982_2	2.48\|885146\|33\|CP026982\|PILER-CR	885146-885178	33	JX195166	Pectobacterium phage My1, complete genome	2908-2940	2	0.939
CP026982_2	2.48\|885146\|33\|CP026982\|PILER-CR	885146-885178	33	JX195166	Pectobacterium phage My1, complete genome	112078-112110	2	0.939
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	JX195166	Pectobacterium phage My1, complete genome	7785-7816	2	0.938
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	JX195166	Pectobacterium phage My1, complete genome	116955-116986	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034939	Pectobacterium odoriferum strain JK2.1 plasmid p.Jk2_1, complete sequence	87221-87252	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP021658	Aeromonas salmonicida strain O23A plasmid pO23AP4, complete sequence	6779-6810	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022182	Aeromonas salmonicida strain S68 plasmid pS68-1, complete sequence	31542-31573	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017144	Aeromonas salmonicida subsp. masoucida strain RFAS1 plasmid unnamed1, complete sequence	14485-14516	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022177	Aeromonas salmonicida strain S44 plasmid pS44-2, complete sequence	50323-50354	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022171	Aeromonas salmonicida strain S121 plasmid pS121-2, complete sequence	27683-27714	2	0.938
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP054213	Erwiniaceae bacterium PD-1 plasmid pPD-1, complete sequence	71004-71035	2	0.938
CP026982_3	3.7\|902928\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902928-902959	32	NZ_CP021021	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence	2580-2611	2	0.938
CP026982_3	3.7\|902928\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902928-902959	32	NZ_CP021021	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence	34917-34948	2	0.938
CP026982_3	3.7\|902928\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902928-902959	32	NZ_CP046349	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed2, complete sequence	10073-10104	2	0.938
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KT033470	Aeromonas salmonicida subsp. salmonicida strain JF2267 plasmid pAsa4c, complete sequence	145739-145766	2	0.929
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_AP019196	Aeromonas caviae strain GSH8M-1 plasmid pGSH8M-1-1, complete sequence	117507-117534	2	0.929
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP022176	Aeromonas salmonicida strain S44 plasmid pS44-1, complete sequence	154200-154227	2	0.929
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	NC_047887	Pectobacterium phage DU_PP_V, complete genome	4541-4572	3	0.906
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	NC_047887	Pectobacterium phage DU_PP_V, complete genome	4541-4572	3	0.906
CP026982_3	3.7\|902928\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902928-902959	32	KC170285	Uncultured bacterium plasmid pMBUI2, complete sequence	29189-29220	3	0.906
CP026982_3	3.13\|903288\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903288-903319	32	MN602881	Erwinia phage Midgardsormr38, complete genome	6155-6186	3	0.906
CP026982_3	3.13\|903288\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903288-903319	32	MN856003	Bacteriophage sp. isolate 1, complete genome	17362-17393	3	0.906
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	MN095770	Serratia phage Slocum, complete genome	5881-5912	4	0.875
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	MN095770	Serratia phage Slocum, complete genome	5881-5912	4	0.875
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP054046	Yersinia massiliensis strain 2011N-4075 plasmid unnamed1, complete sequence	73998-74029	4	0.875
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_022540	Xanthomonas citri pv. fuscans plasmid plb, complete sequence	8740-8771	4	0.875
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP021009	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pB, complete sequence	19107-19138	4	0.875
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP020995	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pB, complete sequence	20247-20278	4	0.875
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP021005	Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pB, complete sequence	10712-10743	4	0.875
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP050010	Citrobacter sp. Y3 plasmid unnamed1, complete sequence	1978-2009	4	0.875
CP026982_3	3.19\|903648\|25\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903648-903672	25	MT233524	Salmonella phage vB_Sen_I1, complete genome	45947-45971	4	0.84
CP026982_3	3.32\|904421\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904421-904452	32	JX195166	Pectobacterium phage My1, complete genome	3549-3580	4	0.875
CP026982_3	3.32\|904421\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904421-904452	32	JX195166	Pectobacterium phage My1, complete genome	112719-112750	4	0.875
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041048	Citrobacter sp. CF971 plasmid pBM527-2, complete sequence	121752-121779	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN783744	Klebsiella oxytoca plasmid pFDL-VIM, complete sequence	13353-13380	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP022274	Citrobacter freundii strain 18-1 plasmid pA18-1, complete sequence	123475-123502	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP042536	Citrobacter freundii strain E51 plasmid pE51_002, complete sequence	124148-124175	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	227143-227170	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP034714	Salmonella enterica subsp. enterica serovar Mikawasima strain RSE15 plasmid pRSE15, complete sequence	110197-110224	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP010360	Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence	2316-2343	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	206811-206838	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN783743	Escherichia coli plasmid pGA_VIM, complete sequence	25599-25626	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP034084	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-VIM, complete sequence	126225-126252	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH220284	Aeromonas sp. pRIVM0001_VIM-1 plasmid pRIVM0001_VIM-1_171012_B12, complete sequence	131224-131251	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MG228427	Kluyvera cryocrescens strain BO64W plasmid pKC-BO-N1-VIM, complete sequence	113431-113458	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH325469	Enterobacter hormaechei strain Ec13 plasmid pEc13, complete sequence	219666-219693	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH325468	Enterobacter hormaechei strain Ec09 plasmid pEc09, complete sequence	136021-136048	4	0.857
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH594478	Citrobacter freundii strain AA593 plasmid pIBAC_Incx3_A/C, complete sequence	4525-4552	4	0.857
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP016446	Pseudomonas putida strain IEC33019 plasmid pIEC33019, complete sequence	31194-31225	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_010891	Pseudomonas sp. CT14 plasmid pCT14, complete sequence	15357-15388	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029092	Pseudomonas aeruginosa strain AR441 plasmid unnamed2, complete sequence	30804-30835	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP027168	Pseudomonas aeruginosa strain AR_0356 plasmid unnamed1, complete sequence	2247-2278	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019906	Pseudomonas putida HB3267 plasmid pPC9, complete sequence	49105-49136	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	MN961669	Pseudomonas monteilii strain 918607 plasmid p918607-IMP, complete sequence	11667-11698	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK671725	Pseudomonas mosselii strain AM/94 plasmid pMOS94, complete sequence	10477-10508	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK047610	Pseudomonas aeruginosa strain 163940 plasmid pTROUS1, complete sequence	35053-35084	5	0.844
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029374	Acidovorax citrulli strain M6 plasmid pACM6, complete sequence	46952-46983	5	0.844
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KT935446	Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence	153870-153897	5	0.821
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KP276584	Escherichia coli strain 39R861 plasmid p39R861-4, complete sequence	140588-140615	5	0.821
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_012885	Aeromonas hydrophila plasmid pRA1, complete sequence	126961-126988	5	0.821
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_012886	Escherichia coli plasmid pRAx, complete sequence	50840-50867	5	0.821
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	AP014939	Citrobacter freundii plasmid pKHM-1 DNA, complete sequence, strain: KHM 243	142507-142534	5	0.821
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_AP018687	Vibrio rumoiensis strain FERM P-14531 plasmid 1, complete sequence	70047-70074	5	0.821
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	NC_007603	Enterobacteria phage RTP, complete genome	13526-13557	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	KY398841	Escherichia phage vB_Ecos_CEB_EC3a, complete genome	11644-11675	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	KF771238	Escherichia phage bV_EcoS_AHS24, complete genome	8310-8341	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	KF771237	Escherichia phage bV_EcoS_AHP42, complete genome	8309-8340	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	AM156909	Bacteriophage RTP, complete genome	13526-13557	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	NC_024789	Escherichia phage bV_EcoS_AKS96, complete genome	8309-8340	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	MG065688	UNVERIFIED: Campylobacter phage A110b, complete genome	2113-2144	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	NC_019404	Enterobacteria phage vB_EcoS_ACG-M12, complete genome	10457-10488	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	MK372342	Enterobacteria phage vB_EcoS_IME542, complete genome	26207-26238	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	KF771236	Escherichia phage bV_EcoS_AHP24, complete genome	8309-8340	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	GQ495225	Escherichia phage RES-2009a putative terminase large subunit (halo21), putative portal protein (halo23), putative phage head morphogenesis protein (halo24), Halo25 (halo25), putative phage protein rtp26 (halo26), Halo27 (halo27), Halo28 (halo28), Halo29 (halo29), and Halo30 (halo30) genes, complete cds	6292-6323	5	0.844
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	NC_047893	Escherichia phage DTL, complete genome	19826-19857	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	NC_007603	Enterobacteria phage RTP, complete genome	13526-13557	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	KY398841	Escherichia phage vB_Ecos_CEB_EC3a, complete genome	11644-11675	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	KF771238	Escherichia phage bV_EcoS_AHS24, complete genome	8310-8341	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	KF771237	Escherichia phage bV_EcoS_AHP42, complete genome	8309-8340	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	AM156909	Bacteriophage RTP, complete genome	13526-13557	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	NC_024789	Escherichia phage bV_EcoS_AKS96, complete genome	8309-8340	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	MG065688	UNVERIFIED: Campylobacter phage A110b, complete genome	2113-2144	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	NC_019404	Enterobacteria phage vB_EcoS_ACG-M12, complete genome	10457-10488	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	MK372342	Enterobacteria phage vB_EcoS_IME542, complete genome	26207-26238	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	KF771236	Escherichia phage bV_EcoS_AHP24, complete genome	8309-8340	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	GQ495225	Escherichia phage RES-2009a putative terminase large subunit (halo21), putative portal protein (halo23), putative phage head morphogenesis protein (halo24), Halo25 (halo25), putative phage protein rtp26 (halo26), Halo27 (halo27), Halo28 (halo28), Halo29 (halo29), and Halo30 (halo30) genes, complete cds	6292-6323	5	0.844
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	NC_047893	Escherichia phage DTL, complete genome	19826-19857	5	0.844
CP026982_2	2.1\|883758\|32\|CP026982\|CRISPRCasFinder,CRT	883758-883789	32	LR134127	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7	130841-130872	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MN434096	Klebsiella phage JIPh_Kp127, complete genome	4047-4078	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MN163280	Klebsiella phage KpGranit, complete genome	4370-4401	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MN163280	Klebsiella phage KpGranit, complete genome	116980-117011	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MK630230	Klebsiella phage Spivey, complete genome	6420-6451	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MN434094	Klebsiella phage AmPh_EK80, complete genome	4056-4087	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	4366-4397	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	117579-117610	6	0.812
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MN101228	Klebsiella phage KPN4, complete genome	103356-103387	6	0.812
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	MG969413	UNVERIFIED: Salmonella phage GE_vB_N8, complete genome	16997-17028	6	0.812
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	NC_047835	Escherichia phage OSYSP, complete genome	82788-82819	6	0.812
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	NC_048853	Phage NBEco001, complete genome	1716-1747	6	0.812
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	NC_048853	Phage NBEco001, complete genome	110208-110239	6	0.812
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	MG969412	UNVERIFIED: Salmonella phage GE_vB_N5, complete genome	114198-114229	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	JX195166	Pectobacterium phage My1, complete genome	11957-11988	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	JX195166	Pectobacterium phage My1, complete genome	121127-121158	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	NC_047882	Vibrio phage JSF12, complete genome	53998-54029	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	KY883654	Vibrio phage JSF10, complete genome	91510-91541	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	KP280063	Vibrio phage phi 3, complete genome	4296-4327	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	KP280063	Vibrio phage phi 3, complete genome	112665-112696	6	0.812
CP026982_2	2.25\|885204\|32\|CP026982\|CRISPRCasFinder,CRT	885204-885235	32	KP280062	Vibrio phage phi 1, complete genome	66635-66666	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MN434096	Klebsiella phage JIPh_Kp127, complete genome	4047-4078	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MN163280	Klebsiella phage KpGranit, complete genome	4370-4401	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MN163280	Klebsiella phage KpGranit, complete genome	116980-117011	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MK630230	Klebsiella phage Spivey, complete genome	6420-6451	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MN434094	Klebsiella phage AmPh_EK80, complete genome	4056-4087	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	4366-4397	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	117579-117610	6	0.812
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MN101228	Klebsiella phage KPN4, complete genome	103356-103387	6	0.812
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	MG969413	UNVERIFIED: Salmonella phage GE_vB_N8, complete genome	16997-17028	6	0.812
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	NC_047835	Escherichia phage OSYSP, complete genome	82788-82819	6	0.812
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	NC_048853	Phage NBEco001, complete genome	1716-1747	6	0.812
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	NC_048853	Phage NBEco001, complete genome	110208-110239	6	0.812
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	MG969412	UNVERIFIED: Salmonella phage GE_vB_N5, complete genome	114198-114229	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	JX195166	Pectobacterium phage My1, complete genome	11957-11988	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	JX195166	Pectobacterium phage My1, complete genome	121127-121158	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	NC_047882	Vibrio phage JSF12, complete genome	53998-54029	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	KY883654	Vibrio phage JSF10, complete genome	91510-91541	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	KP280063	Vibrio phage phi 3, complete genome	4296-4327	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	KP280063	Vibrio phage phi 3, complete genome	112665-112696	6	0.812
CP026982_2	2.49\|885207\|32\|CP026982\|PILER-CR	885207-885238	32	KP280062	Vibrio phage phi 1, complete genome	66635-66666	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK033500	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj58k plasmid pConj58k, complete sequence	24595-24626	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK033501	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence	72894-72925	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044976	Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence	201720-201751	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP027261	Pectobacterium parmentieri strain IFB5427 plasmid pPAR01, complete sequence	52309-52340	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022492	Salmonella enterica subsp. enterica serovar Saintpaul strain SA20031783 plasmid unnamed1, complete sequence	110697-110728	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014305	Erwinia billingiae Eb661 plasmid pEB170, complete sequence	129071-129102	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010187	Escherichia coli strain M6 plasmid A, complete genome	9901-9932	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010207	Escherichia coli strain M11 plasmid A, complete sequence	103876-103907	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010197	Escherichia coli strain M9 plasmid A, complete genome	9901-9932	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_021871	Salmonella bongori N268-08 plasmid RM1, complete sequence	44897-44928	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010222	Escherichia coli strain M19 plasmid A, complete sequence	9901-9932	6	0.812
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010214	Escherichia coli strain M15 plasmid A, complete sequence	124731-124762	6	0.812
CP026982_3	3.5\|902808\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902808-902839	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1638459-1638490	6	0.812
CP026982_6	6.1\|4150172\|28\|CP026982\|CRISPRCasFinder	4150172-4150199	28	CP002962	Emticicia oligotrophica DSM 17448 plasmid pEMTOL01, complete sequence	77487-77514	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_AP022377	Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence	136416-136443	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LC507075	Providencia rettgeri strain BML2526 plasmid p.BML2526, complete sequence	188453-188480	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026281	Klebsiella oxytoca strain KONIH2 plasmid pKOR-01e8, complete sequence	183771-183798	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KX709966	Pseudomonas aeruginosa strain IP40a plasmid pIP40a, complete sequence	146698-146725	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KX869741	Enterobacter cloacae strain 20130723 plasmid R222, complete sequence	161800-161827	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY399978	Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence	130862-130889	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY986974	Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence	173970-173997	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887592	Citrobacter freundii strain Cf52 plasmid pCf52, complete sequence	204131-204158	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887593	Citrobacter freundii strain Cf53 plasmid pCf53, complete sequence	185248-185275	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887594	Klebsiella pneumoniae strain Kp55 plasmid pKp55, complete sequence	200326-200353	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_022652	Klebsiella pneumoniae strain CRE114 plasmid pIMP-PH114, complete sequence	135500-135527	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP033514	Vibrio cholerae strain E4 plasmid pVCR94, complete sequence	81913-81940	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009414	Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence	149714-149741	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	132278-132305	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KX156772	Escherichia coli strain K-12 plasmid IP40a, complete sequence	149569-149596	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KX156773	Escherichia coli strain K-12 plasmid R16a, complete sequence	157892-157919	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KX029331	Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence	140184-140211	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	136666-136693	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009412	Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence	88375-88402	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009411	Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence	151287-151314	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	159478-159505	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KJ909290	Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence	135831-135858	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KM083064	Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence	108525-108552	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KR559888	Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence	143773-143800	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KR559889	Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence	137921-137948	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KM670336	Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence	129394-129421	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KP975074	Citrobacter freundii strain MRSN11938 plasmid pMRVIM0912, complete sequence	86373-86400	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KR559890	Enterobacter cloacae strain Ecl4873 plasmid pEcl-Gr4873, complete sequence	138756-138783	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KP056256	Escherichia coli strain YDC637 plasmid pYDC637, complete sequence	181807-181834	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KP345882	Escherichia coli strain BK32533 plasmid pBK32533, complete sequence	73986-74013	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	AP014611	Serratia marcescens plasmid p11663 DNA, complete sequence, strain: 11663	138118-138145	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	389875-389902	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	125844-125871	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025141	Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence	91672-91699	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032391	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence	97391-97418	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP017987	Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence	16884-16911	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP017387	Klebsiella pneumoniae strain KP36 plasmid 2, complete sequence	94106-94133	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP047308	Citrobacter freundii strain L75 plasmid pCf75, complete sequence	129912-129939	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	41413-41440	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP010373	Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence	167402-167429	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP048305	Escherichia coli strain 9 plasmid p009_A, complete sequence	143305-143332	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025240	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence	131371-131398	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025242	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence	82884-82911	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC055503	Klebsiella pneumoniae plasmid pHM881QN DNA, complete sequence, strain: Y881	144338-144365	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024192	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence	201501-201528	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN477204	Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence	69992-70019	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP017058	Citrobacter freundii strain SL151 plasmid unnamed1, complete sequence	119809-119836	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP020513	Escherichia coli strain 165 plasmid unnamed4, complete sequence	10961-10988	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LS992184	Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence	51342-51369	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018716	Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence	7313-7340	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018722	Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence	46147-46174	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018704	Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence	71150-71177	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP029249	Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence	110045-110072	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_008612	Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence	102195-102222	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025470	Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence	27960-27987	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP022359	Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence	125266-125293	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT904892	Salmonella enterica subsp. enterica serovar Typhi strain 80-2002 plasmid 2	30131-30158	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP029802	Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_90k, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP008790	Klebsiella oxytoca KONIH1 plasmid pKOX-86d, complete sequence	177385-177412	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP027038	Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence	34346-34373	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP028316	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-2, complete sequence	67076-67103	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	CP009868	Pantoea sp. PSNIH2 plasmid pPSP-100, complete sequence	93764-93791	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP012682	Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence	144936-144963	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP042646	Escherichia coli strain NCYU-21-79 plasmid pNCYU-21-79-1, complete sequence	164359-164386	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP031549	Escherichia coli strain cq9 plasmid unnamed3, complete sequence	140406-140433	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032385	Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence	2539-2566	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032388	Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_1, complete sequence	72685-72712	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC556210	Enterobacter cloacae CC23 plasmid pCC23 DNA, complete sequence	23732-23759	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC556211	Enterobacter cloacae CC32 plasmid pCC32 DNA, complete sequence	150157-150184	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC556212	Klebsiella pneumoniae CC37 plasmid pCC37 DNA, complete sequence	24486-24513	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC556213	Escherichia coli S44 plasmid pS44 DNA, complete sequence	24800-24827	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP022063	Salmonella enterica strain FDAARGOS_312 plasmid unnamed3, complete sequence	22798-22825	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN175387	Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence	182760-182787	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP014978	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence	132086-132113	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_008613	Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence	96649-96676	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP031564	Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence	15497-15524	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032397	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence	165767-165794	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP027055	Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2	34350-34377	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN254970	Escherichia coli strain EC009 plasmid pEC009.1, complete sequence	151232-151259	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	CP052444	Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence	148153-148180	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP014658	Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence	144188-144215	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP043190	Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence	149300-149327	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025231	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence	143003-143030	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026552	Citrobacter sp. SL156 plasmid unnamed3	194338-194365	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP039562	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014847 plasmid p08-5333.1, complete sequence	71195-71222	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP038330	Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence	76308-76335	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP038326	Escherichia coli O157:H7 strain NE 1169-1 plasmid pNE1169-3, complete sequence	52088-52115	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP030077	Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence	154606-154633	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041083	Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence	162869-162896	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP043215	Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence	149300-149327	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP031362	Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p3, complete sequence	8763-8790	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KU160531	Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence	158905-158932	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP038322	Escherichia coli O157:H7 strain NE1127 plasmid pNE1127-2, complete sequence	128989-129016	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_016974	Providencia stuartii plasmid pMR0211, complete sequence	163076-163103	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP008824	UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKEC-39c, complete sequence	303636-303663	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041103	Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed4, complete sequence	66470-66497	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN310369	Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-Ct1/2, complete sequence	137864-137891	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN310370	Klebsiella pneumoniae strain 11935 plasmid p11935-Ct1/2, complete sequence	137864-137891	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN310378	Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence	163427-163454	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP021835	Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence	149569-149596	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP021956	Klebsiella pneumoniae strain AR_0107 plasmid unitig_1_pilon, complete sequence	79248-79275	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009560	Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence	76927-76954	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045459	Salmonella enterica subsp. enterica serovar Anatum strain M-3471 plasmid pM-3471_DHA, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_022372	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence	79507-79534	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041641	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MCR1, complete sequence	28327-28354	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026207	Escherichia coli strain ECONIH5 plasmid pECO-dc1b, complete sequence	182782-182809	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009562	Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence	42161-42188	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP031802	Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence	111889-111916	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP040024	Klebsiella pneumoniae strain KPC160132 plasmid pIncC-L132, complete sequence	128047-128074	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045517	Salmonella enterica subsp. enterica serovar Anatum strain Sal-4737 plasmid pSal-4737_DHA, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045520	Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_DHA, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045462	Salmonella enterica subsp. enterica serovar Anatum strain M-3851 plasmid pM-3851_DHA, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045467	Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045510	Salmonella enterica subsp. enterica serovar Anatum strain M-5360 plasmid pM-5360_DHA, complete sequence	13492-13519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_023291	Vibrio cholerae strain BI144 plasmid pVCR94deltaX, complete sequence	105048-105075	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP007732	Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKEC-dc3, complete sequence	251994-252021	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP028996	Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence	120696-120723	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP006029	Escherichia coli O145:H28 str. RM13514 plasmid pRM13514, complete sequence	18224-18251	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP040039	Klebsiella pneumoniae strain KPC160125 plasmid pIncC-L125	149029-149056	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP040034	Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence	148463-148490	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP038464	Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence	76365-76392	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP027043	Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence	84725-84752	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP007137	Escherichia coli O145:H28 str. RM12581 plasmid pRM12581, complete sequence	18225-18252	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP047350	Proteus cibarius strain ZN2 plasmid pZN2-tetX-171kb, complete sequence	154868-154895	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_009140	Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence	161263-161290	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP038466	Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence	37541-37568	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_AP019688	Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-1, complete sequence	168971-168998	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_009139	Yersinia ruckeri YR71 plasmid pYR1, complete sequence	142757-142784	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_021667	Klebsiella pneumoniae plasmid IncA/C-LS6, complete sequence	11612-11639	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP003998	Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13e, complete sequence	80771-80798	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP047345	Proteus vulgaris strain ZN3 plasmid pZN3-tetX-171kb, complete sequence	154866-154893	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP047353	Proteus mirabilis strain ZA25 plasmid pZA25-tetX-168kb, complete sequence	152172-152199	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026405	Escherichia coli strain ECONIH4 plasmid pECO-c85f, complete sequence	61946-61973	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_017645	Escherichia coli UMNK88 plasmid pUMNK88, complete sequence	145361-145388	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009567	Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence	92076-92103	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP007636	Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence	1632-1659	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032450	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence	13618-13645	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_012690	Escherichia coli plasmid peH4H, complete sequence	132894-132921	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032238	Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence	146023-146050	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024557	Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence	200111-200138	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041172	Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence	35587-35614	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024529	Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence	201501-201528	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP011429	Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence	141112-141139	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018457	Shewanella algae strain CCU101 plasmid unnamed, complete sequence	31985-32012	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MK638972	Escherichia coli J53 plasmid pMG252, complete sequence	130235-130262	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP016013	Salmonella enterica subsp. enterica serovar Newport strain CFSAN003890 plasmid pCFSAN003890, complete sequence	130009-130036	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032491	Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence	132358-132385	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032496	Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence	74258-74285	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024522	Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence	201501-201528	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP011540	Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence	81158-81185	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_019065	Escherichia coli plasmid pPG010208, complete sequence	120592-120619	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	CP028804	Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence	307595-307622	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP017084	Proteus mirabilis strain T21 plasmid pT212, complete sequence	8760-8787	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP040029	Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence	148463-148490	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KY014464	Vibrio parahaemolyticus plasmid pVPS129, complete sequence	7823-7850	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KY014465	Vibrio parahaemolyticus plasmid pVPS114, complete sequence	103192-103219	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KY014466	Vibrio vulnificus plasmid pVVS1-per1, complete sequence	70345-70372	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP031122	Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence	55189-55216	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP019001	Escherichia coli strain Ecol_AZ155 plasmid pECAZ155_KPC, complete sequence	109513-109540	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP023724	Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed2, complete sequence	21151-21178	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_016976	Klebsiella pneumoniae plasmid pR55, complete sequence	155608-155635	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP044075	Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence	125040-125067	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026225	Aeromonas sp. ASNIH3 plasmid pKPC-8e09, complete sequence	173742-173769	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025275	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923	97378-97405	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC536681	Klebsiella pneumoniae MyNCGM076 plasmid pMyNCGM076, complete sequence	142618-142645	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC536682	Klebsiella pneumoniae MyNCGM079 plasmid pMyNCGM079, complete sequence	142618-142645	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KM506769	Uncultured bacterium plasmid pKAZ1, complete sequence	108496-108523	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045016	Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-1, complete sequence	65900-65927	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP021853	Proteus mirabilis strain AR_0156 plasmid unitig_1, complete sequence	22546-22573	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP017055	Providencia stuartii strain BE2467 plasmid pPS1, complete sequence	162165-162192	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	CP028419	Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence	109196-109223	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024550	Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence	170037-170064	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018318	Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence	25561-25588	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN823987	Escherichia coli strain 2016061604 plasmid p6061604-KPC, complete sequence	43066-43093	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KR827391	Uncultured bacterium plasmid pKAZ2, complete sequence	120418-120445	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KR827392	Uncultured bacterium plasmid pKAZ3, complete sequence	104990-105017	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	KR827394	Uncultured bacterium plasmid pKAZ5, complete sequence	95685-95712	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP007558	Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence	255957-255984	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025236	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence	107391-107418	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_AP018672	Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-1, complete sequence	136376-136403	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009570	Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence	88378-88405	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009564	Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence	41766-41793	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009563	Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence	44420-44447	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_AP019818	Enterobacter hormaechei subsp. hoffmannii strain OIPH-N069 plasmid pN069_1, complete sequence	120485-120512	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP041209	Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence	86538-86565	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP014295	Klebsiella pneumoniae strain KP38731 plasmid unnamed1, complete sequence	62780-62807	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP031106	Escherichia coli strain AMSCJX02 plasmid pAMSC1, complete sequence	124927-124954	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018689	Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence	77-104	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_019107	Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_174, complete sequence	159328-159355	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_019116	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence	119957-119984	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_019118	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence	120212-120239	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_019121	Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence	35097-35124	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP019053	Escherichia coli strain CRE1540 plasmid p1540-2, complete sequence	139462-139489	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP029743	Escherichia coli strain AR_0085 plasmid unnamed2, complete sequence	32318-32345	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP026233	Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-0b27, complete sequence	103795-103822	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_012692	Escherichia coli plasmid pAR060302, complete sequence	151319-151346	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_012693	Salmonella enterica plasmid pAM04528, complete sequence	143003-143030	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_016839	Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence	78636-78663	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024564	Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence	170037-170064	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP046773	Vibrio alginolyticus strain 2014V-1011 plasmid unnamed2, complete sequence	87928-87955	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP014775	Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence	55955-55982	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025245	Salmonella enterica subsp. enterica serovar Newport str. CDC 2012K-0663 isolate USDA-ARS-USMARC-1936 plasmid pSNE2-2012K-0663, complete sequence	96309-96336	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_019375	Providencia stuartii plasmid pTC2, complete sequence	151834-151861	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_022377	Escherichia coli strain SCEC2 plasmid pSCEC2, complete sequence	119275-119302	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP021695	Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence	187962-187989	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032395	Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence	33898-33925	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP050732	Salmonella enterica subsp. enterica serovar Typhimurium strain ST101 plasmid pST101-1, complete sequence	163672-163699	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025144	Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence	91524-91551	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP025147	Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence	96978-97005	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	LC225353	Photobacterium damselae subsp. piscicida plasmid pP0855 DNA, complete sequence	102195-102222	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP050727	Salmonella enterica subsp. enterica serovar Typhimurium strain ST113 plasmid pST-1, complete sequence	28378-28405	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP050740	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence	30194-30221	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP015394	Klebsiella pneumoniae strain CR14 plasmid pCR14_2, complete sequence	137967-137994	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018698	Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-2, complete sequence	80739-80766	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018220	Salmonella enterica subsp. enterica strain LSP 389/97 plasmid pUO-STmRV1, complete sequence	170660-170687	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP027695	Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence	14253-14280	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP045953	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00008979 plasmid pAUSMDU00008979_01, complete sequence	132343-132370	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT882698	Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence	202657-202684	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT882699	Enterobacter cloacae isolate Enterobacter cloacae ENCL58 plasmid I, complete sequence	59450-59477	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985220	Escherichia coli strain 83 plasmid RCS1TR83_p, complete sequence	38313-38340	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985225	Escherichia coli strain 89 plasmid RCS2TR89_p, complete sequence	149362-149389	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985258	Escherichia coli strain 726 plasmid RCS54TR726_p, complete sequence	7169-7196	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985222	Escherichia coli strain 548 plasmid RCS24TR548_p, complete sequence	28601-28628	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985228	Escherichia coli strain 552 plasmid RCS28TR552_p, complete sequence	39060-39087	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985218	Escherichia coli strain 541 plasmid RCS18TR541_p, complete sequence	123416-123443	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985260	Escherichia coli strain 724 plasmid RCS53TR724_p, complete sequence	151191-151218	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985253	Escherichia coli strain 660 plasmid RCS48TR660_p, complete sequence	155020-155047	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985250	Escherichia coli strain 170 plasmid RCS38_p, complete sequence	22495-22522	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985224	Escherichia coli strain 513 plasmid RCS30_p, complete sequence	68797-68824	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985243	Escherichia coli strain 722 plasmid RCS41_p, complete sequence	152366-152393	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_LT985244	Escherichia coli strain 167 plasmid RCS39_p, complete sequence	23168-23195	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018956	Escherichia coli strain Ecol_316 plasmid pEC316_KPC, complete sequence	187528-187555	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP018710	Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-2, complete sequence	80824-80851	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK733575	Escherichia coli strain J53 plasmid pMG252A, complete sequence	87865-87892	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK388209	Escherichia coli strain Ec20-Lar plasmid pC-Ec20-KPC, complete sequence	175477-175504	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK439959	Escherichia coli strain Ec-2Lar plasmid pC-Ec2-KPC, complete sequence	212667-212694	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MN101850	Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence	256018-256045	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MN101853	Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence	182381-182408	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK770642	Klebsiella pneumoniae strain T38 plasmid pT38_MCR3, complete sequence	131630-131657	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MN148427	Proteus vulgaris strain PV835 plasmid pPV835TEM24, complete sequence	158884-158911	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NC_022522	Salmonella enterica subsp. enterica serovar Kentucky strain 1643/10 plasmid p1643_10, complete sequence	152409-152436	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MN657252	Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence	152722-152749	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032380	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU1-USMARC-69807, complete sequence	4726-4753	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP032448	Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU2-USMARC-69840, complete sequence	17204-17231	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH105050	Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence	130892-130919	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH917285	Klebsiella pneumoniae strain 427113 plasmid p427113-Ct1/2, complete sequence	189334-189361	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH909327	Klebsiella pneumoniae strain 526316 plasmid p526316-KPC, complete sequence	150660-150687	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH917284	Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence	95621-95648	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH760469	Salmonella enterica strain 2016K-0796 plasmid p2016K-0796, complete sequence	164648-164675	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK205418	Salmonella enterica subsp. enterica serovar Dublin strain 14-1360 plasmid p14-1360-1, complete sequence	86075-86102	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK205416	Salmonella enterica subsp. enterica serovar Dublin strain N13-01070 plasmid pN13-01070-1, complete sequence	92093-92120	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK205417	Salmonella enterica subsp. enterica serovar Dublin strain N13-01141 plasmid pN13-01141, complete sequence	68181-68208	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH061195	Klebsiella pneumoniae strain AHM7C8I plasmid pHNAH8I-NDM, complete sequence	77723-77750	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	62720-62747	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH011352	Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence	196293-196320	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH476540	Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence	175876-175903	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP009410	Salmonella enterica strain CFSAN007405 isolate 30034 plasmid pCFSAN007405_01, complete sequence	116944-116971	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MG764534	Klebsiella aerogenes strain EA409 plasmid pEA409TEM24, complete sequence	152693-152720	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH001166	Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence	167672-167699	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF150121	Klebsiella pneumoniae strain A64477 plasmid pKP64477c, complete sequence	4334-4361	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF150123	Klebsiella pneumoniae strain A64216 plasmid pKP64216b, complete sequence	3275-3302	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF344573	Klebsiella pneumoniae strain N201205880 plasmid p205880-Ct1/2, complete sequence	137033-137060	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF344572	Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence	151259-151286	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF344574	Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence	119453-119480	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MG450360	Escherichia coli strain AMA566 plasmid pAMA566, complete sequence	173517-173544	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MG252895	Escherichia coli strain Esco-36073cz plasmid pEsco-36073cz, complete sequence	285747-285774	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH113855	Vibrio alginolyticus strain Vb1796 plasmid pVb1796, complete sequence	147492-147519	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH475146	Citrobacter freundii strain 164 plasmid pCf164_LMB-1, complete sequence	125985-126012	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH763829	Citrobacter freundii strain JY-17 plasmid pCFJY-17, complete sequence	144404-144431	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH892479	Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence	159135-159162	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH844629	Escherichia coli strain 2248 plasmid pNDM-2248, complete sequence	166293-166320	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP030132	Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence	99563-99590	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MT219816	Escherichia coli strain RF173-1 plasmid pRF173-1_87k_tetX, complete sequence	71105-71132	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887591	Escherichia coli strain Ec19 plasmid pEc19, complete sequence	173644-173671	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887596	Escherichia coli strain Ec158 plasmid pEc158, complete sequence	149958-149985	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887590	Escherichia coli strain Ec9 plasmid pEc9, complete sequence	213306-213333	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KY887595	Escherichia coli strain Ec78 plasmid pEc78, complete sequence	217846-217873	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF582638	Klebsiella pneumoniae strain KKp4 plasmid pKKp4-VIM, complete sequence	145768-145795	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF072965	Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence	146632-146659	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MG764552	Klebsiella pneumoniae strain A1763 plasmid pA1763-Ct2, complete sequence	77065-77092	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF150118	Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence	109429-109456	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MF497432	Vibrio alginolyticus strain Vb0506 plasmid pVb0506, complete sequence	117384-117411	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP040068	Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence	193691-193718	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP044189	Salmonella enterica subsp. enterica strain AR-0401 plasmid pAR-0401-1, complete sequence	75001-75028	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP028814	Edwardsiella ictaluri strain MS-17-156 plasmid pEI-MS-17-156-1, complete sequence	47745-47772	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP048384	Citrobacter freundii strain 62 plasmid p6_B, complete sequence	174306-174333	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP053192	Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence	112676-112703	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	MT151380	Vibrio cholerae strain YA00120881 plasmid pYA00120881, complete sequence	143540-143567	6	0.786
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP054305	Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence	82567-82594	6	0.786
CP026982_2	2.4\|883938\|32\|CP026982\|CRISPRCasFinder,CRT	883938-883969	32	LR535912	XXX	61461-61492	7	0.781
CP026982_2	2.10\|884299\|32\|CP026982\|CRISPRCasFinder,CRT	884299-884330	32	MT380195	Klebsiella phage KP_LZD_B01, complete genome	112614-112645	7	0.781
CP026982_2	2.13\|884480\|32\|CP026982\|CRISPRCasFinder,CRT	884480-884511	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	272547-272578	7	0.781
CP026982_2	2.16\|884661\|32\|CP026982\|CRISPRCasFinder,CRT	884661-884692	32	NZ_CP010326	Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence	146637-146668	7	0.781
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	MT653146	Salmonella phage 8sent1748, complete genome	2010-2041	7	0.781
CP026982_2	2.22\|885023\|32\|CP026982\|CRISPRCasFinder,CRT	885023-885054	32	MT653143	Salmonella phage 3sent1, complete genome	2010-2041	7	0.781
CP026982_2	2.28\|883941\|32\|CP026982\|PILER-CR	883941-883972	32	LR535912	XXX	61461-61492	7	0.781
CP026982_2	2.34\|884302\|32\|CP026982\|PILER-CR	884302-884333	32	MT380195	Klebsiella phage KP_LZD_B01, complete genome	112614-112645	7	0.781
CP026982_2	2.37\|884483\|32\|CP026982\|PILER-CR	884483-884514	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	272547-272578	7	0.781
CP026982_2	2.40\|884664\|32\|CP026982\|PILER-CR	884664-884695	32	NZ_CP010326	Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence	146637-146668	7	0.781
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	MT653146	Salmonella phage 8sent1748, complete genome	2010-2041	7	0.781
CP026982_2	2.46\|885026\|32\|CP026982\|PILER-CR	885026-885057	32	MT653143	Salmonella phage 3sent1, complete genome	2010-2041	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KY494864	Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence	392715-392746	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017620	Salmonella enterica subsp. enterica serovar Typhimurium strain 22792 plasmid unnamed1, complete sequence	60163-60194	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KT935446	Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence	27135-27166	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	10040-10071	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP046282	Salmonella enterica strain FDAARGOS_687 plasmid unnamed1, complete sequence	56279-56310	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017618	Salmonella enterica subsp. enterica serovar Typhimurium strain 22495 plasmid unnamed1, complete sequence	52534-52565	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP035302	Salmonella enterica subsp. enterica strain ST1539 plasmid pST1539, complete sequence	68093-68124	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022965	Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal2, complete sequence	73847-73878	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040569	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-8290 plasmid pCFSAN059542, complete sequence	34394-34425	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_007208	Salmonella enterica OU7025 plasmid pOU1113, complete sequence	58642-58673	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014980	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC H2662 plasmid pSTY1-H2662, complete sequence	53927-53958	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010380	Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence	276469-276500	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_HG970001	Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 plasmid pSG, complete sequence	84789-84820	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014970	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1808 isolate ST1126-1 plasmid pSTY1-1808, complete sequence	53889-53920	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KP899803	Salmonella enterica strain 8025 plasmid p8025, complete sequence	68333-68364	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014968	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-1702 plasmid pSTY1-2011K-1702, complete sequence	53891-53922	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP037873	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS014854 plasmid pPNCS014854_S1, complete sequence	48195-48226	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP037876	Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S3, complete sequence	41221-41252	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP009869	Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence	275880-275911	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP020923	Salmonella enterica subsp. enterica strain 16A242 plasmid unnamed1, complete sequence	59925-59956	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040669	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20082869 plasmid pSA20082869.1, complete sequence	92799-92830	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014973	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY2-1898, complete sequence	53827-53858	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP038435	Salmonella enterica subsp. enterica serovar Typhimurium strain E40V plasmid unnamed, complete sequence	48183-48214	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014976	Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2009K-1640 plasmid pSTY1-2009K-1640, complete sequence	53903-53934	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_017054	Salmonella enterica subsp. enterica serovar Typhimurium str. 798 plasmid p798_93, complete sequence	53711-53742	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042479	Citrobacter freundii strain C50 plasmid pC50_001, complete sequence	126460-126491	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP047324	Salmonella enterica subsp. enterica serovar Typhimurium strain RM13672 plasmid pRM13672, complete sequence	53806-53837	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014537	Salmonella enterica subsp. enterica serovar Typhimurium strain SO3 isolate SOHS 02-68 plasmid pSO3_STV, complete sequence	53818-53849	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_022570	Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 unnamed plasmid, complete sequence	53908-53939	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039560	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.2, complete sequence	83772-83803	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039577	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence	53427-53458	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039586	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014859 plasmid p11-0225.1, complete sequence	83861-83892	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN999012	Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 plasmid pSLT, complete sequence	53818-53849	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034480	Salmonella enterica subsp. enterica serovar Typhimurium strain 14028 plasmid unnamed, complete sequence	57608-57639	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP038433	Salmonella enterica subsp. enterica serovar Typhimurium strain E40 plasmid unnamed, complete sequence	48183-48214	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP016390	Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pSLT931, complete sequence	53830-53861	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP025556	Salmonella enterica subsp. enterica serovar Typhimurium strain PIR00538 plasmid pPIR00538, complete sequence	1194-1225	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP050746	Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-1, complete sequence	69529-69560	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP049311	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence	119171-119202	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP053871	Salmonella enterica subsp. enterica serovar Typhimurium strain SS2017 plasmid pSS2017-1, complete sequence	41333-41364	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP053866	Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-1, complete sequence	39995-40026	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP041006	Salmonella enterica strain FDAARGOS_768 plasmid unnamed1, complete sequence	53094-53125	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP026208	Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence	205805-205836	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039855	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014864 plasmid p11-0972.1, complete sequence	83831-83862	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010360	Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence	77276-77307	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034231	Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 plasmid pATCC14028, complete sequence	2887-2918	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029594	Salmonella enterica strain DA34827 plasmid pDA34827-94, complete sequence	21867-21898	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP049307	Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence	308201-308232	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP051287	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Gull_ST-29 plasmid pST29-94038, complete sequence	51359-51390	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014476	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence	69714-69745	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017729	Salmonella enterica subsp. enterica serovar Typhimurium str. SARA13 plasmid pSARA13, complete sequence	39032-39063	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP008745	Salmonella enterica subsp. enterica serovar Typhimurium strain VNP20009 plasmid pSLT_VNP20009, complete sequence	53806-53837	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP012168	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence	24565-24596	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP007582	Salmonella enterica subsp. enterica serovar Typhimurium strain 138736 plasmid, complete sequence	53915-53946	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP032179	Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence	170093-170124	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039566	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014849 plasmid p08-7727.1, complete sequence	83772-83803	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029142	Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence	101924-101955	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_013437	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence	73617-73648	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019001	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence	89887-89918	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017294	Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence	173381-173412	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034720	Salmonella enterica subsp. enterica serovar Typhimurium strain RSE04 plasmid pRSE04, complete sequence	57680-57711	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP031575	Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence	125336-125367	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP051281	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-99574.1A, complete sequence	66353-66384	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_AP014566	Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence	89652-89683	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029596	Salmonella enterica strain DA34833 plasmid pDA34833-94, complete sequence	48742-48773	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP051277	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Sparrow_ST-87 plasmid pST87-92921, complete sequence	74295-74326	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LS997974	Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pSLT-BT	57584-57615	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	LN794247	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSBLT, complete sequence	88472-88503	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP041974	Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence	16193-16224	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP041974	Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence	111924-111955	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039580	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014857 plasmid p10-3881.1, complete sequence	100866-100897	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039583	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014858 plasmid p10-8609.1, complete sequence	83933-83964	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP031135	Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence	203508-203539	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011635	Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence	166438-166469	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044969	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS007087.2, complete sequence	82158-82189	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044959	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.2, complete sequence	57608-57639	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039596	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014865 plasmid p12-4331.1, complete sequence	83772-83803	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039592	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014862 plasmid p11-0500.1, complete sequence	83931-83962	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039568	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014850 plasmid p08-8136.1, complete sequence	83771-83802	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP014577	Salmonella enterica subsp. enterica serovar Typhimurium strain RM9437 plasmid pRM9437, complete sequence	53824-53855	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP013721	Salmonella enterica subsp. enterica serovar Typhimurium strain RM10607 plasmid pRM10607, complete sequence	53820-53851	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_016864	Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 plasmid pSTUK-100, complete sequence	35617-35648	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP020113	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence	99717-99748	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014962	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 plasmid pSTY1-1899, complete sequence	53825-53856	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP027144	Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence	153930-153961	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_016861	Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_L, complete sequence	66412-66443	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP021464	Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_2, complete sequence	86481-86512	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029838	Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093B, complete sequence	17998-18029	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014050	Salmonella enterica strain FDAARGOS_94 plasmid unnamed, complete sequence	90237-90268	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019108	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence	42784-42815	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019109	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence	42784-42815	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019112	Salmonella enterica subsp. enterica serovar Pullorum plasmid pSPUV, complete sequence	65090-65121	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP038848	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014851 plasmid p09-0499.1, complete sequence	83796-83827	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP050736	Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-2, complete sequence	25039-25070	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040565	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-7699 plasmid pCFSAN059544, complete sequence	2734-2765	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_003277	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 plasmid pSLT, complete sequence	53826-53857	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022071	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed1, complete sequence	21806-21837	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP012348	Salmonella enterica subsp. enterica serovar Pullorum str. ATCC 9120 plasmid pCFSAN000725_01, complete sequence	651-682	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP051268	Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Hawk_ST-33 plasmid pST33-93798, complete sequence	33462-33493	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029841	Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence	57608-57639	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_016855	Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S plasmid unnamed, complete sequence	53806-53837	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KY320277	Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence	121412-121443	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LT855377	Salmonella enterica subsp. enterica serovar Typhimurium isolate STMU2UK plasmid 2	53836-53867	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP027413	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed2, complete sequence	53377-53408	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP027409	Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence	51419-51450	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014359	Salmonella enterica subsp. enterica serovar Typhimurium strain YU15 plasmid pYU15_94, complete sequence	53914-53945	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP015158	Salmonella enterica subsp. enterica serovar Typhimurium strain NC983 plasmid unnamed, complete sequence	53804-53835	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP018658	Salmonella enterica subsp. enterica serovar Enteritidis strain 92-0392 plasmid pSE92-0392, complete sequence	66651-66682	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028200	Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN018746 plasmid pGMI14-001, complete sequence	9702-9733	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_021155	Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-1, complete sequence	83284-83315	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014357	Salmonella enterica subsp. enterica serovar Typhimurium strain SO2 isolate SOHS 02-20 plasmid pSO2_STV, complete sequence	53811-53842	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028319	Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067216 plasmid pSC-09-1, complete sequence	68578-68609	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044111	Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2	50174-50205	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP050741	Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-2, complete sequence	10353-10384	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040901	Salmonella enterica subsp. enterica serovar Typhimurium strain SAP18-6199 plasmid pCFSAN074387, complete sequence	48204-48235	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040322	Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014879 plasmid p16-6397.1, complete sequence	83844-83875	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045950	Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_01, complete sequence	57620-57651	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP015599	Salmonella enterica strain FORC_030 plasmid pFORC_030, complete sequence	48945-48976	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP026701	Salmonella enterica subsp. enterica serovar Typhimurium strain AR_0031 plasmid unitig_1_pilon, complete sequence	13920-13951	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KX777254	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTV-Mu1, complete sequence	51876-51907	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP025885	Escherichia coli strain 503440 plasmid p503440_68, complete sequence	31419-31450	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KP987215	Citrobacter freundii strain 112298 plasmid p112298-KPC, complete sequence	51428-51459	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028272	Mixta intestinalis strain SRCM103226 plasmid unnamed1, complete sequence	53202-53233	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028272	Mixta intestinalis strain SRCM103226 plasmid unnamed1, complete sequence	54892-54923	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028272	Mixta intestinalis strain SRCM103226 plasmid unnamed1, complete sequence	60962-60993	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN890519	Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462388 plasmid 2, complete sequence	15912-15943	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN890519	Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462388 plasmid 2, complete sequence	18629-18660	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045758	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669, complete sequence	76115-76146	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045758	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669, complete sequence	78775-78806	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP037736	Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence	68207-68238	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP037736	Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence	70876-70907	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP037736	Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence	76859-76890	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045760	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000661 plasmid pCFSAN000661, complete sequence	65051-65082	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045760	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000661 plasmid pCFSAN000661, complete sequence	67711-67742	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019187	Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence	49161-49192	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019187	Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence	51830-51861	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019187	Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence	57814-57845	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN890521	Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462413 plasmid 2, complete sequence	15912-15943	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN890521	Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462413 plasmid 2, complete sequence	18629-18660	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040702	Salmonella enterica strain 3 isolate CFSAN047349 plasmid unnamed, complete sequence	101036-101067	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP040702	Salmonella enterica strain 3 isolate CFSAN047349 plasmid unnamed, complete sequence	103753-103784	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019175	Salmonella enterica subsp. enterica serovar Give strain CFSAN024229 plasmid pCFSAN024229, complete sequence	50279-50310	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029733	Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed5, complete sequence	57001-57032	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP035635	Enterobacter cloacae strain EN3600 plasmid unnamed3, complete sequence	42768-42799	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LS992176	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence	59533-59564	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LS992176	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence	65516-65547	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LS992176	Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence	68185-68216	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP045557	Citrobacter sp. S39 plasmid pS39-2, complete sequence	35787-35818	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP048110	Klebsiella michiganensis strain BD177 plasmid unnamed2	107360-107391	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP048110	Klebsiella michiganensis strain BD177 plasmid unnamed2	112942-112973	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045204	Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence	78526-78557	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045204	Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence	84469-84500	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP053577	Salmonella enterica strain 2012K-0845 plasmid unnamed2, complete sequence	637-668	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP053577	Salmonella enterica strain 2012K-0845 plasmid unnamed2, complete sequence	4012-4043	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045755	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid p1CFSAN000752, complete sequence	34590-34621	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045755	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid p1CFSAN000752, complete sequence	37250-37281	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030079	Enterobacter hormaechei strain 20710 plasmid p5-20710, complete sequence	25763-25794	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030198	Salmonella enterica strain SA20051401 plasmid pSA20051401.2, complete sequence	117602-117633	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014723	Paraburkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence	111955-111986	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022118	Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 plasmid unnamed1, complete sequence	384637-384668	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039470	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001112 plasmid pCFSAN001112, complete sequence	53907-53938	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039470	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001112 plasmid pCFSAN001112, complete sequence	56567-56598	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039485	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000952 plasmid pCFSAN000952, complete sequence	410-441	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039485	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000952 plasmid pCFSAN000952, complete sequence	79679-79710	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039494	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_1, complete sequence	63449-63480	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039494	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_1, complete sequence	66109-66140	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP038468	Citrobacter sp. SNU WT2 plasmid unnamed1, complete sequence	66165-66196	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029998	Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.3, complete sequence	17663-17694	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029998	Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.3, complete sequence	23786-23817	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP029998	Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.3, complete sequence	26456-26487	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039466	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001118 plasmid pCFSAN001118, complete sequence	70963-70994	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039466	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001118 plasmid pCFSAN001118, complete sequence	73623-73654	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039468	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001115 plasmid pCFSAN001115, complete sequence	63445-63476	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039468	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001115 plasmid pCFSAN001115, complete sequence	66105-66136	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP024977	Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence	27072-27103	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030210	Salmonella enterica strain SA20044414 plasmid pSA20044414.1, complete sequence	50562-50593	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030210	Salmonella enterica strain SA20044414 plasmid pSA20044414.1, complete sequence	56546-56577	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030210	Salmonella enterica strain SA20044414 plasmid pSA20044414.1, complete sequence	59215-59246	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019125	Salmonella enterica subsp. salamae plasmid pSGSC3045-121, complete sequence	75685-75716	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019125	Salmonella enterica subsp. salamae plasmid pSGSC3045-121, complete sequence	78148-78179	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	69575-69606	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	75559-75590	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022156	Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence	78228-78259	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	83324-83355	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	89308-89339	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP046347	Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence	91977-92008	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039464	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001140 plasmid pCFSAN001140, complete sequence	2159-2190	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039464	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001140 plasmid pCFSAN001140, complete sequence	81439-81470	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039472	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000970 plasmid pCFSAN000970, complete sequence	2159-2190	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039472	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000970 plasmid pCFSAN000970, complete sequence	81410-81441	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039474	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000968 plasmid pCFSAN000968_1, complete sequence	42484-42515	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039474	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000968 plasmid pCFSAN000968_1, complete sequence	45144-45175	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039492	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000700 plasmid pCFSAN000700, complete sequence	63450-63481	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039492	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000700 plasmid pCFSAN000700, complete sequence	66110-66141	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017992	Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-2c5, complete sequence	43962-43993	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017992	Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-2c5, complete sequence	52656-52687	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022035	Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed2, complete sequence	103446-103477	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022035	Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed2, complete sequence	109108-109139	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022035	Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed2, complete sequence	111778-111809	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022661	Salmonella enterica subsp. enterica strain RM11065 plasmid pRM11065-1, complete sequence	84475-84506	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	25790-25821	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN890523	Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5712384 plasmid 2, complete sequence	48522-48553	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_LN890523	Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5712384 plasmid 2, complete sequence	51239-51270	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011595	Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence	30538-30569	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011595	Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence	33207-33238	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011595	Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence	39191-39222	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011654	Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence	32706-32737	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011654	Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence	38689-38720	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011654	Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence	41358-41389	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP053407	Salmonella enterica strain 87-0091 plasmid unnamed, complete sequence	23355-23386	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP053403	Salmonella enterica strain 2010K-2057 plasmid unnamed1, complete sequence	59629-59660	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP053403	Salmonella enterica strain 2010K-2057 plasmid unnamed1, complete sequence	63016-63047	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033743	Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence	81748-81779	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	2215-2246	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	128680-128711	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP011610	Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence	131349-131380	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039483	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000954 plasmid pCFSAN000954, complete sequence	63447-63478	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039483	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000954 plasmid pCFSAN000954, complete sequence	66107-66138	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039479	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000960 plasmid pCFSAN000960, complete sequence	16367-16398	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039479	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000960 plasmid pCFSAN000960, complete sequence	19027-19058	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP039501	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid pCFSAN000189, complete sequence	48332-48363	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP039501	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid pCFSAN000189, complete sequence	50992-51023	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	183389-183420	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034178	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid unnamed, complete sequence	37620-37651	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034178	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid unnamed, complete sequence	40280-40311	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019342	Salmonella sp. 14 plasmid p14-120, complete sequence	67741-67772	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019342	Salmonella sp. 14 plasmid p14-120, complete sequence	70411-70442	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019342	Salmonella sp. 14 plasmid p14-120, complete sequence	76073-76104	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP042439	Salmonella enterica strain CFSAN079094 plasmid pCFSAN079094, complete sequence	47476-47507	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP042439	Salmonella enterica strain CFSAN079094 plasmid pCFSAN079094, complete sequence	50193-50224	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039481	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000958 plasmid pCFSAN000958, complete sequence	63447-63478	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039481	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000958 plasmid pCFSAN000958, complete sequence	66107-66138	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039488	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000753 plasmid pCFSAN000753, complete sequence	16540-16571	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP039488	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000753 plasmid pCFSAN000753, complete sequence	19200-19231	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044100	Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence	86072-86103	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044100	Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence	92056-92087	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP044100	Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence	94725-94756	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	182542-182573	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP046281	Salmonella enterica strain FDAARGOS_688 plasmid unnamed1, complete sequence	18099-18130	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP023469	Salmonella enterica subsp. enterica strain BAA-1586 plasmid pSalMiami, complete sequence	54703-54734	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014997	Salmonella enterica subsp. enterica serovar Weltevreden str. 1655 plasmid, complete sequence	32753-32784	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP014997	Salmonella enterica subsp. enterica serovar Weltevreden str. 1655 plasmid, complete sequence	35470-35501	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	182557-182588	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045838	Citrobacter sp. H12-3-2 plasmid pH12-1, complete sequence	46376-46407	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	182554-182585	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK167988	Citrobacter freundii strain TS45CTX plasmid pHNTS45-1, complete sequence	68769-68800	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019182	Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 plasmid pATCC10720, complete sequence	88870-88901	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019182	Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 plasmid pATCC10720, complete sequence	92257-92288	7	0.781
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP024166	Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_01, complete sequence	26701-26732	7	0.781
CP026982_3	3.8\|902988\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902988-903019	32	NC_019763	Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.01, complete sequence	85210-85241	7	0.781
CP026982_3	3.8\|902988\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902988-903019	32	NC_019763	Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.01, complete sequence	135577-135608	7	0.781
CP026982_3	3.8\|902988\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902988-903019	32	NC_019730	Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.02, complete sequence	46895-46926	7	0.781
CP026982_3	3.10\|903108\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903108-903139	32	NZ_CP046163	Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence	462584-462615	7	0.781
CP026982_3	3.10\|903108\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903108-903139	32	NZ_CP046066	Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence	646874-646905	7	0.781
CP026982_3	3.10\|903108\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903108-903139	32	NZ_CP045356	Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence	1113934-1113965	7	0.781
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MK047717	Escherichia phage p000v, complete genome	162422-162453	7	0.781
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_KT997783	Escherichia coli strain Y5 plasmid pECY53, complete sequence	673-700	7	0.75
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP044142	Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence	74099-74126	7	0.75
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_CP024824	Escherichia coli strain CREC-591 plasmid pCREC-591_3, complete sequence	24931-24958	7	0.75
CP026982_7	7.1\|4412570\|28\|CP026982\|CRT	4412570-4412597	28	NZ_MH476540	Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence	3403-3430	7	0.75
CP026982_8	8.1\|4415196\|32\|CP026982\|CRISPRCasFinder,CRT	4415196-4415227	32	NZ_CP041418	Escherichia coli strain STEC711 plasmid pSTEC711_2, complete sequence	1831-1862	7	0.781
CP026982_8	8.7\|4415563\|32\|CP026982\|CRISPRCasFinder,CRT	4415563-4415594	32	HQ316603	Cyanophage S-SSM6b genomic sequence	20931-20962	7	0.781
CP026982_8	8.7\|4415563\|32\|CP026982\|CRISPRCasFinder,CRT	4415563-4415594	32	NC_020875	Cyanophage S-SSM4 genomic sequence	61300-61331	7	0.781
CP026982_8	8.11\|4415807\|32\|CP026982\|CRISPRCasFinder,CRT	4415807-4415838	32	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	51004-51035	7	0.781
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NZ_CP033220	Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence	62810-62841	8	0.75
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NZ_CP033220	Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence	144479-144510	8	0.75
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NZ_CP011665	Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence	409767-409798	8	0.75
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	224345-224376	8	0.75
CP026982_2	2.6\|884058\|32\|CP026982\|CRISPRCasFinder,CRT	884058-884089	32	NC_003374	Gluconobacter oxydans DSM 3504 plasmid pGO128, complete sequence	2957-2988	8	0.75
CP026982_2	2.19\|884842\|32\|CP026982\|CRISPRCasFinder,CRT	884842-884873	32	NZ_CP015734	Arthrobacter sp. U41 plasmid unnamed2, complete sequence	133058-133089	8	0.75
CP026982_2	2.23\|885083\|32\|CP026982\|CRISPRCasFinder,CRT	885083-885114	32	MN693266	Marine virus AFVG_25M408, complete genome	23552-23583	8	0.75
CP026982_2	2.30\|884061\|32\|CP026982\|PILER-CR	884061-884092	32	NC_003374	Gluconobacter oxydans DSM 3504 plasmid pGO128, complete sequence	2957-2988	8	0.75
CP026982_2	2.43\|884845\|32\|CP026982\|PILER-CR	884845-884876	32	NZ_CP015734	Arthrobacter sp. U41 plasmid unnamed2, complete sequence	133058-133089	8	0.75
CP026982_2	2.47\|885086\|32\|CP026982\|PILER-CR	885086-885117	32	MN693266	Marine virus AFVG_25M408, complete genome	23552-23583	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034939	Pectobacterium odoriferum strain JK2.1 plasmid p.Jk2_1, complete sequence	82946-82977	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK033501	Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence	29461-29492	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	81568-81599	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	78968-78999	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP041027	Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence	153298-153329	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014476	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence	12060-12091	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019001	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence	33071-33102	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_AP014566	Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence	32891-32922	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP020113	Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence	12563-12594	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019108	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence	100438-100469	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019109	Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence	120981-121012	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014108	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence	74-105	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014108	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence	4033-4064	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_014108	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence	8904-8935	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030922	Escherichia coli strain KL53 plasmid pKL53-S, complete sequence	9789-9820	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	AM261282	Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence	1162-1193	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	AM261282	Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence	29252-29283	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_007353	Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence	30964-30995	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP053984	Achromobacter pestifer strain FDAARGOS_790 plasmid unnamed, complete sequence	10246-10277	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP015373	Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence	21053-21084	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP026268	Aminobacter sp. MSH1 plasmid pBAM1, complete sequence	25126-25157	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_010935	Comamonas testosteroni CNB-1 plasmid pCNB, complete sequence	11703-11734	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JX469834	Uncultured bacterium plasmid pDS3, complete sequence	40509-40540	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JX469826	Uncultured bacterium plasmid pB12, complete sequence	64039-64070	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JX469827	Uncultured bacterium plasmid pEMT3, complete sequence	42962-42993	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JX469828	Uncultured bacterium plasmid pRSB223, complete sequence	8338-8369	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JX469829	Uncultured bacterium plasmid pB1, complete sequence	57942-57973	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JX469831	Uncultured bacterium plasmid pKSP212, complete sequence	47637-47668	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028340	Thauera aromatica K172 plasmid pKJK172, complete sequence	383-414	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JN106171	Uncultured bacterium plasmid pAKD26, complete sequence	73390-73421	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JN106172	Uncultured bacterium plasmid pAKD29, complete sequence	40638-40669	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JN106169	Uncultured bacterium plasmid pAKD18, complete sequence	41780-41811	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_008766	Acidovorax sp. JS42 plasmid pAOVO02, complete sequence	43535-43566	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042584	Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence	3769-3800	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042584	Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence	67087-67118	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_016968	Comamonas testosteroni plasmid pTB30, complete sequence	78937-78968	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_016978	Comamonas testosteroni plasmid pI2, complete sequence	68244-68275	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017760	Cupriavidus necator strain NH9 plasmid pENH91, complete sequence	18770-18801	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP053554	Diaphorobacter sp. JS3050 plasmid pDCNB, complete sequence	17202-17233	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KF743817	Proteus mirabilis plasmid R772, complete sequence	40732-40763	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KF743818	Bordetella bronchiseptica plasmid R906, complete sequence	42950-42981	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KC964605	Uncultured bacterium plasmid pMLUA1, complete sequence	1162-1193	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KC964605	Uncultured bacterium plasmid pMLUA1, complete sequence	33714-33745	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KC964606	Uncultured bacterium plasmid pMLUA3, complete sequence	1162-1193	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KC964606	Uncultured bacterium plasmid pMLUA3, complete sequence	32728-32759	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KC964607	Uncultured bacterium plasmid pMLUA4, complete sequence	1162-1193	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	KC964607	Uncultured bacterium plasmid pMLUA4, complete sequence	30344-30375	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JQ004406	Uncultured bacterium plasmid pHH128, complete sequence	17616-17647	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JQ004406	Uncultured bacterium plasmid pHH128, complete sequence	43905-43936	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JQ004407	Uncultured bacterium plasmid pHH3408, complete sequence	17622-17653	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JQ004408	Uncultured bacterium plasmid pHH3414, complete sequence	17622-17653	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JQ004409	Uncultured bacterium plasmid pKS77, complete sequence	17493-17524	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	JQ004409	Uncultured bacterium plasmid pKS77, complete sequence	43789-43820	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MN366356	Bacterium plasmid pALTS27, complete sequence	58692-58723	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MN366356	Bacterium plasmid pALTS27, complete sequence	32399-32430	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MN366360	Bacterium plasmid pALTS32, complete sequence	57797-57828	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MN366360	Bacterium plasmid pALTS32, complete sequence	31504-31535	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MN366361	Bacterium plasmid pALTS33, complete sequence	31665-31696	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019263	Delftia acidovorans plasmid pLME1, complete sequence	77075-77106	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019264	Delftia acidovorans plasmid pNB8c, complete sequence	60068-60099	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019283	Delftia acidovorans plasmid pC1-1, complete sequence	73926-73957	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019369	Burkholderia cepacia plasmid pYS1, complete sequence	41298-41329	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019318	Ralstonia pickettii plasmid p712, complete sequence	21558-21589	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_021077	Comamonas sp. 7D-2 plasmid pBHB, complete sequence	78587-78618	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_006830	Achromobacter xylosoxidans A8 plasmid pA81, complete sequence	80648-80679	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP050860	Klebsiella pneumoniae strain SCH6109 plasmid pSCH6109-Vir, complete sequence	94522-94553	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KX863568	Citrobacter freundii strain AtetA plasmid pLNU-11, complete sequence	9160-9191	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KY296096	Pseudomonas aeruginosa strain 14057 plasmid p14057-tetA, complete sequence	10366-10397	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KY399978	Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence	44355-44386	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KY689633	Escherichia coli strain 100R plasmid p100R, complete sequence	8976-9007	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KY986974	Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence	28553-28584	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045446	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence	156855-156886	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028168	Escherichia coli strain CFSAN064036 plasmid pGMI17-004_1, complete sequence	102474-102505	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP034786	Escherichia coli strain ECZP248 plasmid pTB402, complete sequence	21610-21641	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP009414	Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence	31406-31437	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KU852461	Salmonella enterica subsp. enterica serovar Typhimurium strain ST1004 plasmid pNUC, complete sequence	10750-10781	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KU321583	Escherichia coli strain E80 plasmid pE80, complete sequence	17709-17740	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KX815983	Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence	119479-119510	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KX129782	Escherichia coli strain S38 plasmid pS38, complete sequence	118162-118193	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KX029331	Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence	53683-53714	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP015833	Escherichia coli O157 strain 180-PT54 plasmid unnamed, complete sequence	114170-114201	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP035548	Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence	28557-28588	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP009412	Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence	30522-30553	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP009411	Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence	29694-29725	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP009413	Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence	123780-123811	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP052795	Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0125 plasmid pN19S0125, complete sequence	44010-44041	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KJ909290	Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence	28521-28552	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KR559888	Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence	29695-29726	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KR559889	Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence	29695-29726	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KR653209	Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence	27698-27729	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KR091911	Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence	170134-170165	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KT990220	Escherichia coli strain 42-2 plasmid p42-2, complete sequence	15287-15318	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KP056256	Escherichia coli strain YDC637 plasmid pYDC637, complete sequence	28578-28609	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	LT221036	Yersinia pseudotuberculosis strain Yps.F1, plasmid pYps.F1 complete sequence	173463-173494	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP028197	Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence	301927-301958	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010164	Escherichia coli strain H2 plasmid A, complete sequence	29233-29264	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010232	Escherichia coli strain S30 plasmid A, complete sequence	150383-150414	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010233	Escherichia coli strain S30 plasmid B, complete sequence	4812-4843	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP032391	Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence	142297-142328	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP047882	Salmonella enterica subsp. enterica serovar Infantis strain 119944 plasmid pESI, complete sequence	173854-173885	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_AP017613	Escherichia coli strain 20Ec-P-124 plasmid pMRY16-002_3, complete sequence	48842-48873	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP017987	Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence	65963-65994	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_AP023191	Escherichia coli strain TUM18530 plasmid pMTY18530-1_lncHI2, complete sequence	117485-117516	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_022996	Escherichia coli plasmid pO26-CRL-125, complete sequence	28749-28780	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP035011	Shigella sonnei strain LC1477/18 plasmid pLC1477_18-3, complete sequence	3732-3763	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP010118	Escherichia coli strain C2 plasmid A, complete sequence	2223-2254	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045742	Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence	72206-72237	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP052804	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S973 plasmid pN17S0973, complete sequence	225487-225518	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_022992	Escherichia coli plasmid pO111-CRL-115, complete sequence	28909-28940	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP043219	Escherichia coli O80:H26 strain EC-107 plasmid pET6.2-IncFII, complete sequence	7429-7460	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP038508	Salmonella enterica subsp. enterica serovar Infantis strain FARPER-219 plasmid p-F219, complete sequence	33589-33620	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022498	Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence	10748-10779	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022498	Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence	21637-21668	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP022499	Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed2, complete sequence	22583-22614	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP025240	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence	29695-29726	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP025242	Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence	29400-29431	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_KT754161	Shigella dysenteriae 1 strain CAR10 plasmid pCAR10, complete sequence	83423-83454	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	CP052802	Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S976 plasmid pN17S0976, complete sequence	75461-75492	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP045449	Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence	156854-156885	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP024192	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence	175258-175289	8	0.75
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP019272	Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence	16021-16052	8	0.75
CP026982_3	3.6\|902868\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902868-902899	32	NC_005887	Burkholderia phage BcepC6B, complete genome	32663-32694	8	0.75
CP026982_3	3.6\|902868\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902868-902899	32	AY605181	Burkholderia cepacia complex phage BcepC6B, complete genome	32663-32694	8	0.75
CP026982_3	3.11\|903168\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903168-903199	32	NC_015178	Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence	83835-83866	8	0.75
CP026982_3	3.17\|903528\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903528-903559	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	112735-112766	8	0.75
CP026982_3	3.18\|903588\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903588-903619	32	NZ_CP044989	Deinococcus sp. AJ005 plasmid p380k, complete sequence	118048-118079	8	0.75
CP026982_3	3.20\|903701\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903701-903732	32	CP046442	Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed1, complete sequence	27331-27362	8	0.75
CP026982_3	3.21\|903761\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903761-903792	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	174312-174343	8	0.75
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	645125-645156	8	0.75
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	644336-644367	8	0.75
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1329847-1329878	8	0.75
CP026982_3	3.33\|904481\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904481-904512	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	649854-649885	8	0.75
CP026982_8	8.23\|4415563\|33\|CP026982\|PILER-CR	4415563-4415595	33	HQ316603	Cyanophage S-SSM6b genomic sequence	20931-20963	8	0.758
CP026982_8	8.23\|4415563\|33\|CP026982\|PILER-CR	4415563-4415595	33	NC_020875	Cyanophage S-SSM4 genomic sequence	61299-61331	8	0.758
CP026982_8	8.27\|4415807\|33\|CP026982\|PILER-CR	4415807-4415839	33	NC_008573	Shewanella sp. ANA-3 plasmid unnamed1, complete sequence	51004-51036	8	0.758
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	3263-3294	9	0.719
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NZ_KR152226	Micrococcus sp. MG-2010-D12 plasmid pJD12, complete sequence	51825-51856	9	0.719
CP026982_1	1.1\|455960\|32\|CP026982\|CRISPRCasFinder	455960-455991	32	NC_024972	Micrococcus sp. A1 plasmid pLMA1, complete sequence	64226-64257	9	0.719
CP026982_2	2.2\|883818\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	883818-883849	32	NC_015583	Novosphingobium sp. PP1Y plasmid Mpl, complete sequence	1113302-1113333	9	0.719
CP026982_2	2.2\|883818\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	883818-883849	32	MN693928	Marine virus AFVG_250M221, complete genome	3219-3250	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	311852-311883	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	119718-119749	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP048695	Vibrio coralliilyticus OCN008 plasmid unnamed1, complete sequence	24035-24066	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	60351-60382	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP031474	Vibrio coralliilyticus strain RE22 plasmid p337, complete sequence	171545-171576	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP009266	Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence	370110-370141	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP009620	Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence	50474-50505	9	0.719
CP026982_2	2.7\|884118\|32\|CP026982\|CRISPRCasFinder,CRT	884118-884149	32	NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	268304-268335	9	0.719
CP026982_2	2.12\|884420\|32\|CP026982\|CRISPRCasFinder,CRT	884420-884451	32	HM452126	Aeromonas phage phiAS5, complete genome	142506-142537	9	0.719
CP026982_2	2.13\|884480\|32\|CP026982\|CRISPRCasFinder,CRT	884480-884511	32	NZ_CP007257	Rhodococcus erythropolis R138 plasmid pLRE138, complete sequence	51132-51163	9	0.719
CP026982_2	2.13\|884480\|32\|CP026982\|CRISPRCasFinder,CRT	884480-884511	32	MH333064	Klebsiella phage Mineola, complete genome	108968-108999	9	0.719
CP026982_2	2.13\|884480\|32\|CP026982\|CRISPRCasFinder,CRT	884480-884511	32	MK421971	Klebsiella phage vB_KpnM_GF, partial genome	94739-94770	9	0.719
CP026982_2	2.14\|884540\|32\|CP026982\|CRISPRCasFinder,CRT	884540-884571	32	FJ904927	Vibrio phage VEJphi, complete genome	6040-6071	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	311852-311883	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	119718-119749	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP048695	Vibrio coralliilyticus OCN008 plasmid unnamed1, complete sequence	24035-24066	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	60351-60382	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP031474	Vibrio coralliilyticus strain RE22 plasmid p337, complete sequence	171545-171576	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP009266	Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence	370110-370141	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP009620	Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence	50474-50505	9	0.719
CP026982_2	2.31\|884121\|32\|CP026982\|PILER-CR	884121-884152	32	NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	268304-268335	9	0.719
CP026982_2	2.36\|884423\|32\|CP026982\|PILER-CR	884423-884454	32	HM452126	Aeromonas phage phiAS5, complete genome	142506-142537	9	0.719
CP026982_2	2.37\|884483\|32\|CP026982\|PILER-CR	884483-884514	32	NZ_CP007257	Rhodococcus erythropolis R138 plasmid pLRE138, complete sequence	51132-51163	9	0.719
CP026982_2	2.37\|884483\|32\|CP026982\|PILER-CR	884483-884514	32	MH333064	Klebsiella phage Mineola, complete genome	108968-108999	9	0.719
CP026982_2	2.37\|884483\|32\|CP026982\|PILER-CR	884483-884514	32	MK421971	Klebsiella phage vB_KpnM_GF, partial genome	94739-94770	9	0.719
CP026982_2	2.38\|884543\|32\|CP026982\|PILER-CR	884543-884574	32	FJ904927	Vibrio phage VEJphi, complete genome	6040-6071	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_MK033499	Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence	125002-125028	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NC_019906	Pseudomonas putida HB3267 plasmid pPC9, complete sequence	80307-80338	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	8667-8698	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	17735-17766	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	107417-107448	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	116488-116519	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042584	Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence	2371-2402	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042584	Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence	69013-69044	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042584	Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence	72987-73018	9	0.719
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP042584	Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence	75784-75815	9	0.719
CP026982_3	3.6\|902868\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	902868-902899	32	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	309542-309573	9	0.719
CP026982_3	3.17\|903528\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903528-903559	32	NZ_CP013345	Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence	8398-8429	9	0.719
CP026982_3	3.17\|903528\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903528-903559	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	280872-280903	9	0.719
CP026982_3	3.20\|903701\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903701-903732	32	NZ_CP028348	Novosphingobium sp. THN1 plasmid pTHN, complete sequence	567166-567197	9	0.719
CP026982_3	3.21\|903761\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903761-903792	32	KY697807	Microcystis phage MACPNOA1, complete genome	34232-34263	9	0.719
CP026982_3	3.24\|903941\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903941-903972	32	NZ_CP031652	Pantoea agglomerans strain TH81 plasmid unnamed3, complete sequence	152110-152141	9	0.719
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP015090	Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence	164446-164477	9	0.719
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	280844-280875	9	0.719
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	756971-757002	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	LK391770	Klebsiella pneumoniae plasmid pRYC11, complete sequence, strain H67	894-925	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026048	Raoultella planticola strain FDAARGOS_64 plasmid unnamed1, complete sequence	14892-14923	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026280	Klebsiella oxytoca strain KONIH2 plasmid pKPC-55bf, complete sequence	39736-39767	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP018674	Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-71, complete sequence	38758-38789	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KY093014	Klebsiella aerogenes strain Eaer-4382 plasmid pEaer-4382s, complete sequence	43082-43113	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KY093013	Klebsiella aerogenes strain Eaer-4382 plasmid pEaer-4382b, complete sequence	68831-68862	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KY270850	Klebsiella pneumoniae strain 12181 plasmid p12181-KPC, complete sequence	80061-80092	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KY270849	Klebsiella pneumoniae strain 0716 plasmid p0716-KPC, complete sequence	37887-37918	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034757	Enterobacter hormaechei subsp. hoffmannii strain Eh1 plasmid p3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP050835	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence	171452-171483	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KX443408	Klebsiella pneumoniae strain SC24 plasmid pKSC24, complete sequence	27072-27103	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KX236178	Klebsiella pneumoniae strain HS091147 plasmid pHS091147, complete sequence	3645-3676	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP029740	Klebsiella pneumoniae strain AR_0087 plasmid unnamed2, complete sequence	51357-51388	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KP125893	Klebsiella pneumoniae subsp. pneumoniae strain HS08204 plasmid pHS08204, complete sequence	49543-49574	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KR822246	Enterobacter hormaechei strain E0083033-1 plasmid pEh1A, complete sequence	452-483	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KU295132	Escherichia coli strain BK34397 plasmid pBK34397, complete sequence	40167-40198	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NC_020087	Klebsiella pneumoniae plasmid pK1HV, complete sequence	451-482	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021753	Klebsiella pneumoniae strain AR_0113 plasmid unitig_2, complete sequence	91500-91531	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024917	Klebsiella pneumoniae strain NH54 plasmid pKPNH54.1, complete sequence	26195-26226	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP031262	Klebsiella quasipneumoniae strain L22 plasmid pL22-5, complete sequence	90646-90677	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP044529	Klebsiella grimontii strain SS141 plasmid plamid_2, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP017386	Klebsiella pneumoniae strain KP36 plasmid 1, complete sequence	91186-91217	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP014005	Klebsiella pneumoniae subsp. pneumoniae strain NUHL24835 plasmid unnamed1, complete sequence	82972-83003	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP048351	Raoultella ornithinolytica strain 23 plasmid p23_B, complete sequence	76562-76593	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052410	Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028588	Escherichia coli strain WCHEC4533 plasmid pNDM4_000533, complete sequence	589-620	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028805	Klebsiella pneumoniae strain WCHKP7E2 plasmid pKPC2_085072, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024194	Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP011977	Klebsiella pneumoniae DMC1097 plasmid pDMC1097-218.836kb, complete sequence	86850-86881	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052311	Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN200129	Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-IncFII-114, complete sequence	6909-6940	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN200130	Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence	184153-184184	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN543580	Klebsiella pneumoniae strain PM48 plasmid pPM48_125, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NC_010886	Klebsiella pneumoniae plasmid pK245, complete sequence	43351-43382	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KJ721789	Klebsiella pneumoniae strain NJ HT1872 plasmid pUSKPC3, complete sequence	133448-133479	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_KJ958926	Klebsiella pneumoniae strain Kpn-3002cz plasmid pB-3002cz, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_LN824135	Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_B_Kpneumoniae_MS6671	28110-28141	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP020523	Escherichia coli strain 190 plasmid unnamed2, complete sequence	30884-30915	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_AP023150	Klebsiella pneumoniae strain SMKP03 plasmid pSMKP03M, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028955	Klebsiella pneumoniae strain AR_0141 plasmid unnamed2, complete sequence	71417-71448	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP008791	Klebsiella oxytoca KONIH1 plasmid pKPC-727, complete sequence	132328-132359	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MT066418	Klebsiella pneumoniae strain ST11 plasmid p158590-KPC, complete sequence	89915-89946	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN586817	Klebsiella pneumoniae strain A1966 plasmid pA1966-NR, complete sequence	52-83	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NC_019389	Klebsiella pneumoniae plasmid pKDO1, complete sequence	12512-12543	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP025042	Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_5, complete sequence	13883-13914	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034777	Klebsiella pneumoniae strain 18CPO060 plasmid pKPCKP060, complete sequence	37916-37947	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP020843	Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-2, complete sequence	37243-37274	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891677	Klebsiella pneumoniae strain ZZ41 plasmid pZZ41-KPC, complete sequence	81164-81195	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891679	Klebsiella pneumoniae strain ZZ40 plasmid pZZ40-KPC, complete sequence	2518-2549	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891681	Klebsiella pneumoniae strain 14899 plasmid p14899-KPC, complete sequence	84378-84409	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891683	Klebsiella pneumoniae strain 314013 plasmid p314013-KPC, complete sequence	19292-19323	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891684	Klebsiella pneumoniae strain BJ107 plasmid pBJ107-KPC, complete sequence	80212-80243	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891685	Klebsiella pneumoniae strain BJ119 plasmid pBJ119-KPC, complete sequence	16720-16751	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	LC549807	Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence	208768-208799	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	LC549808	Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP032878	Escherichia coli strain WCHEC000837 plasmid pNDM4_000837, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP015502	Klebsiella pneumoniae strain SKGH01 plasmid unnamed 2, complete sequence	29706-29737	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028178	Klebsiella pneumoniae strain CFSAN054111 plasmid pGMI16-006_2, complete sequence	91653-91684	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP047686	Serratia marcescens strain 2838 plasmid p2838-KPC, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP037964	Klebsiella pneumoniae strain SCKP020135 plasmid pMCR8_020135, complete sequence	13095-13126	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026272	Klebsiella oxytoca strain KONIH4 plasmid pKPC-f607, complete sequence	6195-6226	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP023250	Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1	36955-36986	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP023250	Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1	39277-39308	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP022442	Klebsiella sp. LY plasmid unnamed1, complete sequence	80299-80330	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP042483	Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024876	Klebsiella pneumoniae strain NH25 plasmid pNH25.2, complete sequence	84406-84437	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP047683	Serratia marcescens strain 3024 plasmid p3024-KPC, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034325	Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-CTX-M-3, complete sequence	90926-90957	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP035182	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncR, complete sequence	12792-12823	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP035182	Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncR, complete sequence	61886-61917	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP025214	Klebsiella pneumoniae strain HZW25 plasmid unnamed3, complete sequence	5389-5420	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP025214	Klebsiella pneumoniae strain HZW25 plasmid unnamed3, complete sequence	75214-75245	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021959	Klebsiella pneumoniae strain AR_0139 plasmid tig00000003, complete sequence	89178-89209	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP012569	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-3.X, complete sequence	32517-32548	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028991	Klebsiella pneumoniae strain AR_0142 plasmid unnamed1, complete sequence	41219-41250	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP047680	Serratia marcescens strain 4201 plasmid p4201-KPC, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP029135	Klebsiella pneumoniae strain AR376 plasmid unnamed1, complete sequence	1902-1933	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052554	Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP041642	Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-NDM4, complete sequence	101825-101856	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024835	Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_1, complete sequence	24952-24983	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP038003	Klebsiella pneumoniae strain SCKP020009 plasmid pKPC2_020009, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026185	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-9a0d, complete sequence	934-965	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP039525	Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-88K, complete sequence	22969-23000	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MK191023	Klebsiella pneumoniae strain KP17-16 plasmid p17-16-KPC, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP047337	Klebsiella pneumoniae strain 2019036D plasmid p2019036D-mcr8-345kb, complete sequence	261379-261410	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	KY930324	Klebsiella pneumoniae plasmid pUCLAKPC1, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021545	Klebsiella pneumoniae strain AR_0112 plasmid tig00000001, complete sequence	49353-49384	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021687	Klebsiella pneumoniae strain AR_0146 plasmid tig00001186, complete sequence	69392-69423	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021720	Escherichia coli strain AR_0128 plasmid tig00000793, complete sequence	190764-190795	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP036306	Klebsiella pneumoniae strain WCHKP020098 plasmid pKPC2_020098, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_AP019690	Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-3, complete sequence	24155-24186	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP030067	Klebsiella pneumoniae strain IA565 plasmid pDA11912.2, complete sequence	31875-31906	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028553	Klebsiella variicola strain WCHKP19 plasmid pCTXM15_020019, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP009774	Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pNJST258N3-62b, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP044038	Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed4, complete sequence	66823-66854	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP006925	Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP008932	Klebsiella pneumoniae strain PMK1 plasmid pPMK1-C, complete sequence	18489-18520	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP006921	Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C3, complete sequence	11199-11230	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP009116	Klebsiella pneumoniae strain carbapenem-resistant blaNDM-1 plasmid p1, complete sequence	89219-89250	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052281	Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-1, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024839	Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_1, complete sequence	73038-73069	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026396	Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-8c6e, complete sequence	129240-129271	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP041250	Raoultella electrica strain DSM 102253 plasmid unnamed3, complete sequence	52-83	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052289	Klebsiella pneumoniae strain E16KP0218 plasmid pE16KP0218-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP018999	Escherichia coli strain Ecol_AZ153 plasmid pECAZ153_KPC, complete sequence	32186-32217	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP036446	Klebsiella pneumoniae strain KPNIH45 plasmid unnamed1, complete sequence	39133-39164	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP025966	Klebsiella pneumoniae strain WCHKP34 plasmid pQnrB_LL34, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP038279	Raoultella ornithinolytica strain WLK218 plasmid pWLK-KPC, complete sequence	20556-20587	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP012564	Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-3, complete sequence	37587-37618	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP050170	Klebsiella pneumoniae plasmid Carbapenemase(KPC-2)_IncFII, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NC_032103	Klebsiella pneumoniae strain 628 plasmid p628-KPC, complete sequence	41165-41196	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034131	Klebsiella quasipneumoniae strain G4584 plasmid pG4584_136.4Kb, complete sequence	71237-71268	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034677	Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_80kb, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP050155	Klebsiella quasipneumoniae plasmid Carbapenemase(IMP-4)_IncFI, complete sequence	64961-64992	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MF918372	Klebsiella pneumoniae plasmid p1512-KPC, complete sequence	97026-97057	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024431	Klebsiella pneumoniae strain DA48896 plasmid p48896_2, complete sequence	25694-25725	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024524	Klebsiella pneumoniae strain INF158 plasmid unnamed3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN792917	Enterobacter hormaechei subsp. xiangfangensis strain ST114 plasmid pLAU_ENM30_NDM1, complete sequence	42206-42237	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP050374	Klebsiella pneumoniae strain 50595 plasmid p50595_NDM_1, complete sequence	14722-14753	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP050361	Klebsiella pneumoniae strain 47733 plasmid p47733_ARR2, complete sequence	42726-42757	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052540	Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NC_021198	Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP035384	Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence	56079-56110	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP018451	Klebsiella pneumoniae strain Kp_Goe_71070 plasmid pKp_Goe_070-1, complete sequence	64570-64601	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP017452	Klebsiella sp. LTGPAF-6F plasmid unnamed2, complete sequence	32029-32060	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP045678	Klebsiella pneumoniae strain WSD411 plasmid pWSD411_5, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026212	Citrobacter sp. CFNIH10 plasmid pCIT-a850, complete sequence	53472-53503	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP022226	Escherichia coli strain WCHEC96200 plasmid pNDM4_WCHEC96200, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP013340	Raoultella ornithinolytica strain Yangling I2 plasmid pKPYL2, complete sequence	48601-48632	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021857	Klebsiella pneumoniae strain AR_0125 plasmid tig00000002_pilon, complete sequence	30528-30559	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP029723	Klebsiella pneumoniae strain AR_0140 plasmid unnamed1, complete sequence	175754-175785	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034137	Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_150.8Kb, complete sequence	85702-85733	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN823996	Klebsiella pneumoniae strain 0239 plasmid p0239-FIIK, complete sequence	4797-4828	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN824001	Klebsiella pneumoniae strain N201205880 plasmid p205880-1FIIK, complete sequence	58293-58324	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN615880	Serratia marcescens strain S1 plasmid pS1-KPC2, complete sequence	40653-40684	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP011630	Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-49, complete sequence	34151-34182	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024510	Klebsiella pneumoniae strain KSB2_1B plasmid unnamed4, complete sequence	33633-33664	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP016925	Klebsiella pneumoniae isolate 23 plasmid pCTXM15_DHQP1400954, complete sequence	59967-59998	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP032212	Klebsiella pneumoniae strain AR_0109 plasmid unnamed6, complete sequence	12791-12822	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP032188	Klebsiella pneumoniae strain AR_0075 plasmid unnamed3, complete sequence	49983-50014	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN842291	Klebsiella pneumoniae strain 11935 plasmid p11935-KPC, complete sequence	160-191	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028782	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pQnrB52_020046, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP023489	Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_02, complete sequence	2016-2047	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP027606	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0093 plasmid unnamed2, complete sequence	474-505	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_AP018673	Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-2, complete sequence	68545-68576	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP011646	Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence	52-83	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021946	Klebsiella pneumoniae strain AR_0152 plasmid tig00000195, complete sequence	114456-114487	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052391	Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP011576	Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-50, complete sequence	48319-48350	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP035197	Klebsiella pneumoniae strain LH375 plasmid pLH375_1, complete sequence	51287-51318	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP020050	Escherichia coli strain AR_0118 plasmid unitig_2, complete sequence	108076-108107	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052436	Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-2, complete sequence	19813-19844	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024573	Klebsiella pneumoniae strain INF274 plasmid unnamed3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	AP022352	Klebsiella pneumoniae E208 plasmid pE208_IMP6 DNA, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP031883	Klebsiella pneumoniae strain WCHKP095845 plasmid pMCR8_095845, complete sequence	74216-74247	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP035124	Escherichia coli strain EC25 plasmid pEC25-1, complete sequence	66936-66967	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052352	Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NC_013950	Klebsiella pneumoniae plasmid pKF3-94, complete sequence	23275-23306	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP024566	Klebsiella pneumoniae strain INF278 plasmid unnamed3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP034085	Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-CTX, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP028782	Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pCTXM27_020046, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028717	Klebsiella pneumoniae strain SCM96 plasmid pSCM96-1, complete sequence	74643-74674	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_AP018830	Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence	95022-95053	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052393	Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052479	Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP032176	Klebsiella pneumoniae strain AR_0135 plasmid unnamed1, complete sequence	19977-20008	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP028389	Klebsiella pneumoniae strain WCHKP13F2 plasmid pKPC2_095132, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP021758	Klebsiella pneumoniae strain AR_0138 plasmid tig00000001, complete sequence	71175-71206	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	CP052471	Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-3, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP023943	Klebsiella pneumoniae strain FDAARGOS_444 plasmid unnamed1, complete sequence	22987-23018	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP014765	Klebsiella pneumoniae strain KPNIH39 plasmid pKpQIL-9b8, complete sequence	53364-53395	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP019904	Escherichia coli strain MDR_56 plasmid unnamed1, complete sequence	78293-78324	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026588	Klebsiella pneumoniae strain NUHL30457 plasmid p2, complete sequence	3628-3659	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP047634	Klebsiella pneumoniae strain K2606 plasmid unnamed1, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN891678	Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-KPC, complete sequence	97461-97492	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MK773536	Klebsiella pneumoniae strain QDE2 plasmid pQDE2-B, complete sequence	21111-21142	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MN543570	Klebsiella pneumoniae strain HKU49 plasmid pHKU49_CIP, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP041086	Klebsiella pneumoniae strain Kp202 plasmid pKp202_4, complete sequence	70-101	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MH909340	Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence	52-83	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MH917122	Klebsiella pneumoniae strain Kp715 plasmid pSZF_KPC, complete sequence	41067-41098	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MK413718	Klebsiella pneumoniae strain 427113 plasmid p427113-2, complete sequence	52-83	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MG878868	Klebsiella pneumoniae strain Kp21774 plasmid pKp21774-135, complete sequence	930-961	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MH464586	Klebsiella pneumoniae strain KP1572 plasmid pIMP1572, complete sequence	112363-112394	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MH477636	Klebsiella pneumoniae strain 130504051 plasmid p504051-KPC, complete sequence	96032-96063	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MK036886	Klebsiella pneumoniae strain 283149 plasmid p283149-KPC, complete sequence	59207-59238	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP020091	Enterobacter cloacae strain PIMB10EC27 plasmid pEC27-2, complete sequence	2508-2539	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN688131	Enterobacter hormaechei subsp. xiangfangensis strain ST114 plasmid pLAU_ENC1, complete sequence	35471-35502	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP016810	Klebsiella pneumoniae strain DHQP1002001 plasmid p_IncFIB_DHQP1002001, complete sequence	93390-93421	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP014777	Pluralibacter gergoviae strain FB2 plasmid pFB2.2, complete sequence	54108-54139	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MF156708	Klebsiella pneumoniae strain 13294 plasmid p13294-KPC, complete sequence	48715-48746	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MF168406	Klebsiella pneumoniae strain 283747 plasmid p283747-KPC, complete sequence	127342-127373	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MT109193	Klebsiella pneumoniae strain 156070 plasmid p156070-KPC, complete sequence	100589-100620	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP018448	Klebsiella pneumoniae strain Kp_Goe_33208 plasmid pKp_Goe_208-1, complete sequence	88922-88953	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_MG764553	Klebsiella pneumoniae strain A3295 plasmid pA3295-KPC, complete sequence	95699-95730	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP026371	Klebsiella quasipneumoniae strain A708 plasmid pA708-3, complete sequence	33963-33994	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP033755	Klebsiella pneumoniae strain FDAARGOS_566 plasmid unnamed1, complete sequence	9541-9572	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP035204	Klebsiella pneumoniae strain LH94 plasmid pLH94-8, complete sequence	114628-114659	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MN661404	Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-3, complete sequence	21579-21610	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MT108210	Klebsiella pneumoniae strain W09308 plasmid pW09308-KPC, complete sequence	181-212	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	MT108213	Klebsiella pneumoniae strain ZZ100 plasmid pZZ100-KPC, complete sequence	199-230	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP018737	Klebsiella pneumoniae strain Kp_Goe_121641 plasmid pKp_Goe_641-1	60154-60185	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP033776	Klebsiella pneumoniae strain FDAARGOS_531 plasmid unnamed3, complete sequence	24722-24753	9	0.719
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP033776	Klebsiella pneumoniae strain FDAARGOS_531 plasmid unnamed3, complete sequence	61737-61768	9	0.719
CP026982_3	3.33\|904481\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904481-904512	32	NZ_CP007144	Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence	148611-148642	9	0.719
CP026982_3	3.34\|904541\|33\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904541-904573	33	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1878460-1878492	9	0.727
CP026982_3	3.34\|904541\|33\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904541-904573	33	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1788241-1788273	9	0.727
CP026982_3	3.34\|904541\|33\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904541-904573	33	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1788243-1788275	9	0.727
CP026982_7	7.2\|4412627\|32\|CP026982\|CRT,CRISPRCasFinder	4412627-4412658	32	NZ_CP031836	Lactobacillus amylolyticus strain L5 plasmid p1, complete sequence	16675-16706	9	0.719
CP026982_7	7.2\|4412627\|32\|CP026982\|CRT,CRISPRCasFinder	4412627-4412658	32	NZ_CP020458	Lactobacillus amylolyticus strain L6 plasmid pL6-1, complete sequence	16675-16706	9	0.719
CP026982_7	7.9\|4413054\|32\|CP026982\|CRT,CRISPRCasFinder	4413054-4413085	32	NZ_CP026198	Enterobacteriaceae bacterium ENNIH3 plasmid pKPC-c606, complete sequence	53527-53558	9	0.719
CP026982_7	7.9\|4413054\|32\|CP026982\|CRT,CRISPRCasFinder	4413054-4413085	32	NZ_CP025983	Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence	65578-65609	9	0.719
CP026982_7	7.13\|4412629\|32\|CP026982\|PILER-CR	4412629-4412660	32	NZ_CP031836	Lactobacillus amylolyticus strain L5 plasmid p1, complete sequence	16675-16706	9	0.719
CP026982_7	7.13\|4412629\|32\|CP026982\|PILER-CR	4412629-4412660	32	NZ_CP020458	Lactobacillus amylolyticus strain L6 plasmid pL6-1, complete sequence	16675-16706	9	0.719
CP026982_7	7.20\|4413056\|32\|CP026982\|PILER-CR	4413056-4413087	32	NZ_CP026198	Enterobacteriaceae bacterium ENNIH3 plasmid pKPC-c606, complete sequence	53527-53558	9	0.719
CP026982_7	7.20\|4413056\|32\|CP026982\|PILER-CR	4413056-4413087	32	NZ_CP025983	Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence	65578-65609	9	0.719
CP026982_8	8.1\|4415196\|32\|CP026982\|CRISPRCasFinder,CRT	4415196-4415227	32	NC_048639	Pseudomonas phage ZC08, complete genome	68535-68566	9	0.719
CP026982_8	8.1\|4415196\|32\|CP026982\|CRISPRCasFinder,CRT	4415196-4415227	32	NC_048638	Pseudomonas phage ZC03, complete genome	67605-67636	9	0.719
CP026982_8	8.2\|4415257\|33\|CP026982\|CRISPRCasFinder,CRT	4415257-4415289	33	NZ_CP039495	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_2, complete sequence	15426-15458	9	0.727
CP026982_8	8.2\|4415257\|33\|CP026982\|CRISPRCasFinder,CRT	4415257-4415289	33	MK714353	Klebsiella phage ST13-OXA48phi12.5, complete genome	12335-12367	9	0.727
CP026982_8	8.2\|4415257\|33\|CP026982\|CRISPRCasFinder,CRT	4415257-4415289	33	MN013086	Klebsiella phage vB_Kpn_Chronis, complete genome	37956-37988	9	0.727
CP026982_8	8.14\|4415990\|32\|CP026982\|CRISPRCasFinder,CRT	4415990-4416021	32	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	76576-76607	9	0.719
CP026982_8	8.18\|4415257\|34\|CP026982\|PILER-CR	4415257-4415290	34	NZ_CP039495	Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_2, complete sequence	15425-15458	9	0.735
CP026982_8	8.18\|4415257\|34\|CP026982\|PILER-CR	4415257-4415290	34	MK714353	Klebsiella phage ST13-OXA48phi12.5, complete genome	12335-12368	9	0.735
CP026982_8	8.18\|4415257\|34\|CP026982\|PILER-CR	4415257-4415290	34	MN013086	Klebsiella phage vB_Kpn_Chronis, complete genome	37956-37989	9	0.735
CP026982_8	8.30\|4415990\|33\|CP026982\|PILER-CR	4415990-4416022	33	NZ_LR134454	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence	76575-76607	9	0.727
CP026982_2	2.13\|884480\|32\|CP026982\|CRISPRCasFinder,CRT	884480-884511	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2132003-2132034	10	0.688
CP026982_2	2.16\|884661\|32\|CP026982\|CRISPRCasFinder,CRT	884661-884692	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	362267-362298	10	0.688
CP026982_2	2.20\|884902\|32\|CP026982\|CRISPRCasFinder,CRT	884902-884933	32	CP000876	Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence	159698-159729	10	0.688
CP026982_2	2.26\|885264\|32\|CP026982\|CRISPRCasFinder,CRT	885264-885295	32	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	546593-546624	10	0.688
CP026982_2	2.37\|884483\|32\|CP026982\|PILER-CR	884483-884514	32	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	2132003-2132034	10	0.688
CP026982_2	2.40\|884664\|32\|CP026982\|PILER-CR	884664-884695	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	362267-362298	10	0.688
CP026982_2	2.44\|884905\|32\|CP026982\|PILER-CR	884905-884936	32	CP000876	Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence	159698-159729	10	0.688
CP026982_2	2.50\|885267\|32\|CP026982\|PILER-CR	885267-885298	32	NZ_CP018784	Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence	546593-546624	10	0.688
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	12769-12800	10	0.688
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP033074	Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence	111523-111554	10	0.688
CP026982_3	3.18\|903588\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903588-903619	32	MN512538	Vibrio phage Seahorse, complete genome	5369-5400	10	0.688
CP026982_3	3.18\|903588\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903588-903619	32	NC_008043	Ruegeria sp. TM1040 megaplasmid, complete sequence	25782-25813	10	0.688
CP026982_3	3.25\|904001\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904001-904032	32	MN228696	Sinorhizobium phage ort11, complete genome	28991-29022	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP026927	Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609a, complete sequence	92336-92367	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	634007-634038	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	NZ_LN997849	Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence	22999-23030	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	MK620899	Gordonia phage GodonK, complete genome	3435-3466	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	MK620899	Gordonia phage GodonK, complete genome	118417-118448	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	MN096369	Gordonia phage Phendrix, complete genome	3275-3306	10	0.688
CP026982_3	3.26\|904061\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904061-904092	32	MN096369	Gordonia phage Phendrix, complete genome	116873-116904	10	0.688
CP026982_3	3.29\|904241\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	904241-904272	32	NZ_CP045419	Pseudoalteromonas sp. THAF3 plasmid pTHAF3_a, complete sequence	268408-268439	10	0.688
CP026982_7	7.5\|4412810\|32\|CP026982\|CRT,CRISPRCasFinder	4412810-4412841	32	MN693122	Marine virus AFVG_25M460, complete genome	7900-7931	10	0.688
CP026982_7	7.6\|4412871\|32\|CP026982\|CRT,CRISPRCasFinder	4412871-4412902	32	MK290739	Pectobacterium phage Q19, complete genome	16840-16871	10	0.688
CP026982_7	7.9\|4413054\|32\|CP026982\|CRT,CRISPRCasFinder	4413054-4413085	32	NZ_CP054609	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence	22051-22082	10	0.688
CP026982_7	7.9\|4413054\|32\|CP026982\|CRT,CRISPRCasFinder	4413054-4413085	32	NZ_CP054611	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed3, complete sequence	38813-38844	10	0.688
CP026982_7	7.10\|4413115\|32\|CP026982\|CRT,CRISPRCasFinder	4413115-4413146	32	NZ_AP018258	Calothrix sp. NIES-4071 plasmid plasmid3 DNA, complete genome	95159-95190	10	0.688
CP026982_7	7.12\|4413237\|32\|CP026982\|CRT,CRISPRCasFinder	4413237-4413268	32	NZ_CP012265	Cronobacter condimenti 1330 strain LMG 26250 plasmid pCCO1, complete sequence	144911-144942	10	0.688
CP026982_7	7.16\|4412812\|32\|CP026982\|PILER-CR	4412812-4412843	32	MN693122	Marine virus AFVG_25M460, complete genome	7900-7931	10	0.688
CP026982_7	7.17\|4412873\|32\|CP026982\|PILER-CR	4412873-4412904	32	MK290739	Pectobacterium phage Q19, complete genome	16840-16871	10	0.688
CP026982_7	7.20\|4413056\|32\|CP026982\|PILER-CR	4413056-4413087	32	NZ_CP054609	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence	22051-22082	10	0.688
CP026982_7	7.20\|4413056\|32\|CP026982\|PILER-CR	4413056-4413087	32	NZ_CP054611	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed3, complete sequence	38813-38844	10	0.688
CP026982_7	7.21\|4413117\|32\|CP026982\|PILER-CR	4413117-4413148	32	NZ_AP018258	Calothrix sp. NIES-4071 plasmid plasmid3 DNA, complete genome	95159-95190	10	0.688
CP026982_7	7.23\|4413239\|32\|CP026982\|PILER-CR	4413239-4413270	32	NZ_CP012265	Cronobacter condimenti 1330 strain LMG 26250 plasmid pCCO1, complete sequence	144911-144942	10	0.688
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030922	Escherichia coli strain KL53 plasmid pKL53-S, complete sequence	889-920	11	0.656
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030922	Escherichia coli strain KL53 plasmid pKL53-S, complete sequence	3700-3731	11	0.656
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030922	Escherichia coli strain KL53 plasmid pKL53-S, complete sequence	6873-6904	11	0.656
CP026982_3	3.1\|902568\|32\|CP026982\|CRISPRCasFinder,CRT	902568-902599	32	NZ_CP030922	Escherichia coli strain KL53 plasmid pKL53-S, complete sequence	76368-76399	11	0.656
CP026982_3	3.17\|903528\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903528-903559	32	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	335552-335583	11	0.656
CP026982_3	3.21\|903761\|32\|CP026982\|CRISPRCasFinder,CRT,PILER-CR	903761-903792	32	LR745207	uncultured phage genome assembly, chromosome: 1	964-995	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP047377	Aeromonas salmonicida subsp. salmonicida strain J410 plasmid p1AsJ410, complete sequence	57466-57497	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP048224	Aeromonas salmonicida subsp. salmonicida strain J223 plasmid pASal5, complete sequence	150175-150206	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP022183	Aeromonas salmonicida strain S68 plasmid pS68-2, complete sequence	41859-41890	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NC_009350	Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence	94129-94160	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP038103	Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence	96732-96763	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP017145	Aeromonas salmonicida subsp. masoucida strain RFAS1 plasmid unnamed2, complete sequence	62765-62796	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP022178	Aeromonas salmonicida strain S44 plasmid pS44-3, complete sequence	57650-57681	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP022172	Aeromonas salmonicida strain S121 plasmid pS121-3, complete sequence	6949-6980	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_CP047375	Aeromonas salmonicida subsp. salmonicida strain J409 plasmid p1AsJ409, complete sequence	70002-70033	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	NZ_KY555069	Aeromonas salmonicida subsp. salmonicida strain 01-B526 plasmid pAsa5, complete sequence	96762-96793	11	0.656
CP026982_8	8.15\|4416051\|32\|CP026982\|CRISPRCasFinder,CRT	4416051-4416082	32	CP052035	Aeromonas salmonicida subsp. salmonicida strain J411 plasmid p1AsJ411, complete sequence	67954-67985	11	0.656

1. spacer 3.9|903048|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_019522 (Pectobacterium phage ZF40, complete genome) position: , mismatch: 0, identity: 1.0

gattcgcgggttagcgtgggtggttctgcgct	CRISPR spacer
gattcgcgggttagcgtgggtggttctgcgct	Protospacer
********************************

2. spacer 8.5|4415441|32|CP026982|CRISPRCasFinder,CRT matches to NC_019522 (Pectobacterium phage ZF40, complete genome) position: , mismatch: 0, identity: 1.0

gacgtgttgttatcagcgatcgatacatacga	CRISPR spacer
gacgtgttgttatcagcgatcgatacatacga	Protospacer
********************************

3. spacer 8.21|4415441|33|CP026982|PILER-CR matches to NC_019522 (Pectobacterium phage ZF40, complete genome) position: , mismatch: 0, identity: 1.0

gacgtgttgttatcagcgatcgatacatacgac	CRISPR spacer
gacgtgttgttatcagcgatcgatacatacgac	Protospacer
*********************************

4. spacer 2.17|884721|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 1, identity: 0.969

cgaaaggcacgtaaacagattgcccgacttta	CRISPR spacer
cgaaaggcacataaacagattgcccgacttta	Protospacer
**********.*********************

5. spacer 2.17|884721|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 1, identity: 0.969

cgaaaggcacgtaaacagattgcccgacttta	CRISPR spacer
cgaaaggcacataaacagattgcccgacttta	Protospacer
**********.*********************

6. spacer 2.41|884724|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 1, identity: 0.969

cgaaaggcacgtaaacagattgcccgacttta	CRISPR spacer
cgaaaggcacataaacagattgcccgacttta	Protospacer
**********.*********************

7. spacer 2.41|884724|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 1, identity: 0.969

cgaaaggcacgtaaacagattgcccgacttta	CRISPR spacer
cgaaaggcacataaacagattgcccgacttta	Protospacer
**********.*********************

8. spacer 3.7|902928|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021004 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence) position: , mismatch: 1, identity: 0.969

tggtattcgtcgccggtcactcggtcatccgt	CRISPR spacer
tggtattcgtcgctggtcactcggtcatccgt	Protospacer
*************.******************

9. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026273 (Klebsiella oxytoca strain KONIH4 plasmid pKOX-ea2b, complete sequence) position: , mismatch: 1, identity: 0.964

ttagaccaacatgcaaca-aggggtataa	CRISPR spacer
ttagaccaacatgcaacagaggggtata-	Protospacer
****************** *********

10. spacer 2.1|883758|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP026273 (Klebsiella oxytoca strain KONIH4 plasmid pKOX-ea2b, complete sequence) position: , mismatch: 2, identity: 0.938

gctgaatatcgttttcctgttcactgtgatct	CRISPR spacer
gctgaatatagttttcctgttcactgtcatct	Protospacer
********* ***************** ****

11. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atagcgcaccataacattgttagcgcttacat	CRISPR spacer
ttagcgcaccataacattgtttgcgcttacat	Protospacer
 ******************** **********

12. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atagcgcaccataacattgttagcgcttacat	CRISPR spacer
ttagcgcaccataacattgtttgcgcttacat	Protospacer
 ******************** **********

13. spacer 2.12|884420|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atcatgcacatcatggatgaattggaattgtg	CRISPR spacer
atcatgcacatcatggatgaactggaattgag	Protospacer
*********************.******** *

14. spacer 2.12|884420|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atcatgcacatcatggatgaattggaattgtg	CRISPR spacer
atcatgcacatcatggatgaactggaattgag	Protospacer
*********************.******** *

15. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP015073 (Escherichia coli strain Ecol_743 plasmid pEC743_4, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

16. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KM670336 (Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

17. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045255 (Proteus mirabilis strain L90-1 plasmid pL902, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

18. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to AP018710 (Uncultured bacterium plasmid pSN1216-29 DNA, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

19. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP021021 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

20. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046349 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

21. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP021004 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

22. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to KC170285 (Uncultured bacterium plasmid pMBUI2, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

23. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014764 (Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-704, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

24. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP020602 (Pseudomonas aeruginosa strain E6130952 plasmid pJHX613, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

25. spacer 2.20|884902|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

acgagtttctgccgcttgccctgctttctgct	CRISPR spacer
acgggtttcagccgcttgccctgctttctgct	Protospacer
***.***** **********************

26. spacer 2.20|884902|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

acgagtttctgccgcttgccctgctttctgct	CRISPR spacer
acgggtttcagccgcttgccctgctttctgct	Protospacer
***.***** **********************

27. spacer 2.24|885143|33|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.939

cctgcgaaacctgaaagcggataatttgcagtg	CRISPR spacer
tctgcgaaacctgaaagcggataatttgcagta	Protospacer
.*******************************.

28. spacer 2.24|885143|33|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.939

cctgcgaaacctgaaagcggataatttgcagtg	CRISPR spacer
tctgcgaaacctgaaagcggataatttgcagta	Protospacer
.*******************************.

29. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
aggaagttttaggggtatgtatgtttatacag	Protospacer
****. **************************

30. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
aggaagttttaggggtatgtatgtttatacag	Protospacer
****. **************************

31. spacer 2.34|884302|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atagcgcaccataacattgttagcgcttacat	CRISPR spacer
ttagcgcaccataacattgtttgcgcttacat	Protospacer
 ******************** **********

32. spacer 2.34|884302|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atagcgcaccataacattgttagcgcttacat	CRISPR spacer
ttagcgcaccataacattgtttgcgcttacat	Protospacer
 ******************** **********

33. spacer 2.36|884423|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atcatgcacatcatggatgaattggaattgtg	CRISPR spacer
atcatgcacatcatggatgaactggaattgag	Protospacer
*********************.******** *

34. spacer 2.36|884423|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

atcatgcacatcatggatgaattggaattgtg	CRISPR spacer
atcatgcacatcatggatgaactggaattgag	Protospacer
*********************.******** *

35. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP015073 (Escherichia coli strain Ecol_743 plasmid pEC743_4, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

36. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_KM670336 (Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

37. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP045255 (Proteus mirabilis strain L90-1 plasmid pL902, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

38. spacer 2.38|884543|32|CP026982|PILER-CR matches to AP018710 (Uncultured bacterium plasmid pSN1216-29 DNA, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

39. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP021021 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

40. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP046349 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

41. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP021004 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pE, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

42. spacer 2.38|884543|32|CP026982|PILER-CR matches to KC170285 (Uncultured bacterium plasmid pMBUI2, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

43. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP014764 (Klebsiella pneumoniae strain KPNIH39 plasmid pKPN-704, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

44. spacer 2.38|884543|32|CP026982|PILER-CR matches to NZ_CP020602 (Pseudomonas aeruginosa strain E6130952 plasmid pJHX613, complete sequence) position: , mismatch: 2, identity: 0.938

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
gagctgcgtaagaaaaactgcctcgtcatcat	Protospacer
********.********.**************

45. spacer 2.44|884905|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

acgagtttctgccgcttgccctgctttctgct	CRISPR spacer
acgggtttcagccgcttgccctgctttctgct	Protospacer
***.***** **********************

46. spacer 2.44|884905|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

acgagtttctgccgcttgccctgctttctgct	CRISPR spacer
acgggtttcagccgcttgccctgctttctgct	Protospacer
***.***** **********************

47. spacer 2.48|885146|33|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.939

cctgcgaaacctgaaagcggataatttgcagtg	CRISPR spacer
tctgcgaaacctgaaagcggataatttgcagta	Protospacer
.*******************************.

48. spacer 2.48|885146|33|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.939

cctgcgaaacctgaaagcggataatttgcagtg	CRISPR spacer
tctgcgaaacctgaaagcggataatttgcagta	Protospacer
.*******************************.

49. spacer 2.49|885207|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
aggaagttttaggggtatgtatgtttatacag	Protospacer
****. **************************

50. spacer 2.49|885207|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 2, identity: 0.938

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
aggaagttttaggggtatgtatgtttatacag	Protospacer
****. **************************

51. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034939 (Pectobacterium odoriferum strain JK2.1 plasmid p.Jk2_1, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagcccgccc	Protospacer
*********.**************** *****

52. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP021658 (Aeromonas salmonicida strain O23A plasmid pO23AP4, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctgactcgatgcgcagcatgacagcgcgacc	Protospacer
****.************************ **

53. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022182 (Aeromonas salmonicida strain S68 plasmid pS68-1, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgtagcatgacagcgcgacc	Protospacer
**************.************** **

54. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017144 (Aeromonas salmonicida subsp. masoucida strain RFAS1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgtagcatgacagcgcgacc	Protospacer
**************.************** **

55. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022177 (Aeromonas salmonicida strain S44 plasmid pS44-2, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgtagcatgacagcgcgacc	Protospacer
**************.************** **

56. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022171 (Aeromonas salmonicida strain S121 plasmid pS121-2, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgtagcatgacagcgcgacc	Protospacer
**************.************** **

57. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP054213 (Erwiniaceae bacterium PD-1 plasmid pPD-1, complete sequence) position: , mismatch: 2, identity: 0.938

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gccggctcggtgcgcagcatgacagcgcgccc	Protospacer
**.******.**********************

58. spacer 3.7|902928|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021021 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence) position: , mismatch: 2, identity: 0.938

tggtattcgtcgccggtcactcggtcatccgt	CRISPR spacer
tggtattcgtcgctggccactcggtcatccgt	Protospacer
*************.**.***************

59. spacer 3.7|902928|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021021 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6167 plasmid pE, complete sequence) position: , mismatch: 2, identity: 0.938

tggtattcgtcgccggtcactcggtcatccgt	CRISPR spacer
tggtattcgtcgctggccactcggtcatccgt	Protospacer
*************.**.***************

60. spacer 3.7|902928|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046349 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.938

tggtattcgtcgccggtcactcggtcatccgt	CRISPR spacer
tggtattcgtcgccggtcactccgtgatccgt	Protospacer
********************** ** ******

61. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KT033470 (Aeromonas salmonicida subsp. salmonicida strain JF2267 plasmid pAsa4c, complete sequence) position: , mismatch: 2, identity: 0.929

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtataa	Protospacer
******** ********.**********

62. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_AP019196 (Aeromonas caviae strain GSH8M-1 plasmid pGSH8M-1-1, complete sequence) position: , mismatch: 2, identity: 0.929

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtataa	Protospacer
******** ********.**********

63. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP022176 (Aeromonas salmonicida strain S44 plasmid pS44-1, complete sequence) position: , mismatch: 2, identity: 0.929

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtataa	Protospacer
******** ********.**********

64. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to NC_047887 (Pectobacterium phage DU_PP_V, complete genome) position: , mismatch: 3, identity: 0.906

atagcgcaccataacattgttagcgcttacat	CRISPR spacer
agggcgcaccataacattgtttgcgcttacat	Protospacer
* .****************** **********

65. spacer 2.34|884302|32|CP026982|PILER-CR matches to NC_047887 (Pectobacterium phage DU_PP_V, complete genome) position: , mismatch: 3, identity: 0.906

atagcgcaccataacattgttagcgcttacat	CRISPR spacer
agggcgcaccataacattgtttgcgcttacat	Protospacer
* .****************** **********

66. spacer 3.7|902928|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to KC170285 (Uncultured bacterium plasmid pMBUI2, complete sequence) position: , mismatch: 3, identity: 0.906

tggtattcgtcgccggtcactcggtcatccgt	CRISPR spacer
tggttttcgtcgccggtcattcggtcatccgg	Protospacer
**** **************.***********

67. spacer 3.13|903288|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN602881 (Erwinia phage Midgardsormr38, complete genome) position: , mismatch: 3, identity: 0.906

catcgctggcgtattcagtgtggtcgaaagag	CRISPR spacer
catcgctgtcgtattcagtgtggtcgaatgaa	Protospacer
******** ******************* **.

68. spacer 3.13|903288|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN856003 (Bacteriophage sp. isolate 1, complete genome) position: , mismatch: 3, identity: 0.906

catcgctggcgtattcagtgtggtcgaaagag	CRISPR spacer
cgtcgctggcgtagtcagtgtggtcgaacgag	Protospacer
*.*********** ************** ***

69. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to MN095770 (Serratia phage Slocum, complete genome) position: , mismatch: 4, identity: 0.875

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggtatgtatgtttatacag	Protospacer
**..  **************************

70. spacer 2.49|885207|32|CP026982|PILER-CR matches to MN095770 (Serratia phage Slocum, complete genome) position: , mismatch: 4, identity: 0.875

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggtatgtatgtttatacag	Protospacer
**..  **************************

71. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP054046 (Yersinia massiliensis strain 2011N-4075 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.875

gctggctcgatgcgcagcatgac-agcgcgccc	CRISPR spacer
gctggctctgtgcgcagcatgacaagcccgcc-	Protospacer
******** .************* *** ****

72. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_022540 (Xanthomonas citri pv. fuscans plasmid plb, complete sequence) position: , mismatch: 4, identity: 0.875

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgcagcacgacagcccggac	Protospacer
*******************.****** **  *

73. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP021009 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6975 plasmid pB, complete sequence) position: , mismatch: 4, identity: 0.875

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgcagcacgacagcccggac	Protospacer
*******************.****** **  *

74. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP020995 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP4885 plasmid pB, complete sequence) position: , mismatch: 4, identity: 0.875

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgcagcacgacagcccggac	Protospacer
*******************.****** **  *

75. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP021005 (Xanthomonas citri pv. phaseoli var. fuscans strain CFBP6166 plasmid pB, complete sequence) position: , mismatch: 4, identity: 0.875

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcgatgcgcagcacgacagcccggac	Protospacer
*******************.****** **  *

76. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP050010 (Citrobacter sp. Y3 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.875

gctggctcgatgcgcagcatgacagc-gcgccc	CRISPR spacer
gctggctcgatgcgcagcacgaccgtagcgcc-	Protospacer
*******************.*** *. *****

77. spacer 3.19|903648|25|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MT233524 (Salmonella phage vB_Sen_I1, complete genome) position: , mismatch: 4, identity: 0.84

ctttagtgcaggcagcggggcgcta	CRISPR spacer
aattaatgcaggcagcggcgcgcta	Protospacer
  ***.************ ******

78. spacer 3.32|904421|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 4, identity: 0.875

attggaataaggcaattaatagccgtgcttag	CRISPR spacer
actggaataaggcaattaatagtcctgcttat	Protospacer
*.********************.* ******

79. spacer 3.32|904421|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 4, identity: 0.875

attggaataaggcaattaatagccgtgcttag	CRISPR spacer
actggaataaggcaattaatagtcctgcttat	Protospacer
*.********************.* ******

80. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041048 (Citrobacter sp. CF971 plasmid pBM527-2, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

81. spacer 7.1|4412570|28|CP026982|CRT matches to MN783744 (Klebsiella oxytoca plasmid pFDL-VIM, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

82. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP022274 (Citrobacter freundii strain 18-1 plasmid pA18-1, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

83. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP042536 (Citrobacter freundii strain E51 plasmid pE51_002, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

84. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

85. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP034714 (Salmonella enterica subsp. enterica serovar Mikawasima strain RSE15 plasmid pRSE15, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

86. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP010360 (Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

87. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

88. spacer 7.1|4412570|28|CP026982|CRT matches to MN783743 (Escherichia coli plasmid pGA_VIM, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

89. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP034084 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-VIM, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

90. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH220284 (Aeromonas sp. pRIVM0001_VIM-1 plasmid pRIVM0001_VIM-1_171012_B12, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

91. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MG228427 (Kluyvera cryocrescens strain BO64W plasmid pKC-BO-N1-VIM, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

92. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH325469 (Enterobacter hormaechei strain Ec13 plasmid pEc13, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

93. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH325468 (Enterobacter hormaechei strain Ec09 plasmid pEc09, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

94. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH594478 (Citrobacter freundii strain AA593 plasmid pIBAC_Incx3_A/C, complete sequence) position: , mismatch: 4, identity: 0.857

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtagga	Protospacer
******** ********.******* .*

95. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP016446 (Pseudomonas putida strain IEC33019 plasmid pIEC33019, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

96. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_010891 (Pseudomonas sp. CT14 plasmid pCT14, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

97. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029092 (Pseudomonas aeruginosa strain AR441 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

98. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP027168 (Pseudomonas aeruginosa strain AR_0356 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

99. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019906 (Pseudomonas putida HB3267 plasmid pPC9, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
tgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

100. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to MN961669 (Pseudomonas monteilii strain 918607 plasmid p918607-IMP, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

101. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK671725 (Pseudomonas mosselii strain AM/94 plasmid pMOS94, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
tgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

102. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK047610 (Pseudomonas aeruginosa strain 163940 plasmid pTROUS1, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgtggctcgatgcgcagcacgacagcccgcgc	Protospacer
  *****************.****** *** *

103. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029374 (Acidovorax citrulli strain M6 plasmid pACM6, complete sequence) position: , mismatch: 5, identity: 0.844

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
ggtggctcgatgcgcagcacgacagcccggtc	Protospacer
* *****************.****** ** .*

104. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KT935446 (Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence) position: , mismatch: 5, identity: 0.821

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacaagggggaggg	Protospacer
******** ************** * ..

105. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KP276584 (Escherichia coli strain 39R861 plasmid p39R861-4, complete sequence) position: , mismatch: 5, identity: 0.821

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtggga	Protospacer
******** ********.******. .*

106. spacer 7.1|4412570|28|CP026982|CRT matches to NC_012885 (Aeromonas hydrophila plasmid pRA1, complete sequence) position: , mismatch: 5, identity: 0.821

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtggga	Protospacer
******** ********.******. .*

107. spacer 7.1|4412570|28|CP026982|CRT matches to NC_012886 (Escherichia coli plasmid pRAx, complete sequence) position: , mismatch: 5, identity: 0.821

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggtggga	Protospacer
******** ********.******. .*

108. spacer 7.1|4412570|28|CP026982|CRT matches to AP014939 (Citrobacter freundii plasmid pKHM-1 DNA, complete sequence, strain: KHM 243) position: , mismatch: 5, identity: 0.821

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggaggaa	Protospacer
******** ********.***** . **

109. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_AP018687 (Vibrio rumoiensis strain FERM P-14531 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.821

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggaggaa	Protospacer
******** ********.***** . **

110. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to NC_007603 (Enterobacteria phage RTP, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

111. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to KY398841 (Escherichia phage vB_Ecos_CEB_EC3a, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

112. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to KF771238 (Escherichia phage bV_EcoS_AHS24, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

113. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to KF771237 (Escherichia phage bV_EcoS_AHP42, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

114. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to AM156909 (Bacteriophage RTP, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

115. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to NC_024789 (Escherichia phage bV_EcoS_AKS96, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

116. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to MG065688 (UNVERIFIED: Campylobacter phage A110b, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

117. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to NC_019404 (Enterobacteria phage vB_EcoS_ACG-M12, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

118. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to MK372342 (Enterobacteria phage vB_EcoS_IME542, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctcctgagaggg	Protospacer
  * *************.****** *******

119. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to KF771236 (Escherichia phage bV_EcoS_AHP24, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

120. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to GQ495225 (Escherichia phage RES-2009a putative terminase large subunit (halo21), putative portal protein (halo23), putative phage head morphogenesis protein (halo24), Halo25 (halo25), putative phage protein rtp26 (halo26), Halo27 (halo27), Halo28 (halo28), Halo29 (halo29), and Halo30 (halo30) genes, complete cds) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

121. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to NC_047893 (Escherichia phage DTL, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

122. spacer 7.23|4413239|32|CP026982|PILER-CR matches to NC_007603 (Enterobacteria phage RTP, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

123. spacer 7.23|4413239|32|CP026982|PILER-CR matches to KY398841 (Escherichia phage vB_Ecos_CEB_EC3a, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

124. spacer 7.23|4413239|32|CP026982|PILER-CR matches to KF771238 (Escherichia phage bV_EcoS_AHS24, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

125. spacer 7.23|4413239|32|CP026982|PILER-CR matches to KF771237 (Escherichia phage bV_EcoS_AHP42, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

126. spacer 7.23|4413239|32|CP026982|PILER-CR matches to AM156909 (Bacteriophage RTP, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

127. spacer 7.23|4413239|32|CP026982|PILER-CR matches to NC_024789 (Escherichia phage bV_EcoS_AKS96, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

128. spacer 7.23|4413239|32|CP026982|PILER-CR matches to MG065688 (UNVERIFIED: Campylobacter phage A110b, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

129. spacer 7.23|4413239|32|CP026982|PILER-CR matches to NC_019404 (Enterobacteria phage vB_EcoS_ACG-M12, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

130. spacer 7.23|4413239|32|CP026982|PILER-CR matches to MK372342 (Enterobacteria phage vB_EcoS_IME542, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctcctgagaggg	Protospacer
  * *************.****** *******

131. spacer 7.23|4413239|32|CP026982|PILER-CR matches to KF771236 (Escherichia phage bV_EcoS_AHP24, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
agtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

132. spacer 7.23|4413239|32|CP026982|PILER-CR matches to GQ495225 (Escherichia phage RES-2009a putative terminase large subunit (halo21), putative portal protein (halo23), putative phage head morphogenesis protein (halo24), Halo25 (halo25), putative phage protein rtp26 (halo26), Halo27 (halo27), Halo28 (halo28), Halo29 (halo29), and Halo30 (halo30) genes, complete cds) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

133. spacer 7.23|4413239|32|CP026982|PILER-CR matches to NC_047893 (Escherichia phage DTL, complete genome) position: , mismatch: 5, identity: 0.844

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
ggtacagacgtaaaaaagccctccgaagaggg	Protospacer
  * *************.*******.******

134. spacer 2.1|883758|32|CP026982|CRISPRCasFinder,CRT matches to LR134127 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 7) position: , mismatch: 6, identity: 0.812

gctgaatatcgttttcctgttcactgtgatct	CRISPR spacer
gctgaatatcgtgttcctgttcatcatgacca	Protospacer
************ **********...***.*

135. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

136. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

137. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

138. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MK630230 (Klebsiella phage Spivey, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

139. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MN434094 (Klebsiella phage AmPh_EK80, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

140. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

141. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

142. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

143. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to MG969413 (UNVERIFIED: Salmonella phage GE_vB_N8, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

144. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to NC_047835 (Escherichia phage OSYSP, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

145. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to NC_048853 (Phage NBEco001, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

146. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to NC_048853 (Phage NBEco001, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

147. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to MG969412 (UNVERIFIED: Salmonella phage GE_vB_N5, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

148. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttagcggtatgtatgtttgtacag	Protospacer
**..  ****** *************.*****

149. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttagcggtatgtatgtttgtacag	Protospacer
**..  ****** *************.*****

150. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to NC_047882 (Vibrio phage JSF12, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

151. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to KY883654 (Vibrio phage JSF10, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

152. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to KP280063 (Vibrio phage phi 3, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

153. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to KP280063 (Vibrio phage phi 3, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

154. spacer 2.25|885204|32|CP026982|CRISPRCasFinder,CRT matches to KP280062 (Vibrio phage phi 1, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagagttttagaggtatgtatatttatacag	Protospacer
**... ******.*********.*********

155. spacer 2.34|884302|32|CP026982|PILER-CR matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

156. spacer 2.34|884302|32|CP026982|PILER-CR matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

157. spacer 2.34|884302|32|CP026982|PILER-CR matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

158. spacer 2.34|884302|32|CP026982|PILER-CR matches to MK630230 (Klebsiella phage Spivey, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

159. spacer 2.34|884302|32|CP026982|PILER-CR matches to MN434094 (Klebsiella phage AmPh_EK80, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

160. spacer 2.34|884302|32|CP026982|PILER-CR matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

161. spacer 2.34|884302|32|CP026982|PILER-CR matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

162. spacer 2.34|884302|32|CP026982|PILER-CR matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 6, identity: 0.812

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcatg	Protospacer
 * ****************.* **** *.***

163. spacer 2.46|885026|32|CP026982|PILER-CR matches to MG969413 (UNVERIFIED: Salmonella phage GE_vB_N8, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

164. spacer 2.46|885026|32|CP026982|PILER-CR matches to NC_047835 (Escherichia phage OSYSP, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

165. spacer 2.46|885026|32|CP026982|PILER-CR matches to NC_048853 (Phage NBEco001, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

166. spacer 2.46|885026|32|CP026982|PILER-CR matches to NC_048853 (Phage NBEco001, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

167. spacer 2.46|885026|32|CP026982|PILER-CR matches to MG969412 (UNVERIFIED: Salmonella phage GE_vB_N5, complete genome) position: , mismatch: 6, identity: 0.812

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttacgcagcgcataatcaagcacgttgaaagt	Protospacer
 .****** *****.************** *

168. spacer 2.49|885207|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttagcggtatgtatgtttgtacag	Protospacer
**..  ****** *************.*****

169. spacer 2.49|885207|32|CP026982|PILER-CR matches to JX195166 (Pectobacterium phage My1, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttagcggtatgtatgtttgtacag	Protospacer
**..  ****** *************.*****

170. spacer 2.49|885207|32|CP026982|PILER-CR matches to NC_047882 (Vibrio phage JSF12, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

171. spacer 2.49|885207|32|CP026982|PILER-CR matches to KY883654 (Vibrio phage JSF10, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

172. spacer 2.49|885207|32|CP026982|PILER-CR matches to KP280063 (Vibrio phage phi 3, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

173. spacer 2.49|885207|32|CP026982|PILER-CR matches to KP280063 (Vibrio phage phi 3, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagcgttttaggggcatgtatatttatacag	Protospacer
**..  *********.******.*********

174. spacer 2.49|885207|32|CP026982|PILER-CR matches to KP280062 (Vibrio phage phi 1, complete genome) position: , mismatch: 6, identity: 0.812

aggagcttttaggggtatgtatgtttatacag	CRISPR spacer
agagagttttagaggtatgtatatttatacag	Protospacer
**... ******.*********.*********

175. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK033500 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj58k plasmid pConj58k, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgaaagccggcac	Protospacer
 ******************.** ***  ** *

176. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK033501 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgaaagccggcac	Protospacer
 ******************.** ***  ** *

177. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044976 (Hydrogenophaga sp. PBL-H3 substr. PBL-H3(B2) plasmid pPBL-H3_B2-1, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaggctcgatgcgcagcacgacagcgcgacg	Protospacer
   ****************.********* *

178. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP027261 (Pectobacterium parmentieri strain IFB5427 plasmid pPAR01, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagccgactg	Protospacer
*********.****************  .*.

179. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022492 (Salmonella enterica subsp. enterica serovar Saintpaul strain SA20031783 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagccccggt	Protospacer
*********.**************** *   .

180. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014305 (Erwinia billingiae Eb661 plasmid pEB170, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gccggctcggtgcgcagcatgacagcgtggtg	Protospacer
**.******.*****************.* .

181. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010187 (Escherichia coli strain M6 plasmid A, complete genome) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccgaccg	Protospacer
*********.**** ***********  .**

182. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010207 (Escherichia coli strain M11 plasmid A, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccgaccg	Protospacer
*********.**** ***********  .**

183. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010197 (Escherichia coli strain M9 plasmid A, complete genome) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccgaccg	Protospacer
*********.**** ***********  .**

184. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_021871 (Salmonella bongori N268-08 plasmid RM1, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccgaccg	Protospacer
*********.**** ***********  .**

185. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010222 (Escherichia coli strain M19 plasmid A, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccgaccg	Protospacer
*********.**** ***********  .**

186. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010214 (Escherichia coli strain M15 plasmid A, complete sequence) position: , mismatch: 6, identity: 0.812

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccgaccg	Protospacer
*********.**** ***********  .**

187. spacer 3.5|902808|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.812

aaggttgggcgctggtgccaattga-gccgact	CRISPR spacer
acggttgggcgctggtgccattcgacgtcgag-	Protospacer
* ****************** *.** *.***

188. spacer 6.1|4150172|28|CP026982|CRISPRCasFinder matches to CP002962 (Emticicia oligotrophica DSM 17448 plasmid pEMTOL01, complete sequence) position: , mismatch: 6, identity: 0.786

cgtccgtcataaaaaaacgttgggagcg	CRISPR spacer
atgccgaaataaaaaaacgttgggagtg	Protospacer
   ***  ******************.*

189. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_AP022377 (Providencia stuartii strain BML2537 plasmid pBML2537, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

190. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LC507075 (Providencia rettgeri strain BML2526 plasmid p.BML2526, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

191. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026281 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-01e8, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

192. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KX709966 (Pseudomonas aeruginosa strain IP40a plasmid pIP40a, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

193. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KX869741 (Enterobacter cloacae strain 20130723 plasmid R222, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

194. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY399978 (Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

195. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY986974 (Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

196. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887592 (Citrobacter freundii strain Cf52 plasmid pCf52, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

197. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887593 (Citrobacter freundii strain Cf53 plasmid pCf53, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

198. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887594 (Klebsiella pneumoniae strain Kp55 plasmid pKp55, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

199. spacer 7.1|4412570|28|CP026982|CRT matches to NC_022652 (Klebsiella pneumoniae strain CRE114 plasmid pIMP-PH114, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

200. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP033514 (Vibrio cholerae strain E4 plasmid pVCR94, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

201. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009414 (Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

202. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

203. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KX156772 (Escherichia coli strain K-12 plasmid IP40a, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

204. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KX156773 (Escherichia coli strain K-12 plasmid R16a, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

205. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KX029331 (Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

206. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

207. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009412 (Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

208. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009411 (Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

209. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

210. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KJ909290 (Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

211. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KM083064 (Vibrio cholerae strain ICDC-1447 plasmid pVC1447, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

212. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KR559888 (Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

213. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KR559889 (Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

214. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KM670336 (Salmonella enterica subsp. enterica serovar Senftenberg strain SRC119 plasmid pSRC119-A/C, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

215. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KP975074 (Citrobacter freundii strain MRSN11938 plasmid pMRVIM0912, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

216. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KR559890 (Enterobacter cloacae strain Ecl4873 plasmid pEcl-Gr4873, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

217. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KP056256 (Escherichia coli strain YDC637 plasmid pYDC637, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

218. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KP345882 (Escherichia coli strain BK32533 plasmid pBK32533, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

219. spacer 7.1|4412570|28|CP026982|CRT matches to AP014611 (Serratia marcescens plasmid p11663 DNA, complete sequence, strain: 11663) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

220. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

221. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

222. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025141 (Klebsiella pneumoniae strain KP1768 plasmid KP1768_p1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

223. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032391 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

224. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP017987 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

225. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP017387 (Klebsiella pneumoniae strain KP36 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

226. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP047308 (Citrobacter freundii strain L75 plasmid pCf75, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

227. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

228. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP010373 (Escherichia coli strain 6409 plasmid p6409-202.186kb, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

229. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP048305 (Escherichia coli strain 9 plasmid p009_A, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

230. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025240 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

231. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025242 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

232. spacer 7.1|4412570|28|CP026982|CRT matches to LC055503 (Klebsiella pneumoniae plasmid pHM881QN DNA, complete sequence, strain: Y881) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

233. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024192 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

234. spacer 7.1|4412570|28|CP026982|CRT matches to MN477204 (Escherichia coli strain S15FP06257 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

235. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP017058 (Citrobacter freundii strain SL151 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

236. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP020513 (Escherichia coli strain 165 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

237. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LS992184 (Citrobacter freundii isolate Citrobacter freundii str. U2785 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

238. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018716 (Klebsiella pneumoniae strain Kp_Goe_152021 plasmid pKp_Goe_021-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

239. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018722 (Klebsiella pneumoniae strain KP_Goe_828304 plasmid pKp_Goe_304-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

240. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018704 (Klebsiella pneumoniae strain Kp_Goe_827024 plasmid pKp_Goe_024-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

241. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP029249 (Salmonella enterica subsp. enterica serovar Thompson strain HFCDC-SM-846 plasmid p846, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

242. spacer 7.1|4412570|28|CP026982|CRT matches to NC_008612 (Photobacterium damselae subsp. piscicida plasmid pP99-018, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

243. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025470 (Klebsiella pneumoniae strain JS187 plasmid p187-4, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

244. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP022359 (Shewanella bicestrii strain JAB-1 plasmid pSHE-CTX-M, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

245. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT904892 (Salmonella enterica subsp. enterica serovar Typhi strain 80-2002 plasmid 2) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

246. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP029802 (Salmonella enterica subsp. enterica serovar Anatum strain R16.0676 plasmid pR16.0676_90k, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

247. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP008790 (Klebsiella oxytoca KONIH1 plasmid pKOX-86d, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

248. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP027038 (Klebsiella pneumoniae strain 16_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

249. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP028316 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067217 plasmid pSC-31-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

250. spacer 7.1|4412570|28|CP026982|CRT matches to CP009868 (Pantoea sp. PSNIH2 plasmid pPSP-100, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

251. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP012682 (Salmonella enterica subsp. enterica serovar Typhimurium strain 33676 plasmid p33676_IncA/C, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

252. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP042646 (Escherichia coli strain NCYU-21-79 plasmid pNCYU-21-79-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

253. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP031549 (Escherichia coli strain cq9 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

254. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032385 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N53043 plasmid pN53043_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

255. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032388 (Salmonella enterica subsp. enterica serovar Dublin strain CVM N45955 plasmid pN45955_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

256. spacer 7.1|4412570|28|CP026982|CRT matches to LC556210 (Enterobacter cloacae CC23 plasmid pCC23 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

257. spacer 7.1|4412570|28|CP026982|CRT matches to LC556211 (Enterobacter cloacae CC32 plasmid pCC32 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

258. spacer 7.1|4412570|28|CP026982|CRT matches to LC556212 (Klebsiella pneumoniae CC37 plasmid pCC37 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

259. spacer 7.1|4412570|28|CP026982|CRT matches to LC556213 (Escherichia coli S44 plasmid pS44 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

260. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP022063 (Salmonella enterica strain FDAARGOS_312 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

261. spacer 7.1|4412570|28|CP026982|CRT matches to MN175387 (Klebsiella pneumoniae strain KP-14-6 plasmid pKP-14-6-NDM-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

262. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP014978 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1896 isolate ST03-F34 plasmid pSTY1-1896, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

263. spacer 7.1|4412570|28|CP026982|CRT matches to NC_008613 (Photobacterium damselae subsp. piscicida plasmid pP91278, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

264. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP031564 (Klebsiella pneumoniae strain 2-1 plasmid pKP21AC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

265. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032397 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22429 plasmid p22429, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

266. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP027055 (Klebsiella pneumoniae strain 2_GR_12 plasmid IncAC2) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

267. spacer 7.1|4412570|28|CP026982|CRT matches to MN254970 (Escherichia coli strain EC009 plasmid pEC009.1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

268. spacer 7.1|4412570|28|CP026982|CRT matches to CP052444 (Klebsiella pneumoniae strain C16KP0098 plasmid pC16KP0098-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

269. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP014658 (Salmonella enterica subsp. enterica serovar Anatum str. USDA-ARS-USMARC-1736 plasmid pSAN1-1736, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

270. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP043190 (Escherichia coli O16:H48 strain PG20180175 plasmid pPG20180175.1-IncAC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

271. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025231 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1924 plasmid pSNE1-1924, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

272. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026552 (Citrobacter sp. SL156 plasmid unnamed3) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

273. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP039562 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014847 plasmid p08-5333.1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

274. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP038330 (Escherichia coli O157:H7 strain NE 1092-2 plasmid pNE1092-3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

275. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP038326 (Escherichia coli O157:H7 strain NE 1169-1 plasmid pNE1169-3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

276. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP030077 (Enterobacter hormaechei strain 20710 plasmid p3-20710, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

277. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041083 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

278. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP043215 (Salmonella enterica subsp. enterica serovar Heidelberg strain SL-312 plasmid pET8.1-IncAC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

279. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP031362 (Salmonella enterica subsp. enterica serovar Heidelberg strain 5 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

280. spacer 7.1|4412570|28|CP026982|CRT matches to KU160531 (Vibrio alginolyticus strain VAS3-1 plasmid pVAS3-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

281. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP038322 (Escherichia coli O157:H7 strain NE1127 plasmid pNE1127-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

282. spacer 7.1|4412570|28|CP026982|CRT matches to NC_016974 (Providencia stuartii plasmid pMR0211, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

283. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP008824 (UNVERIFIED_ORG: Enterobacter cloacae ECNIH2 plasmid pKEC-39c, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

284. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041103 (Klebsiella pneumoniae subsp. pneumoniae strain KPCTRSRTH07 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

285. spacer 7.1|4412570|28|CP026982|CRT matches to MN310369 (Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-Ct1/2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

286. spacer 7.1|4412570|28|CP026982|CRT matches to MN310370 (Klebsiella pneumoniae strain 11935 plasmid p11935-Ct1/2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

287. spacer 7.1|4412570|28|CP026982|CRT matches to MN310378 (Klebsiella pneumoniae strain A2293 plasmid pA2293-Ct2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

288. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP021835 (Klebsiella pneumoniae strain AR_0120 plasmid tig00000516_pilon, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

289. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP021956 (Klebsiella pneumoniae strain AR_0107 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

290. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009560 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22425 plasmid pCVM22425, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

291. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045459 (Salmonella enterica subsp. enterica serovar Anatum strain M-3471 plasmid pM-3471_DHA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

292. spacer 7.1|4412570|28|CP026982|CRT matches to NC_022372 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT3 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

293. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041641 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-MCR1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

294. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026207 (Escherichia coli strain ECONIH5 plasmid pECO-dc1b, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

295. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009562 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22513 plasmid pCVM22513, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

296. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP031802 (Klebsiella pneumoniae strain MSB1_8A-sc-2280397 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

297. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP040024 (Klebsiella pneumoniae strain KPC160132 plasmid pIncC-L132, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

298. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045517 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-4737 plasmid pSal-4737_DHA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

299. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045520 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 plasmid pSal-5091_DHA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

300. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045462 (Salmonella enterica subsp. enterica serovar Anatum strain M-3851 plasmid pM-3851_DHA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

301. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045467 (Salmonella enterica subsp. enterica serovar Anatum strain Sal-3973 plasmid pSal-3973_DHA_CMY, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

302. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045510 (Salmonella enterica subsp. enterica serovar Anatum strain M-5360 plasmid pM-5360_DHA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

303. spacer 7.1|4412570|28|CP026982|CRT matches to NC_023291 (Vibrio cholerae strain BI144 plasmid pVCR94deltaX, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

304. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP007732 (Klebsiella pneumoniae subsp. pneumoniae KPNIH27 plasmid pKEC-dc3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

305. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP028996 (Klebsiella pneumoniae strain AR_0079 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

306. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP006029 (Escherichia coli O145:H28 str. RM13514 plasmid pRM13514, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

307. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP040039 (Klebsiella pneumoniae strain KPC160125 plasmid pIncC-L125) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

308. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP040034 (Klebsiella pneumoniae strain KPC160117 plasmid pIncC-L117, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

309. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP038464 (Aeromonas hydrophila strain WCX23 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

310. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP027043 (Klebsiella pneumoniae strain 1_GR_13 plasmid IncAC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

311. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP007137 (Escherichia coli O145:H28 str. RM12581 plasmid pRM12581, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

312. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP047350 (Proteus cibarius strain ZN2 plasmid pZN2-tetX-171kb, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

313. spacer 7.1|4412570|28|CP026982|CRT matches to NC_009140 (Salmonella enterica subsp. enterica serovar Newport str. SL254 plasmid pSN254, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

314. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP038466 (Aeromonas hydrophila strain 23-C-23 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

315. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_AP019688 (Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

316. spacer 7.1|4412570|28|CP026982|CRT matches to NC_009139 (Yersinia ruckeri YR71 plasmid pYR1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

317. spacer 7.1|4412570|28|CP026982|CRT matches to NC_021667 (Klebsiella pneumoniae plasmid IncA/C-LS6, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

318. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP003998 (Klebsiella pneumoniae subsp. pneumoniae Kp13 plasmid pKP13e, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

319. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP047345 (Proteus vulgaris strain ZN3 plasmid pZN3-tetX-171kb, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

320. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP047353 (Proteus mirabilis strain ZA25 plasmid pZA25-tetX-168kb, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

321. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026405 (Escherichia coli strain ECONIH4 plasmid pECO-c85f, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

322. spacer 7.1|4412570|28|CP026982|CRT matches to NC_017645 (Escherichia coli UMNK88 plasmid pUMNK88, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

323. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009567 (Salmonella enterica subsp. enterica serovar Newport str. CVM 22462 plasmid pCFSAN000934_02, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

324. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP007636 (Vibrio cholerae strain 2012EL-2176 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

325. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032450 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69838 plasmid pSDU1-USMARC-69838, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

326. spacer 7.1|4412570|28|CP026982|CRT matches to NC_012690 (Escherichia coli plasmid peH4H, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

327. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032238 (Escherichia coli strain ECCWS199 plasmid pTB221, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

328. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024557 (Klebsiella pneumoniae strain INF164 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

329. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041172 (Salmonella enterica subsp. enterica serovar Thompson strain SH11G0791 plasmid pSH11G0791, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

330. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024529 (Klebsiella pneumoniae strain INF157 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

331. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP011429 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU39 isolate YUHS 05-78 plasmid pYU39_IncA/C, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

332. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018457 (Shewanella algae strain CCU101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

333. spacer 7.1|4412570|28|CP026982|CRT matches to MK638972 (Escherichia coli J53 plasmid pMG252, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

334. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP016013 (Salmonella enterica subsp. enterica serovar Newport strain CFSAN003890 plasmid pCFSAN003890, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

335. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032491 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL26 plasmid pSL26_IncA/C2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

336. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032496 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO21 plasmid pSO21_IncA/C2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

337. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024522 (Klebsiella pneumoniae strain INF158 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

338. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP011540 (Klebsiella aerogenes strain G7 plasmid pGPN1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

339. spacer 7.1|4412570|28|CP026982|CRT matches to NC_019065 (Escherichia coli plasmid pPG010208, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

340. spacer 7.1|4412570|28|CP026982|CRT matches to CP028804 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pCMY2_085072, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

341. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP017084 (Proteus mirabilis strain T21 plasmid pT212, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

342. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP040029 (Klebsiella pneumoniae strain KPC160121 plasmid pIncC-L121, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

343. spacer 7.1|4412570|28|CP026982|CRT matches to KY014464 (Vibrio parahaemolyticus plasmid pVPS129, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

344. spacer 7.1|4412570|28|CP026982|CRT matches to KY014465 (Vibrio parahaemolyticus plasmid pVPS114, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

345. spacer 7.1|4412570|28|CP026982|CRT matches to KY014466 (Vibrio vulnificus plasmid pVVS1-per1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

346. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP031122 (Providencia sp. WCHPHu000369 strain WCHPr000369 plasmid pIMP69_000369, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

347. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP019001 (Escherichia coli strain Ecol_AZ155 plasmid pECAZ155_KPC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

348. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP023724 (Klebsiella pneumoniae strain TVGHCRE225 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

349. spacer 7.1|4412570|28|CP026982|CRT matches to NC_016976 (Klebsiella pneumoniae plasmid pR55, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

350. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP044075 (Providencia stuartii strain FDAARGOS_645 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

351. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026225 (Aeromonas sp. ASNIH3 plasmid pKPC-8e09, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

352. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025275 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1923 plasmid pSNE2-1923) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

353. spacer 7.1|4412570|28|CP026982|CRT matches to LC536681 (Klebsiella pneumoniae MyNCGM076 plasmid pMyNCGM076, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

354. spacer 7.1|4412570|28|CP026982|CRT matches to LC536682 (Klebsiella pneumoniae MyNCGM079 plasmid pMyNCGM079, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

355. spacer 7.1|4412570|28|CP026982|CRT matches to KM506769 (Uncultured bacterium plasmid pKAZ1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

356. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045016 (Klebsiella pneumoniae subsp. pneumoniae strain BK13048 plasmid pBK13048-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

357. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP021853 (Proteus mirabilis strain AR_0156 plasmid unitig_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

358. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP017055 (Providencia stuartii strain BE2467 plasmid pPS1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

359. spacer 7.1|4412570|28|CP026982|CRT matches to CP028419 (Aeromonas hydrophila strain WCX23 plasmid pWCX23_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

360. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024550 (Klebsiella pneumoniae strain INF163 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

361. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018318 (Klebsiella pneumoniae strain Kp_Goe_822579 plasmid pKp_Goe_579-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

362. spacer 7.1|4412570|28|CP026982|CRT matches to MN823987 (Escherichia coli strain 2016061604 plasmid p6061604-KPC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

363. spacer 7.1|4412570|28|CP026982|CRT matches to KR827391 (Uncultured bacterium plasmid pKAZ2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

364. spacer 7.1|4412570|28|CP026982|CRT matches to KR827392 (Uncultured bacterium plasmid pKAZ3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

365. spacer 7.1|4412570|28|CP026982|CRT matches to KR827394 (Uncultured bacterium plasmid pKAZ5, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

366. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP007558 (Citrobacter freundii CFNIH1 plasmid pKEC-a3c, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

367. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025236 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1926 plasmid pSNE2-1926, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

368. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_AP018672 (Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

369. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009570 (Salmonella enterica subsp. enterica serovar Newport str. CVM N1543 isolate CFSAN000926 plasmid pCVMN1543, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

370. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009564 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21550 plasmid pCVM21550, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

371. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009563 (Salmonella enterica subsp. enterica serovar Newport str. CVM 21538 plasmid pCVM21538, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

372. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_AP019818 (Enterobacter hormaechei subsp. hoffmannii strain OIPH-N069 plasmid pN069_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

373. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP041209 (Salmonella enterica subsp. enterica serovar Newport strain SAP18-8729 plasmid pCFSAN074384_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

374. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP014295 (Klebsiella pneumoniae strain KP38731 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

375. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP031106 (Escherichia coli strain AMSCJX02 plasmid pAMSC1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

376. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018689 (Klebsiella pneumoniae strain Kp_Goe_149473 plasmid pKp_Goe_473-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

377. spacer 7.1|4412570|28|CP026982|CRT matches to NC_019107 (Salmonella enterica subsp. enterica serovar Dublin plasmid pSD_174, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

378. spacer 7.1|4412570|28|CP026982|CRT matches to NC_019116 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH163_135, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

379. spacer 7.1|4412570|28|CP026982|CRT matches to NC_019118 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH696_135, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

380. spacer 7.1|4412570|28|CP026982|CRT matches to NC_019121 (Salmonella enterica subsp. enterica serovar Heidelberg plasmid pSH111_166, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

381. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP019053 (Escherichia coli strain CRE1540 plasmid p1540-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

382. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP029743 (Escherichia coli strain AR_0085 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

383. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP026233 (Citrobacter freundii complex sp. CFNIH4 plasmid pCFR-0b27, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

384. spacer 7.1|4412570|28|CP026982|CRT matches to NC_012692 (Escherichia coli plasmid pAR060302, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

385. spacer 7.1|4412570|28|CP026982|CRT matches to NC_012693 (Salmonella enterica plasmid pAM04528, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

386. spacer 7.1|4412570|28|CP026982|CRT matches to NC_016839 (Klebsiella pneumoniae subsp. pneumoniae HS11286 plasmid pKPHS3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

387. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024564 (Klebsiella pneumoniae strain INF278 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

388. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP046773 (Vibrio alginolyticus strain 2014V-1011 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

389. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP014775 (Aeromonas veronii strain AVNIH1 plasmid pASP-a58, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

390. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025245 (Salmonella enterica subsp. enterica serovar Newport str. CDC 2012K-0663 isolate USDA-ARS-USMARC-1936 plasmid pSNE2-2012K-0663, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

391. spacer 7.1|4412570|28|CP026982|CRT matches to NC_019375 (Providencia stuartii plasmid pTC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

392. spacer 7.1|4412570|28|CP026982|CRT matches to NC_022377 (Escherichia coli strain SCEC2 plasmid pSCEC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

393. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP021695 (Proteus mirabilis strain AR_0155 plasmid tig00000123, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

394. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032395 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 22453 plasmid p22453_1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

395. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP050732 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST101 plasmid pST101-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

396. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025144 (Klebsiella pneumoniae strain NR5632 plasmid NR5632_p1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

397. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP025147 (Klebsiella pneumoniae strain KP1766 plasmid KP1766_p1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

398. spacer 7.1|4412570|28|CP026982|CRT matches to LC225353 (Photobacterium damselae subsp. piscicida plasmid pP0855 DNA, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

399. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP050727 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST113 plasmid pST-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

400. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP050740 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

401. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP015394 (Klebsiella pneumoniae strain CR14 plasmid pCR14_2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

402. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018698 (Klebsiella pneumoniae strain Kp_Goe_149832 plasmid pKp_Goe_832-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

403. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018220 (Salmonella enterica subsp. enterica strain LSP 389/97 plasmid pUO-STmRV1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

404. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP027695 (Klebsiella pneumoniae strain KP30835 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

405. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP045953 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00008979 plasmid pAUSMDU00008979_01, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

406. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT882698 (Klebsiella pneumoniae strain Klebsiella pneumoniae KLPN57 isolate KLPN57 plasmid I, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

407. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT882699 (Enterobacter cloacae isolate Enterobacter cloacae ENCL58 plasmid I, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

408. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985220 (Escherichia coli strain 83 plasmid RCS1TR83_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

409. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985225 (Escherichia coli strain 89 plasmid RCS2TR89_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

410. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985258 (Escherichia coli strain 726 plasmid RCS54TR726_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

411. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985222 (Escherichia coli strain 548 plasmid RCS24TR548_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

412. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985228 (Escherichia coli strain 552 plasmid RCS28TR552_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

413. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985218 (Escherichia coli strain 541 plasmid RCS18TR541_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

414. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985260 (Escherichia coli strain 724 plasmid RCS53TR724_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

415. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985253 (Escherichia coli strain 660 plasmid RCS48TR660_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

416. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985250 (Escherichia coli strain 170 plasmid RCS38_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

417. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985224 (Escherichia coli strain 513 plasmid RCS30_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

418. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985243 (Escherichia coli strain 722 plasmid RCS41_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

419. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_LT985244 (Escherichia coli strain 167 plasmid RCS39_p, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

420. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018956 (Escherichia coli strain Ecol_316 plasmid pEC316_KPC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

421. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP018710 (Klebsiella pneumoniae strain Kp_Goe_827026 plasmid pKp_Goe_026-2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

422. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK733575 (Escherichia coli strain J53 plasmid pMG252A, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

423. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK388209 (Escherichia coli strain Ec20-Lar plasmid pC-Ec20-KPC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

424. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK439959 (Escherichia coli strain Ec-2Lar plasmid pC-Ec2-KPC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

425. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MN101850 (Escherichia coli strain 13ZX28 plasmid p13ZX28-272, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

426. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MN101853 (Escherichia coli strain 13ZX36 plasmid p13ZX36-200, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

427. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK770642 (Klebsiella pneumoniae strain T38 plasmid pT38_MCR3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

428. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MN148427 (Proteus vulgaris strain PV835 plasmid pPV835TEM24, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

429. spacer 7.1|4412570|28|CP026982|CRT matches to NC_022522 (Salmonella enterica subsp. enterica serovar Kentucky strain 1643/10 plasmid p1643_10, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

430. spacer 7.1|4412570|28|CP026982|CRT matches to MN657252 (Enterobacteriaceae bacterium strain 21-16 plasmid pPS-T1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

431. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032380 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69807 plasmid pSDU1-USMARC-69807, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

432. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP032448 (Salmonella enterica subsp. enterica serovar Dublin strain USMARC-69840 plasmid pSDU2-USMARC-69840, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

433. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH105050 (Salmonella enterica subsp. enterica serovar Lomita strain SL131 plasmid pSL131_IncA/C-IncX3, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

434. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH917285 (Klebsiella pneumoniae strain 427113 plasmid p427113-Ct1/2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

435. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH909327 (Klebsiella pneumoniae strain 526316 plasmid p526316-KPC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

436. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH917284 (Klebsiella pneumoniae strain 397108 plasmid p397108-Ct2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

437. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH760469 (Salmonella enterica strain 2016K-0796 plasmid p2016K-0796, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

438. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK205418 (Salmonella enterica subsp. enterica serovar Dublin strain 14-1360 plasmid p14-1360-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

439. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK205416 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01070 plasmid pN13-01070-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

440. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK205417 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01141 plasmid pN13-01141, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

441. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH061195 (Klebsiella pneumoniae strain AHM7C8I plasmid pHNAH8I-NDM, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

442. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

443. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH011352 (Klebsiella pneumoniae strain 185 plasmid pNDM-185, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

444. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH476540 (Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

445. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP009410 (Salmonella enterica strain CFSAN007405 isolate 30034 plasmid pCFSAN007405_01, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

446. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MG764534 (Klebsiella aerogenes strain EA409 plasmid pEA409TEM24, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

447. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH001166 (Escherichia coli strain TAEC1 plasmid pNDM-TAEC1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

448. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF150121 (Klebsiella pneumoniae strain A64477 plasmid pKP64477c, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

449. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF150123 (Klebsiella pneumoniae strain A64216 plasmid pKP64216b, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

450. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF344573 (Klebsiella pneumoniae strain N201205880 plasmid p205880-Ct1/2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

451. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF344572 (Enterobacter hormaechei strain 24845 plasmid p24845-Ct2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

452. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF344574 (Enterobacter hormaechei strain T5282 plasmid pT5282-Ct2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

453. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MG450360 (Escherichia coli strain AMA566 plasmid pAMA566, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

454. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MG252895 (Escherichia coli strain Esco-36073cz plasmid pEsco-36073cz, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

455. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH113855 (Vibrio alginolyticus strain Vb1796 plasmid pVb1796, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

456. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH475146 (Citrobacter freundii strain 164 plasmid pCf164_LMB-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

457. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH763829 (Citrobacter freundii strain JY-17 plasmid pCFJY-17, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

458. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH892479 (Citrobacter freundii strain 2262 plasmid pNDM-2262, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

459. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH844629 (Escherichia coli strain 2248 plasmid pNDM-2248, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

460. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP030132 (Klebsiella pneumoniae strain 160111 plasmid pIncAC2_L111, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

461. spacer 7.1|4412570|28|CP026982|CRT matches to MT219816 (Escherichia coli strain RF173-1 plasmid pRF173-1_87k_tetX, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

462. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887591 (Escherichia coli strain Ec19 plasmid pEc19, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

463. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887596 (Escherichia coli strain Ec158 plasmid pEc158, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

464. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887590 (Escherichia coli strain Ec9 plasmid pEc9, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

465. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KY887595 (Escherichia coli strain Ec78 plasmid pEc78, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

466. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF582638 (Klebsiella pneumoniae strain KKp4 plasmid pKKp4-VIM, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

467. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF072965 (Citrobacter freundii strain P10159 plasmid pP10159-5, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

468. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MG764552 (Klebsiella pneumoniae strain A1763 plasmid pA1763-Ct2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

469. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF150118 (Proteus mirabilis strain A64421 plasmid pPM64421a, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

470. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MF497432 (Vibrio alginolyticus strain Vb0506 plasmid pVb0506, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

471. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP040068 (Escherichia coli strain A1_181 plasmid p_unnamed1_KPC2, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

472. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP044189 (Salmonella enterica subsp. enterica strain AR-0401 plasmid pAR-0401-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

473. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP028814 (Edwardsiella ictaluri strain MS-17-156 plasmid pEI-MS-17-156-1, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

474. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP048384 (Citrobacter freundii strain 62 plasmid p6_B, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

475. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP053192 (Enterobacter hormaechei strain EGYMCRVIM plasmid pMS-37b, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

476. spacer 7.1|4412570|28|CP026982|CRT matches to MT151380 (Vibrio cholerae strain YA00120881 plasmid pYA00120881, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

477. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP054305 (Klebsiella pneumoniae strain MS14393 plasmid pMS14393B, complete sequence) position: , mismatch: 6, identity: 0.786

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgagggggaggg	Protospacer
******** ********.***** * ..

478. spacer 2.4|883938|32|CP026982|CRISPRCasFinder,CRT matches to LR535912 (XXX) position: , mismatch: 7, identity: 0.781

tgattg-cccaataccaaacgctggaatttaac	CRISPR spacer
-aattgccccaacagcaaacgctggaatttggt	Protospacer
 .**** *****.* ***************...

479. spacer 2.10|884299|32|CP026982|CRISPRCasFinder,CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.781

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcgtg	Protospacer
 * ****************.* **** *.*.*

480. spacer 2.13|884480|32|CP026982|CRISPRCasFinder,CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.781

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
acggaggcgaccgttacagcgatcaggatgga	Protospacer
************** *******.**  *.  *

481. spacer 2.16|884661|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010326 (Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence) position: , mismatch: 7, identity: 0.781

tttatg-gatgcgcgggcgttagattttgctat	CRISPR spacer
-tgatgcgatgcgcgcgcgtcagattttgcgta	Protospacer
 * *** ******** ****.*********

482. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to MT653146 (Salmonella phage 8sent1748, complete genome) position: , mismatch: 7, identity: 0.781

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttgcgcagcgcataatcaagcacgttgaaagt	Protospacer
 ..***** *****.************** *

483. spacer 2.22|885023|32|CP026982|CRISPRCasFinder,CRT matches to MT653143 (Salmonella phage 3sent1, complete genome) position: , mismatch: 7, identity: 0.781

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttgcgcagcgcataatcaagcacgttgaaagt	Protospacer
 ..***** *****.************** *

484. spacer 2.28|883941|32|CP026982|PILER-CR matches to LR535912 (XXX) position: , mismatch: 7, identity: 0.781

tgattg-cccaataccaaacgctggaatttaac	CRISPR spacer
-aattgccccaacagcaaacgctggaatttggt	Protospacer
 .**** *****.* ***************...

485. spacer 2.34|884302|32|CP026982|PILER-CR matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 7, identity: 0.781

atagcgcaccataacattgttagcgcttacat-	CRISPR spacer
tttgcgcaccataacattgcttgcgc-tgcgtg	Protospacer
 * ****************.* **** *.*.*

486. spacer 2.37|884483|32|CP026982|PILER-CR matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.781

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
acggaggcgaccgttacagcgatcaggatgga	Protospacer
************** *******.**  *.  *

487. spacer 2.40|884664|32|CP026982|PILER-CR matches to NZ_CP010326 (Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence) position: , mismatch: 7, identity: 0.781

tttatg-gatgcgcgggcgttagattttgctat	CRISPR spacer
-tgatgcgatgcgcgcgcgtcagattttgcgta	Protospacer
 * *** ******** ****.*********

488. spacer 2.46|885026|32|CP026982|PILER-CR matches to MT653146 (Salmonella phage 8sent1748, complete genome) position: , mismatch: 7, identity: 0.781

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttgcgcagcgcataatcaagcacgttgaaagt	Protospacer
 ..***** *****.************** *

489. spacer 2.46|885026|32|CP026982|PILER-CR matches to MT653143 (Salmonella phage 3sent1, complete genome) position: , mismatch: 7, identity: 0.781

acacgcagggcatagtcaagcacgttgaatga	CRISPR spacer
ttgcgcagcgcataatcaagcacgttgaaagt	Protospacer
 ..***** *****.************** *

490. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KY494864 (Pseudomonas aeruginosa strain FFUP_PS_37 plasmid pJB37, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

491. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017620 (Salmonella enterica subsp. enterica serovar Typhimurium strain 22792 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

492. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KT935446 (Klebsiella pneumoniae strain Kp2964 plasmid 2964TF, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

493. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

494. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046282 (Salmonella enterica strain FDAARGOS_687 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

495. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017618 (Salmonella enterica subsp. enterica serovar Typhimurium strain 22495 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

496. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP035302 (Salmonella enterica subsp. enterica strain ST1539 plasmid pST1539, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

497. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022965 (Salmonella enterica subsp. enterica serovar Pullorum strain QJ-2D-Sal plasmid pQJDsal2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

498. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040569 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-8290 plasmid pCFSAN059542, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

499. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_007208 (Salmonella enterica OU7025 plasmid pOU1113, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

500. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014980 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC H2662 plasmid pSTY1-H2662, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

501. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010380 (Enterobacter hormaechei subsp. hormaechei strain 34983 plasmid p34983-328.905kb, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

502. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_HG970001 (Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 plasmid pSG, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccgat	Protospacer
*********.***************. *   .

503. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014970 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1808 isolate ST1126-1 plasmid pSTY1-1808, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

504. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KP899803 (Salmonella enterica strain 8025 plasmid p8025, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

505. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014968 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2011K-1702 plasmid pSTY1-2011K-1702, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

506. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP037873 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS014854 plasmid pPNCS014854_S1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

507. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP037876 (Salmonella enterica subsp. enterica serovar 4,[5],12:i:- strain PNCS015054 plasmid pPNCS015054_S3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

508. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP009869 (Pantoea sp. PSNIH2 plasmid pPSP-75c, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

509. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP020923 (Salmonella enterica subsp. enterica strain 16A242 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

510. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040669 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20082869 plasmid pSA20082869.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

511. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014973 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1898 isolate ST073 plasmid pSTY2-1898, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

512. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP038435 (Salmonella enterica subsp. enterica serovar Typhimurium strain E40V plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

513. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014976 (Salmonella enterica subsp. enterica serovar Typhimurium str. CDC 2009K-1640 plasmid pSTY1-2009K-1640, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

514. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_017054 (Salmonella enterica subsp. enterica serovar Typhimurium str. 798 plasmid p798_93, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

515. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042479 (Citrobacter freundii strain C50 plasmid pC50_001, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

516. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP047324 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM13672 plasmid pRM13672, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

517. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014537 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO3 isolate SOHS 02-68 plasmid pSO3_STV, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

518. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_022570 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT104 unnamed plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

519. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039560 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014846 plasmid p08-4425.2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

520. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039577 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014856 plasmid p10-3857.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

521. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039586 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014859 plasmid p11-0225.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

522. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN999012 (Salmonella enterica subsp. enterica serovar Typhimurium str. DT2 plasmid pSLT, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

523. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034480 (Salmonella enterica subsp. enterica serovar Typhimurium strain 14028 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

524. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP038433 (Salmonella enterica subsp. enterica serovar Typhimurium strain E40 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

525. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP016390 (Salmonella enterica subsp. enterica serovar Typhimurium strain 13-931 plasmid pSLT931, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

526. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP025556 (Salmonella enterica subsp. enterica serovar Typhimurium strain PIR00538 plasmid pPIR00538, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

527. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP050746 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST53 plasmid pST53-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

528. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP049311 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N53023 plasmid pN53023, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

529. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP053871 (Salmonella enterica subsp. enterica serovar Typhimurium strain SS2017 plasmid pSS2017-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

530. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP053866 (Salmonella enterica subsp. enterica serovar Typhimurium strain SL7207 plasmid pSL7202-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

531. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041006 (Salmonella enterica strain FDAARGOS_768 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

532. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP026208 (Escherichia coli strain ECONIH5 plasmid pECO-109b, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

533. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039855 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014864 plasmid p11-0972.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

534. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010360 (Enterobacter roggenkampii strain 35734 plasmid p35734-141.404kb, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

535. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034231 (Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 plasmid pATCC14028, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

536. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029594 (Salmonella enterica strain DA34827 plasmid pDA34827-94, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

537. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP049307 (Salmonella enterica subsp. enterica serovar Heidelberg strain CVM N58631 plasmid p58631, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

538. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP051287 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Gull_ST-29 plasmid pST29-94038, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

539. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014476 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

540. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017729 (Salmonella enterica subsp. enterica serovar Typhimurium str. SARA13 plasmid pSARA13, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

541. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP008745 (Salmonella enterica subsp. enterica serovar Typhimurium strain VNP20009 plasmid pSLT_VNP20009, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

542. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP012168 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-239.973kb, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

543. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP007582 (Salmonella enterica subsp. enterica serovar Typhimurium strain 138736 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

544. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP032179 (Citrobacter freundii strain AR_0116 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

545. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039566 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014849 plasmid p08-7727.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

546. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029142 (Klebsiella michiganensis strain AR375 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

547. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_013437 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSLT-BT, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

548. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019001 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

549. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017294 (Pseudomonas aeruginosa strain PA83 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

550. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034720 (Salmonella enterica subsp. enterica serovar Typhimurium strain RSE04 plasmid pRSE04, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

551. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP031575 (Enterobacter hormaechei strain A1 plasmid pIncHI2-1502264, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

552. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP051281 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Junco_ST-35 plasmid pST35-99574.1A, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

553. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_AP014566 (Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

554. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029596 (Salmonella enterica strain DA34833 plasmid pDA34833-94, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

555. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP051277 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Sparrow_ST-87 plasmid pST87-92921, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

556. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LS997974 (Salmonella enterica subsp. enterica serovar Typhimurium strain D23580 isolate D23580_liv plasmid D23580_liv_pSLT-BT) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

557. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to LN794247 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSBLT, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

558. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041974 (Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

559. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041974 (Salmonella enterica subsp. enterica serovar Typhimurium strain NCCP 16207 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

560. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039580 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014857 plasmid p10-3881.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

561. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039583 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014858 plasmid p10-8609.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

562. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP031135 (Escherichia coli strain CFSAN064035 plasmid pGMI17-003_1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

563. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011635 (Klebsiella oxytoca strain CAV1374 plasmid pKPC_CAV1374, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

564. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044969 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007098 plasmid pPNCS007087.2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

565. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044959 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS007087 plasmid pPNCS007087.2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

566. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039596 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014865 plasmid p12-4331.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

567. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039592 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014862 plasmid p11-0500.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

568. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039568 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain PNCS014850 plasmid p08-8136.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

569. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP014577 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM9437 plasmid pRM9437, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

570. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP013721 (Salmonella enterica subsp. enterica serovar Typhimurium strain RM10607 plasmid pRM10607, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

571. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_016864 (Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1 plasmid pSTUK-100, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

572. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP020113 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

573. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014962 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1899 plasmid pSTY1-1899, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

574. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP027144 (Enterobacter hormaechei subsp. hoffmannii strain AR_0365 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

575. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_016861 (Salmonella enterica subsp. enterica serovar Typhimurium str. T000240 plasmid pSTMDT12_L, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

576. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP021464 (Salmonella enterica subsp. enterica serovar Typhimurium strain UGA14 plasmid pUGA14_2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

577. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029838 (Salmonella enterica subsp. enterica serovar Typhimurium strain 10ST07093 plasmid p10ST07093B, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

578. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014050 (Salmonella enterica strain FDAARGOS_94 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

579. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019108 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

580. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019109 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

581. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019112 (Salmonella enterica subsp. enterica serovar Pullorum plasmid pSPUV, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

582. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP038848 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014851 plasmid p09-0499.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

583. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP050736 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST90 plasmid pST90-2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

584. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040565 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP17-7699 plasmid pCFSAN059544, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

585. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_003277 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 plasmid pSLT, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

586. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022071 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_321 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

587. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP012348 (Salmonella enterica subsp. enterica serovar Pullorum str. ATCC 9120 plasmid pCFSAN000725_01, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

588. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP051268 (Salmonella enterica subsp. enterica serovar Typhimurium strain OLF-FSR1_WB_Hawk_ST-33 plasmid pST33-93798, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

589. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029841 (Salmonella enterica subsp. enterica serovar Typhimurium strain 01ST04081 plasmid p01ST04081A, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

590. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_016855 (Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

591. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KY320277 (Leclercia adecarboxylata strain Lec-476 plasmid pLec-476, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

592. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LT855377 (Salmonella enterica subsp. enterica serovar Typhimurium isolate STMU2UK plasmid 2) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

593. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP027413 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_320 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

594. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP027409 (Salmonella enterica subsp. enterica serovar Typhimurium strain FDAARGOS_317 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

595. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014359 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU15 plasmid pYU15_94, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

596. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP015158 (Salmonella enterica subsp. enterica serovar Typhimurium strain NC983 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

597. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP018658 (Salmonella enterica subsp. enterica serovar Enteritidis strain 92-0392 plasmid pSE92-0392, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

598. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028200 (Salmonella enterica subsp. enterica serovar Typhimurium strain CFSAN018746 plasmid pGMI14-001, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

599. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_021155 (Salmonella enterica subsp. enterica serovar Typhimurium str. U288 plasmid pSTU288-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

600. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014357 (Salmonella enterica subsp. enterica serovar Typhimurium strain SO2 isolate SOHS 02-20 plasmid pSO2_STV, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

601. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028319 (Salmonella enterica subsp. enterica serovar Typhimurium var. 5- strain CFSAN067216 plasmid pSC-09-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

602. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044111 (Klebsiella michiganensis strain FDAARGOS_647 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaagctcgatgcgcagcacgacagcgcgacg	Protospacer
   .***************.********* *

603. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP050741 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST56 plasmid pST56-2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

604. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040901 (Salmonella enterica subsp. enterica serovar Typhimurium strain SAP18-6199 plasmid pCFSAN074387, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

605. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040322 (Salmonella enterica subsp. enterica serovar Typhimurium strain PNCS014879 plasmid p16-6397.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

606. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045950 (Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00010529 plasmid pAUSMDU00010529_01, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

607. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP015599 (Salmonella enterica strain FORC_030 plasmid pFORC_030, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

608. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP026701 (Salmonella enterica subsp. enterica serovar Typhimurium strain AR_0031 plasmid unitig_1_pilon, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

609. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KX777254 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSTV-Mu1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcatgacagtcccggt	Protospacer
*********.***************. *   .

610. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP025885 (Escherichia coli strain 503440 plasmid p503440_68, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcggagcatgacagccccggt	Protospacer
*********.**** *********** *   .

611. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KP987215 (Citrobacter freundii strain 112298 plasmid p112298-KPC, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

612. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028272 (Mixta intestinalis strain SRCM103226 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcagtgcgcagcatgacagccccggt	Protospacer
********..**************** *   .

613. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028272 (Mixta intestinalis strain SRCM103226 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcagtgcgcagcatgacagccccggt	Protospacer
********..**************** *   .

614. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028272 (Mixta intestinalis strain SRCM103226 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcagtgcgcagcatgacagccccggt	Protospacer
********..**************** *   .

615. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN890519 (Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462388 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

616. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN890519 (Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462388 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

617. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045758 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

618. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045758 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

619. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP037736 (Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

620. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP037736 (Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

621. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP037736 (Citrobacter freundii strain CAV1857 plasmid pCAV1857-105, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

622. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045760 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000661 plasmid pCFSAN000661, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

623. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045760 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000661 plasmid pCFSAN000661, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

624. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019187 (Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

625. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019187 (Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

626. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019187 (Salmonella enterica subsp. enterica serovar Pomona str. ATCC 10729 plasmid pATCC10729_01, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

627. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN890521 (Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462413 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

628. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN890521 (Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5462413 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

629. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040702 (Salmonella enterica strain 3 isolate CFSAN047349 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

630. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP040702 (Salmonella enterica strain 3 isolate CFSAN047349 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

631. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019175 (Salmonella enterica subsp. enterica serovar Give strain CFSAN024229 plasmid pCFSAN024229, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

632. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029733 (Citrobacter sp. CRE-46 strain AR_0157 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

633. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP035635 (Enterobacter cloacae strain EN3600 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

634. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LS992176 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

635. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LS992176 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

636. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LS992176 (Citrobacter freundii isolate Citrobacter freundii str. E2614 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

637. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP045557 (Citrobacter sp. S39 plasmid pS39-2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

638. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP048110 (Klebsiella michiganensis strain BD177 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcagtgcgcagcatgacagccgacag	Protospacer
********..****************  .*

639. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP048110 (Klebsiella michiganensis strain BD177 plasmid unnamed2) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcagtgcgcagcatgacagccgacag	Protospacer
********..****************  .*

640. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045204 (Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcggagcatgacagccccgat	Protospacer
*********.**** *********** *   .

641. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045204 (Citrobacter sp. NMI7904_11 plasmid pCTEL-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

642. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP053577 (Salmonella enterica strain 2012K-0845 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

643. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP053577 (Salmonella enterica strain 2012K-0845 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

644. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045755 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid p1CFSAN000752, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

645. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045755 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000752 plasmid p1CFSAN000752, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

646. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030079 (Enterobacter hormaechei strain 20710 plasmid p5-20710, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

647. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030198 (Salmonella enterica strain SA20051401 plasmid pSA20051401.2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

648. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014723 (Paraburkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaggctcgatgcacagcacgacagcgcgtct	Protospacer
   **********.*****.*********.*.

649. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022118 (Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

650. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039470 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001112 plasmid pCFSAN001112, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

651. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039470 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001112 plasmid pCFSAN001112, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

652. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039485 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000952 plasmid pCFSAN000952, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

653. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039485 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000952 plasmid pCFSAN000952, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

654. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039494 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

655. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039494 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

656. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP038468 (Citrobacter sp. SNU WT2 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

657. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029998 (Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

658. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029998 (Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

659. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP029998 (Salmonella enterica subsp. salamae strain SA20053897 plasmid pSA20053897.3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

660. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039466 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001118 plasmid pCFSAN001118, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

661. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039466 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001118 plasmid pCFSAN001118, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

662. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039468 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001115 plasmid pCFSAN001115, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

663. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039468 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001115 plasmid pCFSAN001115, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

664. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP024977 (Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

665. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030210 (Salmonella enterica strain SA20044414 plasmid pSA20044414.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

666. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030210 (Salmonella enterica strain SA20044414 plasmid pSA20044414.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

667. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030210 (Salmonella enterica strain SA20044414 plasmid pSA20044414.1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

668. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019125 (Salmonella enterica subsp. salamae plasmid pSGSC3045-121, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

669. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019125 (Salmonella enterica subsp. salamae plasmid pSGSC3045-121, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

670. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

671. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

672. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022156 (Escherichia coli strain ABWA45 plasmid pABWA45_2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

673. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

674. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

675. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046347 (Citrobacter portucalensis strain FDAARGOS_738 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

676. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039464 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001140 plasmid pCFSAN001140, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

677. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039464 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN001140 plasmid pCFSAN001140, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

678. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039472 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000970 plasmid pCFSAN000970, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

679. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039472 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000970 plasmid pCFSAN000970, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

680. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039474 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000968 plasmid pCFSAN000968_1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

681. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039474 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000968 plasmid pCFSAN000968_1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

682. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039492 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000700 plasmid pCFSAN000700, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

683. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039492 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000700 plasmid pCFSAN000700, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

684. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017992 (Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-2c5, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

685. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017992 (Enterobacter cloacae complex sp. ECNIH7 plasmid pENT-2c5, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

686. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022035 (Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

687. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022035 (Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

688. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022035 (Salmonella enterica subsp. enterica serovar Onderstepoort str. SA20060086 plasmid punamed2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

689. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022661 (Salmonella enterica subsp. enterica strain RM11065 plasmid pRM11065-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

690. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cgaggctcaatgcgcagcacgacagcgcgacg	Protospacer
   *****.**********.********* *

691. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN890523 (Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5712384 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

692. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LN890523 (Salmonella enterica subsp. enterica serovar Weltevreden strain 2511STDY5712384 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

693. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011595 (Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

694. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011595 (Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

695. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011595 (Klebsiella oxytoca strain CAV1099 plasmid pKPC_CAV1099, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

696. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011654 (Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

697. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011654 (Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

698. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011654 (Citrobacter freundii strain CAV1741 plasmid pCAV1741-101, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

699. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP053407 (Salmonella enterica strain 87-0091 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

700. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP053403 (Salmonella enterica strain 2010K-2057 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcataacagccccggt	Protospacer
*********.**********.***** *   .

701. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP053403 (Salmonella enterica strain 2010K-2057 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

702. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033743 (Citrobacter freundii strain FDAARGOS_549 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

703. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011610 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

704. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011610 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

705. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP011610 (Citrobacter freundii strain CAV1321 plasmid pCAV1321-135, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

706. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039483 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000954 plasmid pCFSAN000954, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

707. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039483 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000954 plasmid pCFSAN000954, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

708. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039479 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000960 plasmid pCFSAN000960, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

709. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039479 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000960 plasmid pCFSAN000960, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

710. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP039501 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid pCFSAN000189, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

711. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP039501 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid pCFSAN000189, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

712. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

713. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034178 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

714. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034178 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

715. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019342 (Salmonella sp. 14 plasmid p14-120, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

716. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019342 (Salmonella sp. 14 plasmid p14-120, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

717. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019342 (Salmonella sp. 14 plasmid p14-120, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

718. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP042439 (Salmonella enterica strain CFSAN079094 plasmid pCFSAN079094, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

719. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP042439 (Salmonella enterica strain CFSAN079094 plasmid pCFSAN079094, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

720. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039481 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000958 plasmid pCFSAN000958, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

721. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039481 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000958 plasmid pCFSAN000958, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

722. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039488 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000753 plasmid pCFSAN000753, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

723. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039488 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000753 plasmid pCFSAN000753, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

724. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044100 (Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

725. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044100 (Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

726. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044100 (Citrobacter werkmanii strain FDAARGOS_616 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

727. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

728. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046281 (Salmonella enterica strain FDAARGOS_688 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

729. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP023469 (Salmonella enterica subsp. enterica strain BAA-1586 plasmid pSalMiami, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

730. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014997 (Salmonella enterica subsp. enterica serovar Weltevreden str. 1655 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

731. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP014997 (Salmonella enterica subsp. enterica serovar Weltevreden str. 1655 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

732. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

733. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045838 (Citrobacter sp. H12-3-2 plasmid pH12-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

734. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggcccggtgcgcagcatgacagccccggt	Protospacer
******.**.**************** *   .

735. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK167988 (Citrobacter freundii strain TS45CTX plasmid pHNTS45-1, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

736. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019182 (Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 plasmid pATCC10720, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

737. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019182 (Salmonella enterica subsp. enterica serovar Inverness str. ATCC 10720 plasmid pATCC10720, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgcagcataacagccccggt	Protospacer
*********.**********.***** *   .

738. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP024166 (Salmonella enterica subsp. enterica serovar Gaminara strain CFSAN070644 plasmid pCFSAN024441_01, complete sequence) position: , mismatch: 7, identity: 0.781

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gctggctcggtgcgaagcatgacagccccggt	Protospacer
*********.**** *********** *   .

739. spacer 3.8|902988|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_019763 (Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.01, complete sequence) position: , mismatch: 7, identity: 0.781

tttttgtcaggactcaaaccggcgtaatttat	CRISPR spacer
tcattgtcagaactcaaacccgcgtaatcaaa	Protospacer
*. *******.********* *******. *

740. spacer 3.8|902988|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_019763 (Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.01, complete sequence) position: , mismatch: 7, identity: 0.781

tttttgtcaggactcaaaccggcgtaatttat	CRISPR spacer
tcattgtcagaactcaaacccgcgtaatcaaa	Protospacer
*. *******.********* *******. *

741. spacer 3.8|902988|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_019730 (Oscillatoria nigro-viridis PCC 7112 plasmid pOSC7112.02, complete sequence) position: , mismatch: 7, identity: 0.781

tttttgtcaggactcaaaccggcgtaatttat	CRISPR spacer
tcattgtcagaactcaaacccgcgtaatcaaa	Protospacer
*. *******.********* *******. *

742. spacer 3.10|903108|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046163 (Vibrio sp. THAF191c plasmid pTHAF191c_b, complete sequence) position: , mismatch: 7, identity: 0.781

atttaagcttcagaatgtgattggcctcaaaa	CRISPR spacer
attttagcttcataatgtgattgcgctaatag	Protospacer
**** ******* **********  ** * *.

743. spacer 3.10|903108|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP046066 (Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence) position: , mismatch: 7, identity: 0.781

atttaagcttcagaatgtgattggcctcaaaa	CRISPR spacer
attttagcttcataatgtgattgcgctaatag	Protospacer
**** ******* **********  ** * *.

744. spacer 3.10|903108|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045356 (Vibrio sp. THAF64 plasmid pTHAF64_a, complete sequence) position: , mismatch: 7, identity: 0.781

atttaagcttcagaatgtgattggcctcaaaa	CRISPR spacer
attttagcttcataatgtgattgcgctaatag	Protospacer
**** ******* **********  ** * *.

745. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MK047717 (Escherichia phage p000v, complete genome) position: , mismatch: 7, identity: 0.781

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
cgtttcaccgtgacggtggatttactgttgat	Protospacer
  * *.************.**********.*.

746. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_KT997783 (Escherichia coli strain Y5 plasmid pECY53, complete sequence) position: , mismatch: 7, identity: 0.75

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggagggg	Protospacer
******** ********.***** . ..

747. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP044142 (Escherichia coli O157 strain AR-0429 plasmid pAR-0429-1, complete sequence) position: , mismatch: 7, identity: 0.75

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggagggg	Protospacer
******** ********.***** . ..

748. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_CP024824 (Escherichia coli strain CREC-591 plasmid pCREC-591_3, complete sequence) position: , mismatch: 7, identity: 0.75

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggagggg	Protospacer
******** ********.***** . ..

749. spacer 7.1|4412570|28|CP026982|CRT matches to NZ_MH476540 (Klebsiella pneumoniae strain KP1276 plasmid pIA/C-KLUC, complete sequence) position: , mismatch: 7, identity: 0.75

ttagaccaacatgcaacaaggggtataa	CRISPR spacer
ttagaccatcatgcaacgaggggagggg	Protospacer
******** ********.***** . ..

750. spacer 8.1|4415196|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041418 (Escherichia coli strain STEC711 plasmid pSTEC711_2, complete sequence) position: , mismatch: 7, identity: 0.781

--tactcaggtagagcttgctgaaagggttggaa	CRISPR spacer
gcgattt--gtagagcttgctgaaaggctgggaa	Protospacer
   *.*.  ****************** * ****

751. spacer 8.7|4415563|32|CP026982|CRISPRCasFinder,CRT matches to HQ316603 (Cyanophage S-SSM6b genomic sequence) position: , mismatch: 7, identity: 0.781

aagtttctttgatctgcaaactcagttgcagc	CRISPR spacer
agattaatttgatcttcaaactcagttccagt	Protospacer
*..**  ******** *********** ***.

752. spacer 8.7|4415563|32|CP026982|CRISPRCasFinder,CRT matches to NC_020875 (Cyanophage S-SSM4 genomic sequence) position: , mismatch: 7, identity: 0.781

aagtttctttgatctgcaaactcagttgcagc	CRISPR spacer
agattaatttgatcttcaaactcagttccagt	Protospacer
*..**  ******** *********** ***.

753. spacer 8.11|4415807|32|CP026982|CRISPRCasFinder,CRT matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

aggtat-ccaccagtggcgaatgatccacgaac	CRISPR spacer
-gttacgacaccagtggcgagtgatacacgaat	Protospacer
 * **.  ************.**** ******.

754. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NZ_CP033220 (Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence) position: , mismatch: 8, identity: 0.75

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
ggacaccagggccgccagggagggcacgccat	Protospacer
  .**  .**** ******** **********

755. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NZ_CP033220 (Parasedimentitalea marina strain W43 plasmid pW43A, complete sequence) position: , mismatch: 8, identity: 0.75

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
ggacaccagggccgccagggagggcacgccat	Protospacer
  .**  .**** ******** **********

756. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NZ_CP011665 (Streptomyces sp. Mg1 plasmid pSMg1-1, complete sequence) position: , mismatch: 8, identity: 0.75

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
gtgcaggggggcggccagggccggcaggtcgg	Protospacer
 .****************** .**** *.*.

757. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 8, identity: 0.75

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
gtgcaggggggcggccagggccggcaggtcgg	Protospacer
 .****************** .**** *.*.

758. spacer 2.6|884058|32|CP026982|CRISPRCasFinder,CRT matches to NC_003374 (Gluconobacter oxydans DSM 3504 plasmid pGO128, complete sequence) position: , mismatch: 8, identity: 0.75

gcaattagcgacccgtaaaacccgccctccac	CRISPR spacer
acaagaggcgacccgtgaaagccgccctccgt	Protospacer
.***  .*********.*** *********..

759. spacer 2.19|884842|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP015734 (Arthrobacter sp. U41 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccctgcacagcttcaatgatgcgtatgaa	CRISPR spacer
aagccctgcacagcttcaaagctgcggaaggc	Protospacer
  ***************** * **** * *.

760. spacer 2.23|885083|32|CP026982|CRISPRCasFinder,CRT matches to MN693266 (Marine virus AFVG_25M408, complete genome) position: , mismatch: 8, identity: 0.75

gctaac-gctaaattgttccaccagctaaacgc	CRISPR spacer
-cagacagcttaattgttccaccatctaaagca	Protospacer
 * .** *** ************* *****

761. spacer 2.30|884061|32|CP026982|PILER-CR matches to NC_003374 (Gluconobacter oxydans DSM 3504 plasmid pGO128, complete sequence) position: , mismatch: 8, identity: 0.75

gcaattagcgacccgtaaaacccgccctccac	CRISPR spacer
acaagaggcgacccgtgaaagccgccctccgt	Protospacer
.***  .*********.*** *********..

762. spacer 2.43|884845|32|CP026982|PILER-CR matches to NZ_CP015734 (Arthrobacter sp. U41 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

ttgccctgcacagcttcaatgatgcgtatgaa	CRISPR spacer
aagccctgcacagcttcaaagctgcggaaggc	Protospacer
  ***************** * **** * *.

763. spacer 2.47|885086|32|CP026982|PILER-CR matches to MN693266 (Marine virus AFVG_25M408, complete genome) position: , mismatch: 8, identity: 0.75

gctaac-gctaaattgttccaccagctaaacgc	CRISPR spacer
-cagacagcttaattgttccaccatctaaagca	Protospacer
 * .** *** ************* *****

764. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034939 (Pectobacterium odoriferum strain JK2.1 plasmid p.Jk2_1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
actggctcagtgcgcagcatgacagccgactg	Protospacer
.*******..****************  .*.

765. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK033501 (Salmonella enterica subsp. enterica serovar Anatum strain R13.0957_pConj83k plasmid pConj83k, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

766. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

767. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

768. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP041027 (Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:- strain SA20143792 plasmid pSA20143792.1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

769. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014476 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT1 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

770. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019001 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pYT2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

771. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_AP014566 (Salmonella enterica subsp. enterica serovar Typhimurium str. L-3553 plasmid pST3553, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

772. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP020113 (Salmonella enterica subsp. enterica serovar Typhimurium str. USDA-ARS-USMARC-1810 plasmid pSTY1-1810, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

773. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019108 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal6919a, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

774. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019109 (Salmonella enterica subsp. enterica serovar Typhimurium plasmid pSal8934b, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

775. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014108 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagcccggtt	Protospacer
. .****************.****** ** ..

776. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014108 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagcccggtt	Protospacer
. .****************.****** ** ..

777. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_014108 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_B, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagcccggtt	Protospacer
. .****************.****** ** ..

778. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030922 (Escherichia coli strain KL53 plasmid pKL53-S, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagcccggtt	Protospacer
. .****************.****** ** ..

779. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to AM261282 (Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

780. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to AM261282 (Uncultured bacterium IncP-1 plasmid pKJK5 complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

781. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_007353 (Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

782. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP053984 (Achromobacter pestifer strain FDAARGOS_790 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

783. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP015373 (Pandoraea pnomenusa strain MCB032 plasmid unnamed 2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

784. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP026268 (Aminobacter sp. MSH1 plasmid pBAM1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

785. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_010935 (Comamonas testosteroni CNB-1 plasmid pCNB, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

786. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JX469834 (Uncultured bacterium plasmid pDS3, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

787. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JX469826 (Uncultured bacterium plasmid pB12, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

788. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JX469827 (Uncultured bacterium plasmid pEMT3, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

789. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JX469828 (Uncultured bacterium plasmid pRSB223, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

790. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JX469829 (Uncultured bacterium plasmid pB1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

791. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JX469831 (Uncultured bacterium plasmid pKSP212, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

792. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028340 (Thauera aromatica K172 plasmid pKJK172, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

793. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JN106171 (Uncultured bacterium plasmid pAKD26, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

794. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JN106172 (Uncultured bacterium plasmid pAKD29, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

795. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JN106169 (Uncultured bacterium plasmid pAKD18, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

796. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_008766 (Acidovorax sp. JS42 plasmid pAOVO02, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

797. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042584 (Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccggttc	Protospacer
. .****************.******  *..*

798. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042584 (Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccggttc	Protospacer
. .****************.******  *..*

799. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_016968 (Comamonas testosteroni plasmid pTB30, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

800. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_016978 (Comamonas testosteroni plasmid pI2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

801. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017760 (Cupriavidus necator strain NH9 plasmid pENH91, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

802. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP053554 (Diaphorobacter sp. JS3050 plasmid pDCNB, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

803. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KF743817 (Proteus mirabilis plasmid R772, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

804. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KF743818 (Bordetella bronchiseptica plasmid R906, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

805. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KC964605 (Uncultured bacterium plasmid pMLUA1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

806. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KC964605 (Uncultured bacterium plasmid pMLUA1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

807. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KC964606 (Uncultured bacterium plasmid pMLUA3, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

808. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KC964606 (Uncultured bacterium plasmid pMLUA3, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

809. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KC964607 (Uncultured bacterium plasmid pMLUA4, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

810. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to KC964607 (Uncultured bacterium plasmid pMLUA4, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

811. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JQ004406 (Uncultured bacterium plasmid pHH128, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

812. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JQ004406 (Uncultured bacterium plasmid pHH128, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

813. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JQ004407 (Uncultured bacterium plasmid pHH3408, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

814. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JQ004408 (Uncultured bacterium plasmid pHH3414, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

815. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JQ004409 (Uncultured bacterium plasmid pKS77, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

816. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to JQ004409 (Uncultured bacterium plasmid pKS77, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

817. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MN366356 (Bacterium plasmid pALTS27, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

818. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MN366356 (Bacterium plasmid pALTS27, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

819. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MN366360 (Bacterium plasmid pALTS32, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

820. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MN366360 (Bacterium plasmid pALTS32, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

821. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MN366361 (Bacterium plasmid pALTS33, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

822. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019263 (Delftia acidovorans plasmid pLME1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

823. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019264 (Delftia acidovorans plasmid pNB8c, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

824. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019283 (Delftia acidovorans plasmid pC1-1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

825. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019369 (Burkholderia cepacia plasmid pYS1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

826. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019318 (Ralstonia pickettii plasmid p712, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

827. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_021077 (Comamonas sp. 7D-2 plasmid pBHB, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

828. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_006830 (Achromobacter xylosoxidans A8 plasmid pA81, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgacatagccggt	Protospacer
 ******************.****  **   .

829. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP050860 (Klebsiella pneumoniae strain SCH6109 plasmid pSCH6109-Vir, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

830. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KX863568 (Citrobacter freundii strain AtetA plasmid pLNU-11, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

831. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KY296096 (Pseudomonas aeruginosa strain 14057 plasmid p14057-tetA, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

832. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KY399978 (Vibrio cholerae O139 strain ICDC-211 plasmid pVC211, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

833. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KY689633 (Escherichia coli strain 100R plasmid p100R, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

834. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KY986974 (Citrobacter freundii strain 112298 plasmid p112298-tetA, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

835. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045446 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 9355 plasmid p280_9355, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

836. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028168 (Escherichia coli strain CFSAN064036 plasmid pGMI17-004_1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

837. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP034786 (Escherichia coli strain ECZP248 plasmid pTB402, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

838. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP009414 (Salmonella enterica strain CFSAN007428 isolate N11150 plasmid pCFSAN007428_01, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

839. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KU852461 (Salmonella enterica subsp. enterica serovar Typhimurium strain ST1004 plasmid pNUC, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

840. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KU321583 (Escherichia coli strain E80 plasmid pE80, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

841. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KX815983 (Salmonella enterica subsp. enterica serovar Dublin strain N13-01125 plasmid pN13-01125, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

842. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KX129782 (Escherichia coli strain S38 plasmid pS38, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

843. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KX029331 (Klebsiella pneumoniae strain K-109-R plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

844. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP015833 (Escherichia coli O157 strain 180-PT54 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

845. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP035548 (Salmonella enterica subsp. enterica serovar Typhimurium strain YU07-18 plasmid pYU07-18_IncA/C2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

846. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP009412 (Salmonella enterica strain CFSAN007426 isolate N19767 plasmid pCFSAN007426_01, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

847. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP009411 (Salmonella enterica strain CFSAN007425 isolate 22697 plasmid pCFSAN007425_01, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

848. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP009413 (Salmonella enterica strain CFSAN007427 isolate N20272 plasmid pCFSAN007427_01, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

849. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP052795 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N19S0125 plasmid pN19S0125, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

850. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KJ909290 (Aeromonas salmonicida subsp. salmonicida strain 2004-05MF26 plasmid pSN254b, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

851. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KR559888 (Klebsiella pneumoniae strain Kpn642 plasmid pKP-Gr642, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

852. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KR559889 (Klebsiella pneumoniae strain Kpn8143 plasmid pKP-Gr8143, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

853. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KR653209 (Escherichia coli strain GDZ13 plasmid pGD0503Z13, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

854. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KR091911 (Salmonella enterica subsp. enterica serovar Corvallis strain RH-1238 plasmid pRH-1238, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

855. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KT990220 (Escherichia coli strain 42-2 plasmid p42-2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

856. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KP056256 (Escherichia coli strain YDC637 plasmid pYDC637, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

857. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to LT221036 (Yersinia pseudotuberculosis strain Yps.F1, plasmid pYps.F1 complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

858. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP028197 (Salmonella enterica subsp. enterica serovar Concord strain CFSAN018747 plasmid pGMI14-002_1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

859. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010164 (Escherichia coli strain H2 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

860. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010232 (Escherichia coli strain S30 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

861. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010233 (Escherichia coli strain S30 plasmid B, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

862. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP032391 (Salmonella enterica subsp. enterica serovar Dublin strain CVM 34981 plasmid p34981_1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

863. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP047882 (Salmonella enterica subsp. enterica serovar Infantis strain 119944 plasmid pESI, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

864. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_AP017613 (Escherichia coli strain 20Ec-P-124 plasmid pMRY16-002_3, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

865. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017987 (Klebsiella pneumoniae strain 825795-1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

866. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_AP023191 (Escherichia coli strain TUM18530 plasmid pMTY18530-1_lncHI2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

867. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_022996 (Escherichia coli plasmid pO26-CRL-125, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

868. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP035011 (Shigella sonnei strain LC1477/18 plasmid pLC1477_18-3, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

869. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP010118 (Escherichia coli strain C2 plasmid A, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

870. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045742 (Escherichia coli strain DH5alpha plasmid pTHNK130-1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

871. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP052804 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S973 plasmid pN17S0973, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

872. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_022992 (Escherichia coli plasmid pO111-CRL-115, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

873. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP043219 (Escherichia coli O80:H26 strain EC-107 plasmid pET6.2-IncFII, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

874. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP038508 (Salmonella enterica subsp. enterica serovar Infantis strain FARPER-219 plasmid p-F219, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

875. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022498 (Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

876. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022498 (Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

877. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022499 (Salmonella enterica subsp. enterica serovar Manhattan strain SA20084699 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

878. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP025240 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1928 plasmid pSNE3-1928, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

879. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP025242 (Salmonella enterica subsp. enterica serovar Newport str. USDA-ARS-USMARC-1929 plasmid pSNE1-1929, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

880. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KT754161 (Shigella dysenteriae 1 strain CAR10 plasmid pCAR10, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

881. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to CP052802 (Salmonella enterica subsp. enterica serovar Infantis strain CVM N17S976 plasmid pN17S0976, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

882. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045449 (Salmonella enterica subsp. enterica serovar Schwarzengrund strain 12888 plasmid p280_12888, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

883. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP024192 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

884. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP019272 (Escherichia coli strain 13P460A plasmid p13P460A-1, complete sequence) position: , mismatch: 8, identity: 0.75

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
gcaggctcgatgcgcagcacgacatagccggt	Protospacer
** ****************.****  **   .

885. spacer 3.6|902868|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_005887 (Burkholderia phage BcepC6B, complete genome) position: , mismatch: 8, identity: 0.75

---gacagggcggtggatcacatcgttccgctctc	CRISPR spacer
ctgcaca---cggtcgatcacatcgtgccgctcga	Protospacer
    ***   **** *********** ******

886. spacer 3.6|902868|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to AY605181 (Burkholderia cepacia complex phage BcepC6B, complete genome) position: , mismatch: 8, identity: 0.75

---gacagggcggtggatcacatcgttccgctctc	CRISPR spacer
ctgcaca---cggtcgatcacatcgtgccgctcga	Protospacer
    ***   **** *********** ******

887. spacer 3.11|903168|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_015178 (Acidiphilium multivorum AIU301 plasmid pACMV1, complete sequence) position: , mismatch: 8, identity: 0.75

ttggtttcatgacgctgtggctttcg----cacctt	CRISPR spacer
caggtgtcatgacgctgtggctgtcgatgaca----	Protospacer
. *** **************** ***    **

888. spacer 3.17|903528|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 8, identity: 0.75

tggtgcgtgtcgcggcggcggtagagggtgat	CRISPR spacer
gcgaacgtgtcgaggcggcgggagagggcggt	Protospacer
  * .******* ******** ******.*.*

889. spacer 3.18|903588|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044989 (Deinococcus sp. AJ005 plasmid p380k, complete sequence) position: , mismatch: 8, identity: 0.75

ttgataaacacgcacacggcgcagtgatgagc	CRISPR spacer
atgtgccccacgcccacggcgcagtgatgcgc	Protospacer
 **     ***** *************** **

890. spacer 3.20|903701|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP046442 (Pseudomonas coronafaciens pv. coronafaciens strain B19001 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gacgagcaacgggcgcactgcccattgcccaa	CRISPR spacer
gacgaccaacgggcgccctgccctatgatcgg	Protospacer
***** ********** ******  ** .*..

891. spacer 3.21|903761|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 8, identity: 0.75

tcagatgccgttgatctggcacatgccgttat	CRISPR spacer
gtggatcgagttgatctggaacatgccgatat	Protospacer
 ..***   ********** ******** ***

892. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 8, identity: 0.75

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
cggctgcgtcgagcgtcacgtgatccagcact	Protospacer
 ... .********** **** **********

893. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 8, identity: 0.75

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
cggctgcgtcgagcgtcacgtgatccagcact	Protospacer
 ... .********** **** **********

894. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.75

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
gctctatgtcgagggtgacgtcgtccagcacc	Protospacer
*  . *.****** ********.********.

895. spacer 3.33|904481|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

gctaaac--tgctgggcgtgctcgatgaagttaa	CRISPR spacer
--caagccttgctgctcgtgctcgatgaagttgt	Protospacer
  .**.*  *****  ****************.

896. spacer 8.23|4415563|33|CP026982|PILER-CR matches to HQ316603 (Cyanophage S-SSM6b genomic sequence) position: , mismatch: 8, identity: 0.758

aagtttctttgatctgcaaactcagttgcagcc	CRISPR spacer
agattaatttgatcttcaaactcagttccagtg	Protospacer
*..**  ******** *********** ***.

897. spacer 8.23|4415563|33|CP026982|PILER-CR matches to NC_020875 (Cyanophage S-SSM4 genomic sequence) position: , mismatch: 8, identity: 0.758

aagtttctttgatctgcaaactcagttgcagcc	CRISPR spacer
agattaatttgatcttcaaactcagttccagtg	Protospacer
*..**  ******** *********** ***.

898. spacer 8.27|4415807|33|CP026982|PILER-CR matches to NC_008573 (Shewanella sp. ANA-3 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

aggtat-ccaccagtggcgaatgatccacgaacc	CRISPR spacer
-gttacgacaccagtggcgagtgatacacgaata	Protospacer
 * **.  ************.**** ******.

899. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 9, identity: 0.719

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
ccgcagggcggcgaccagggatggcggcaggg	Protospacer
******** ****.***********.    .

900. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NZ_KR152226 (Micrococcus sp. MG-2010-D12 plasmid pJD12, complete sequence) position: , mismatch: 9, identity: 0.719

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
gagcaggggggcggcccggcatggccgccccc	Protospacer
  ************** ** *****   ** .

901. spacer 1.1|455960|32|CP026982|CRISPRCasFinder matches to NC_024972 (Micrococcus sp. A1 plasmid pLMA1, complete sequence) position: , mismatch: 9, identity: 0.719

ccgcaggggggcggccagggatggcacgccat	CRISPR spacer
gagcaggggggcggcccggcatggccgccccc	Protospacer
  ************** ** *****   ** .

902. spacer 2.2|883818|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_015583 (Novosphingobium sp. PP1Y plasmid Mpl, complete sequence) position: , mismatch: 9, identity: 0.719

atattgtactgaaacgtgattggctccattct	CRISPR spacer
acgttgtcctgaaacgcgattggctctccgcc	Protospacer
*..**** ********.*********. . *.

903. spacer 2.2|883818|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN693928 (Marine virus AFVG_250M221, complete genome) position: , mismatch: 9, identity: 0.719

atattgtactgaaacgtgattggctccattct	CRISPR spacer
taaaaatactggaacctgattggctccatgtt	Protospacer
  *  .*****.*** ************* .*

904. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046164 (Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

905. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

906. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP048695 (Vibrio coralliilyticus OCN008 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

907. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP046067 (Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

908. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP031474 (Vibrio coralliilyticus strain RE22 plasmid p337, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

909. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP009266 (Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

910. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP009620 (Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

911. spacer 2.7|884118|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP045357 (Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

912. spacer 2.12|884420|32|CP026982|CRISPRCasFinder,CRT matches to HM452126 (Aeromonas phage phiAS5, complete genome) position: , mismatch: 9, identity: 0.719

atcatgcacatcatggatgaattggaattgtg	CRISPR spacer
atcatggacatcatggacgaattaaatgcgct	Protospacer
****** **********.*****..*  .*.

913. spacer 2.13|884480|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP007257 (Rhodococcus erythropolis R138 plasmid pLRE138, complete sequence) position: , mismatch: 9, identity: 0.719

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
accgaggcgaccgtgaccgcgacctggggtga	Protospacer
** ************** ******   . . *

914. spacer 2.13|884480|32|CP026982|CRISPRCasFinder,CRT matches to MH333064 (Klebsiella phage Mineola, complete genome) position: , mismatch: 9, identity: 0.719

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
aactcgacgaccctgacagcgactattacctg	Protospacer
*    *.***** **********.******..

915. spacer 2.13|884480|32|CP026982|CRISPRCasFinder,CRT matches to MK421971 (Klebsiella phage vB_KpnM_GF, partial genome) position: , mismatch: 9, identity: 0.719

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
aactcgacgaccctgacagcgactattacctg	Protospacer
*    *.***** **********.******..

916. spacer 2.14|884540|32|CP026982|CRISPRCasFinder,CRT matches to FJ904927 (Vibrio phage VEJphi, complete genome) position: , mismatch: 9, identity: 0.719

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
tgattcagctagaaaaattgcctcttcatcag	Protospacer
 ...*  ** ************** ******

917. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP046164 (Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

918. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

919. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP048695 (Vibrio coralliilyticus OCN008 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

920. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP046067 (Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

921. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP031474 (Vibrio coralliilyticus strain RE22 plasmid p337, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

922. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP009266 (Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

923. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP009620 (Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

924. spacer 2.31|884121|32|CP026982|PILER-CR matches to NZ_CP045357 (Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence) position: , mismatch: 9, identity: 0.719

tcagaaattccatccacttatcgttaatcagc	CRISPR spacer
catgaaaatacatccacttatcgttaaagcgg	Protospacer
.  **** * *****************   *

925. spacer 2.36|884423|32|CP026982|PILER-CR matches to HM452126 (Aeromonas phage phiAS5, complete genome) position: , mismatch: 9, identity: 0.719

atcatgcacatcatggatgaattggaattgtg	CRISPR spacer
atcatggacatcatggacgaattaaatgcgct	Protospacer
****** **********.*****..*  .*.

926. spacer 2.37|884483|32|CP026982|PILER-CR matches to NZ_CP007257 (Rhodococcus erythropolis R138 plasmid pLRE138, complete sequence) position: , mismatch: 9, identity: 0.719

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
accgaggcgaccgtgaccgcgacctggggtga	Protospacer
** ************** ******   . . *

927. spacer 2.37|884483|32|CP026982|PILER-CR matches to MH333064 (Klebsiella phage Mineola, complete genome) position: , mismatch: 9, identity: 0.719

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
aactcgacgaccctgacagcgactattacctg	Protospacer
*    *.***** **********.******..

928. spacer 2.37|884483|32|CP026982|PILER-CR matches to MK421971 (Klebsiella phage vB_KpnM_GF, partial genome) position: , mismatch: 9, identity: 0.719

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
aactcgacgaccctgacagcgactattacctg	Protospacer
*    *.***** **********.******..

929. spacer 2.38|884543|32|CP026982|PILER-CR matches to FJ904927 (Vibrio phage VEJphi, complete genome) position: , mismatch: 9, identity: 0.719

gagctgcgcaagaaaaattgcctcgtcatcat	CRISPR spacer
tgattcagctagaaaaattgcctcttcatcag	Protospacer
 ...*  ** ************** ******

930. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_MK033499 (Escherichia coli strain C600_pConj125k plasmid pConj125k, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgcagcacgaaagcc-----	Protospacer
 ******************.** ***

931. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NC_019906 (Pseudomonas putida HB3267 plasmid pPC9, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
cctggctcgatgcgtagcacgacatagccggt	Protospacer
 *************.****.****  **   .

932. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgggtt	Protospacer
. .****************.******  * ..

933. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgggtt	Protospacer
. .****************.******  * ..

934. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgggtt	Protospacer
. .****************.******  * ..

935. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgggtt	Protospacer
. .****************.******  * ..

936. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042584 (Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgagtc	Protospacer
. .****************.******  . .*

937. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042584 (Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgagtc	Protospacer
. .****************.******  . .*

938. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042584 (Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgagtc	Protospacer
. .****************.******  . .*

939. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP042584 (Escherichia coli strain LD91-1 plasmid pLD91-1-76kb, complete sequence) position: , mismatch: 9, identity: 0.719

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgcagcacgacagccgagtc	Protospacer
. .****************.******  . .*

940. spacer 3.6|902868|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 9, identity: 0.719

gacagggcggtggatcacatcgttccgctctc	CRISPR spacer
ctgaccacggtggatcgcatcgatccgctcta	Protospacer
   *  .*********.***** ********

941. spacer 3.17|903528|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013345 (Sphingopyxis macrogoltabida strain 203N plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgcgtgtcgcggcggcggtagagggtgat	CRISPR spacer
gagcgcgtgtcgcgtcggcggtagacggcttc	Protospacer
 .*.********** ********** **.  .

942. spacer 3.17|903528|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 9, identity: 0.719

tggtgcgtgtcgcggcggcggtagagggtgat	CRISPR spacer
aggtgcgcgtcgaggcggcggtagtagcgcag	Protospacer
 ******.**** *********** .*   *

943. spacer 3.20|903701|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028348 (Novosphingobium sp. THN1 plasmid pTHN, complete sequence) position: , mismatch: 9, identity: 0.719

gacgagcaacgggcgcactgcccattgcccaa	CRISPR spacer
tcggtgcagcgggcgcactgaccattgccgcg	Protospacer
   * ***.*********** ********  .

944. spacer 3.21|903761|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to KY697807 (Microcystis phage MACPNOA1, complete genome) position: , mismatch: 9, identity: 0.719

tcagatgccgttgatctggcacatgccgttat	CRISPR spacer
gccgctgcggttgatctggctcatgccgcgca	Protospacer
 * * *** *********** *******.

945. spacer 3.24|903941|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031652 (Pantoea agglomerans strain TH81 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

cgactcacttaacgaatttgcatacg-acccgt	CRISPR spacer
tctctcatttaacgaatttccatacgtatgca-	Protospacer
.  ****.*********** ****** *. *.

946. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015090 (Pelagibaca abyssi strain JLT2014 plasmid pPABY2, complete sequence) position: , mismatch: 9, identity: 0.719

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
ggccgccgtcgagcgtgacgtccgccagcaac	Protospacer
*. .. ****************  ****** .

947. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 9, identity: 0.719

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
gcgcgacgtcgagcgagacgtcatcgagggcc	Protospacer
* ...********** ********* ** .*.

948. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 9, identity: 0.719

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
gtttaacgtccagcgtgacgacatcctcgaac	Protospacer
*  ******* ********* *****   * .

949. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to LK391770 (Klebsiella pneumoniae plasmid pRYC11, complete sequence, strain H67) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

950. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026048 (Raoultella planticola strain FDAARGOS_64 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

951. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026280 (Klebsiella oxytoca strain KONIH2 plasmid pKPC-55bf, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

952. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018674 (Klebsiella pneumoniae strain CAV1217 plasmid pCAV1217-71, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

953. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KY093014 (Klebsiella aerogenes strain Eaer-4382 plasmid pEaer-4382s, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

954. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KY093013 (Klebsiella aerogenes strain Eaer-4382 plasmid pEaer-4382b, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

955. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KY270850 (Klebsiella pneumoniae strain 12181 plasmid p12181-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

956. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KY270849 (Klebsiella pneumoniae strain 0716 plasmid p0716-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

957. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034757 (Enterobacter hormaechei subsp. hoffmannii strain Eh1 plasmid p3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

958. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050835 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

959. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX443408 (Klebsiella pneumoniae strain SC24 plasmid pKSC24, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

960. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KX236178 (Klebsiella pneumoniae strain HS091147 plasmid pHS091147, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

961. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029740 (Klebsiella pneumoniae strain AR_0087 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

962. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KP125893 (Klebsiella pneumoniae subsp. pneumoniae strain HS08204 plasmid pHS08204, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

963. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KR822246 (Enterobacter hormaechei strain E0083033-1 plasmid pEh1A, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

964. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KU295132 (Escherichia coli strain BK34397 plasmid pBK34397, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

965. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_020087 (Klebsiella pneumoniae plasmid pK1HV, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

966. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021753 (Klebsiella pneumoniae strain AR_0113 plasmid unitig_2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

967. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024917 (Klebsiella pneumoniae strain NH54 plasmid pKPNH54.1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

968. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031262 (Klebsiella quasipneumoniae strain L22 plasmid pL22-5, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

969. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044529 (Klebsiella grimontii strain SS141 plasmid plamid_2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

970. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017386 (Klebsiella pneumoniae strain KP36 plasmid 1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

971. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014005 (Klebsiella pneumoniae subsp. pneumoniae strain NUHL24835 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

972. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048351 (Raoultella ornithinolytica strain 23 plasmid p23_B, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

973. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052410 (Klebsiella pneumoniae strain C17KP0008 plasmid pC17KP0008-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

974. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028588 (Escherichia coli strain WCHEC4533 plasmid pNDM4_000533, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

975. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028805 (Klebsiella pneumoniae strain WCHKP7E2 plasmid pKPC2_085072, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

976. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024194 (Klebsiella pneumoniae isolate KSB1_5D plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

977. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011977 (Klebsiella pneumoniae DMC1097 plasmid pDMC1097-218.836kb, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

978. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052311 (Klebsiella pneumoniae strain E16KP0102 plasmid pE16KP0102-2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

979. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN200129 (Klebsiella pneumoniae strain 17ZR-91 plasmid p17ZR-91-IncFII-114, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

980. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN200130 (Escherichia coli strain EC600 plasmid p17ZR-91-TC1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

981. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN543580 (Klebsiella pneumoniae strain PM48 plasmid pPM48_125, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

982. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_010886 (Klebsiella pneumoniae plasmid pK245, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

983. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KJ721789 (Klebsiella pneumoniae strain NJ HT1872 plasmid pUSKPC3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

984. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KJ958926 (Klebsiella pneumoniae strain Kpn-3002cz plasmid pB-3002cz, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

985. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LN824135 (Klebsiella pneumoniae genome assembly MS6671.v1, plasmid : _Plasmid_B_Kpneumoniae_MS6671) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

986. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020523 (Escherichia coli strain 190 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

987. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP023150 (Klebsiella pneumoniae strain SMKP03 plasmid pSMKP03M, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

988. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028955 (Klebsiella pneumoniae strain AR_0141 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

989. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008791 (Klebsiella oxytoca KONIH1 plasmid pKPC-727, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

990. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MT066418 (Klebsiella pneumoniae strain ST11 plasmid p158590-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

991. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN586817 (Klebsiella pneumoniae strain A1966 plasmid pA1966-NR, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

992. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_019389 (Klebsiella pneumoniae plasmid pKDO1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

993. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025042 (Klebsiella pneumoniae strain NU-CRE047 plasmid pNU-CRE047_5, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

994. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034777 (Klebsiella pneumoniae strain 18CPO060 plasmid pKPCKP060, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

995. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020843 (Klebsiella pneumoniae strain KPN1482 plasmid pKPN1482-2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

996. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891677 (Klebsiella pneumoniae strain ZZ41 plasmid pZZ41-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

997. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891679 (Klebsiella pneumoniae strain ZZ40 plasmid pZZ40-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

998. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891681 (Klebsiella pneumoniae strain 14899 plasmid p14899-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

999. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891683 (Klebsiella pneumoniae strain 314013 plasmid p314013-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1000. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891684 (Klebsiella pneumoniae strain BJ107 plasmid pBJ107-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1001. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891685 (Klebsiella pneumoniae strain BJ119 plasmid pBJ119-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1002. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to LC549807 (Klebsiella pneumoniae VNCKp115 plasmid pVNCKp115 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1003. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to LC549808 (Klebsiella pneumoniae VNCKp83 plasmid pVNCKp83 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1004. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032878 (Escherichia coli strain WCHEC000837 plasmid pNDM4_000837, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1005. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015502 (Klebsiella pneumoniae strain SKGH01 plasmid unnamed 2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1006. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028178 (Klebsiella pneumoniae strain CFSAN054111 plasmid pGMI16-006_2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1007. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047686 (Serratia marcescens strain 2838 plasmid p2838-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1008. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP037964 (Klebsiella pneumoniae strain SCKP020135 plasmid pMCR8_020135, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1009. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026272 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-f607, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1010. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023250 (Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1011. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023250 (Klebsiella pneumoniae strain CCUG 70742 plasmid pKpn70742_1) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1012. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022442 (Klebsiella sp. LY plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1013. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042483 (Klebsiella pneumoniae strain C51 plasmid pC51_002, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1014. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024876 (Klebsiella pneumoniae strain NH25 plasmid pNH25.2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1015. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047683 (Serratia marcescens strain 3024 plasmid p3024-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1016. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034325 (Klebsiella pneumoniae isolate KSH203 plasmid pKSH203-CTX-M-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1017. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035182 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncR, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1018. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035182 (Klebsiella pneumoniae strain BA33875 plasmid pBA33875_IncR, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1019. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025214 (Klebsiella pneumoniae strain HZW25 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1020. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025214 (Klebsiella pneumoniae strain HZW25 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1021. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021959 (Klebsiella pneumoniae strain AR_0139 plasmid tig00000003, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1022. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012569 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-3.X, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1023. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028991 (Klebsiella pneumoniae strain AR_0142 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1024. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047680 (Serratia marcescens strain 4201 plasmid p4201-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1025. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029135 (Klebsiella pneumoniae strain AR376 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1026. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052554 (Klebsiella pneumoniae strain A17KP0038 plasmid pA17KP0038-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1027. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041642 (Klebsiella pneumoniae strain PIMB15ND2KP27 plasmid pKP27-NDM4, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1028. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024835 (Klebsiella pneumoniae strain CRKP-2297 plasmid pCRKP-2297_1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1029. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP038003 (Klebsiella pneumoniae strain SCKP020009 plasmid pKPC2_020009, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1030. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026185 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-9a0d, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1031. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP039525 (Klebsiella pneumoniae subsp. pneumoniae strain HB25-1 plasmid pHB25-1-88K, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1032. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MK191023 (Klebsiella pneumoniae strain KP17-16 plasmid p17-16-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1033. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047337 (Klebsiella pneumoniae strain 2019036D plasmid p2019036D-mcr8-345kb, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1034. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to KY930324 (Klebsiella pneumoniae plasmid pUCLAKPC1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1035. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021545 (Klebsiella pneumoniae strain AR_0112 plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1036. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021687 (Klebsiella pneumoniae strain AR_0146 plasmid tig00001186, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1037. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021720 (Escherichia coli strain AR_0128 plasmid tig00000793, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1038. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036306 (Klebsiella pneumoniae strain WCHKP020098 plasmid pKPC2_020098, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1039. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP019690 (Klebsiella quasipneumoniae strain SNI47 plasmid pTMSNI47-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1040. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP030067 (Klebsiella pneumoniae strain IA565 plasmid pDA11912.2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1041. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028553 (Klebsiella variicola strain WCHKP19 plasmid pCTXM15_020019, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1042. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009774 (Klebsiella pneumoniae subsp. pneumoniae strain KPNIH33 plasmid pNJST258N3-62b, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1043. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044038 (Klebsiella pneumoniae strain FDAARGOS_630 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1044. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP006925 (Klebsiella pneumoniae 30660/NJST258_1 plasmid pNJST258N3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1045. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008932 (Klebsiella pneumoniae strain PMK1 plasmid pPMK1-C, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1046. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP006921 (Klebsiella pneumoniae 30684/NJST258_2 plasmid pNJST258C3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1047. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009116 (Klebsiella pneumoniae strain carbapenem-resistant blaNDM-1 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1048. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052281 (Klebsiella pneumoniae strain E16KP0224 plasmid pE16KP0224-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1049. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024839 (Klebsiella pneumoniae strain CRKP-1215 plasmid pCRKP-1215_1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1050. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026396 (Klebsiella pneumoniae strain KPNIH48 plasmid pKPN-8c6e, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1051. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041250 (Raoultella electrica strain DSM 102253 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1052. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052289 (Klebsiella pneumoniae strain E16KP0218 plasmid pE16KP0218-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1053. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018999 (Escherichia coli strain Ecol_AZ153 plasmid pECAZ153_KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1054. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036446 (Klebsiella pneumoniae strain KPNIH45 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1055. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP025966 (Klebsiella pneumoniae strain WCHKP34 plasmid pQnrB_LL34, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1056. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038279 (Raoultella ornithinolytica strain WLK218 plasmid pWLK-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1057. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP012564 (Klebsiella pneumoniae strain UCLAOXA232KP plasmid pUCLAOXA232-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1058. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP050170 (Klebsiella pneumoniae plasmid Carbapenemase(KPC-2)_IncFII, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1059. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_032103 (Klebsiella pneumoniae strain 628 plasmid p628-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1060. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034131 (Klebsiella quasipneumoniae strain G4584 plasmid pG4584_136.4Kb, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1061. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034677 (Klebsiella quasipneumoniae strain D120-1 plasmid pD120-1_80kb, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1062. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP050155 (Klebsiella quasipneumoniae plasmid Carbapenemase(IMP-4)_IncFI, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1063. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MF918372 (Klebsiella pneumoniae plasmid p1512-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1064. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024431 (Klebsiella pneumoniae strain DA48896 plasmid p48896_2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1065. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024524 (Klebsiella pneumoniae strain INF158 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1066. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN792917 (Enterobacter hormaechei subsp. xiangfangensis strain ST114 plasmid pLAU_ENM30_NDM1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1067. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050374 (Klebsiella pneumoniae strain 50595 plasmid p50595_NDM_1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1068. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP050361 (Klebsiella pneumoniae strain 47733 plasmid p47733_ARR2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1069. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052540 (Klebsiella pneumoniae strain B16KP0141 plasmid pB16KP0141-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1070. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_021198 (Klebsiella pneumoniae subsp. pneumoniae KPX plasmid pKPX-1 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1071. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035384 (Klebsiella pneumoniae strain AP8555 plasmid pAP855, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1072. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018451 (Klebsiella pneumoniae strain Kp_Goe_71070 plasmid pKp_Goe_070-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1073. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017452 (Klebsiella sp. LTGPAF-6F plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1074. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045678 (Klebsiella pneumoniae strain WSD411 plasmid pWSD411_5, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1075. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026212 (Citrobacter sp. CFNIH10 plasmid pCIT-a850, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1076. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022226 (Escherichia coli strain WCHEC96200 plasmid pNDM4_WCHEC96200, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1077. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP013340 (Raoultella ornithinolytica strain Yangling I2 plasmid pKPYL2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1078. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021857 (Klebsiella pneumoniae strain AR_0125 plasmid tig00000002_pilon, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1079. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029723 (Klebsiella pneumoniae strain AR_0140 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1080. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034137 (Klebsiella quasipneumoniae subsp. similipneumoniae strain G747 plasmid pG747_150.8Kb, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1081. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN823996 (Klebsiella pneumoniae strain 0239 plasmid p0239-FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1082. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN824001 (Klebsiella pneumoniae strain N201205880 plasmid p205880-1FIIK, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1083. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN615880 (Serratia marcescens strain S1 plasmid pS1-KPC2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1084. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011630 (Klebsiella oxytoca strain CAV1374 plasmid pCAV1374-49, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1085. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024510 (Klebsiella pneumoniae strain KSB2_1B plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1086. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016925 (Klebsiella pneumoniae isolate 23 plasmid pCTXM15_DHQP1400954, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1087. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032212 (Klebsiella pneumoniae strain AR_0109 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1088. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032188 (Klebsiella pneumoniae strain AR_0075 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1089. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN842291 (Klebsiella pneumoniae strain 11935 plasmid p11935-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1090. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028782 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pQnrB52_020046, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1091. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023489 (Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733 plasmid p19-10_02, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1092. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP027606 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0093 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1093. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018673 (Klebsiella pneumoniae strain GSU10-3 plasmid pGSU10-3-2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1094. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011646 (Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1095. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021946 (Klebsiella pneumoniae strain AR_0152 plasmid tig00000195, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1096. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052391 (Klebsiella pneumoniae strain C17KP0052 plasmid pC17KP0052-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1097. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP011576 (Klebsiella pneumoniae strain CAV1392 plasmid pCAV1392-50, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1098. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035197 (Klebsiella pneumoniae strain LH375 plasmid pLH375_1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1099. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020050 (Escherichia coli strain AR_0118 plasmid unitig_2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1100. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052436 (Klebsiella pneumoniae strain C16KP0108 plasmid pC16KP0108-2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1101. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024573 (Klebsiella pneumoniae strain INF274 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1102. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to AP022352 (Klebsiella pneumoniae E208 plasmid pE208_IMP6 DNA, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1103. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031883 (Klebsiella pneumoniae strain WCHKP095845 plasmid pMCR8_095845, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1104. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035124 (Escherichia coli strain EC25 plasmid pEC25-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1105. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052352 (Klebsiella pneumoniae strain D16KP0146 plasmid pD17KP0032-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1106. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_013950 (Klebsiella pneumoniae plasmid pKF3-94, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1107. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024566 (Klebsiella pneumoniae strain INF278 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1108. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034085 (Klebsiella pneumoniae subsp. pneumoniae strain R210-2 plasmid pR210-2-CTX, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1109. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP028782 (Klebsiella pneumoniae subsp. pneumoniae strain SCKP020046 plasmid pCTXM27_020046, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1110. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028717 (Klebsiella pneumoniae strain SCM96 plasmid pSCM96-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1111. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018830 (Enterobacter hormaechei subsp. xiangfangensis strain M206 plasmid pM206-NDM1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1112. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052393 (Klebsiella pneumoniae strain C17KP0040 plasmid pC17KP0040-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1113. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052479 (Klebsiella pneumoniae strain C16KP0050 plasmid pC16KP0050-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1114. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032176 (Klebsiella pneumoniae strain AR_0135 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1115. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028389 (Klebsiella pneumoniae strain WCHKP13F2 plasmid pKPC2_095132, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1116. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP021758 (Klebsiella pneumoniae strain AR_0138 plasmid tig00000001, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1117. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to CP052471 (Klebsiella pneumoniae strain C16KP0053 plasmid pC16KP0053-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1118. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023943 (Klebsiella pneumoniae strain FDAARGOS_444 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1119. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014765 (Klebsiella pneumoniae strain KPNIH39 plasmid pKpQIL-9b8, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1120. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019904 (Escherichia coli strain MDR_56 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1121. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026588 (Klebsiella pneumoniae strain NUHL30457 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1122. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047634 (Klebsiella pneumoniae strain K2606 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1123. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN891678 (Klebsiella pneumoniae strain Kpn47 plasmid pKpn47-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1124. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK773536 (Klebsiella pneumoniae strain QDE2 plasmid pQDE2-B, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1125. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MN543570 (Klebsiella pneumoniae strain HKU49 plasmid pHKU49_CIP, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1126. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041086 (Klebsiella pneumoniae strain Kp202 plasmid pKp202_4, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1127. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH909340 (Klebsiella pneumoniae strain A1763 plasmid pA1763-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1128. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH917122 (Klebsiella pneumoniae strain Kp715 plasmid pSZF_KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1129. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK413718 (Klebsiella pneumoniae strain 427113 plasmid p427113-2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1130. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG878868 (Klebsiella pneumoniae strain Kp21774 plasmid pKp21774-135, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1131. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH464586 (Klebsiella pneumoniae strain KP1572 plasmid pIMP1572, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1132. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MH477636 (Klebsiella pneumoniae strain 130504051 plasmid p504051-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1133. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MK036886 (Klebsiella pneumoniae strain 283149 plasmid p283149-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1134. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020091 (Enterobacter cloacae strain PIMB10EC27 plasmid pEC27-2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1135. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN688131 (Enterobacter hormaechei subsp. xiangfangensis strain ST114 plasmid pLAU_ENC1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1136. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016810 (Klebsiella pneumoniae strain DHQP1002001 plasmid p_IncFIB_DHQP1002001, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1137. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014777 (Pluralibacter gergoviae strain FB2 plasmid pFB2.2, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1138. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF156708 (Klebsiella pneumoniae strain 13294 plasmid p13294-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1139. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MF168406 (Klebsiella pneumoniae strain 283747 plasmid p283747-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1140. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MT109193 (Klebsiella pneumoniae strain 156070 plasmid p156070-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1141. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018448 (Klebsiella pneumoniae strain Kp_Goe_33208 plasmid pKp_Goe_208-1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1142. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_MG764553 (Klebsiella pneumoniae strain A3295 plasmid pA3295-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1143. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026371 (Klebsiella quasipneumoniae strain A708 plasmid pA708-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1144. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033755 (Klebsiella pneumoniae strain FDAARGOS_566 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1145. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP035204 (Klebsiella pneumoniae strain LH94 plasmid pLH94-8, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1146. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN661404 (Klebsiella quasipneumoniae strain KP18-31 plasmid pKP18-31-3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1147. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MT108210 (Klebsiella pneumoniae strain W09308 plasmid pW09308-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1148. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MT108213 (Klebsiella pneumoniae strain ZZ100 plasmid pZZ100-KPC, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1149. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018737 (Klebsiella pneumoniae strain Kp_Goe_121641 plasmid pKp_Goe_641-1) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1150. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033776 (Klebsiella pneumoniae strain FDAARGOS_531 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1151. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033776 (Klebsiella pneumoniae strain FDAARGOS_531 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gccttacttgtgacggtgagtttattgttaac	Protospacer
.*. *  ..**********.****.*******

1152. spacer 3.33|904481|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007144 (Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence) position: , mismatch: 9, identity: 0.719

gctaaactgctgggcgtgctcgatgaagttaa	CRISPR spacer
gcgccgctgctggccgtgctggatgaagtgtt	Protospacer
**   .******* ****** ********

1153. spacer 3.34|904541|33|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.727

attctgtttatgttataaaagattcttcctgcg	CRISPR spacer
cctatgtttaagttaaaaaagattcttcaatca	Protospacer
 .* ****** **** ************   *.

1154. spacer 3.34|904541|33|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

attctgtttatgttataaaagattcttcctgcg	CRISPR spacer
cctatgtttaagttaaaaaagattcttcaatca	Protospacer
 .* ****** **** ************   *.

1155. spacer 3.34|904541|33|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

attctgtttatgttataaaagattcttcctgcg	CRISPR spacer
cctatgtttaagttaaaaaagattcttcaatca	Protospacer
 .* ****** **** ************   *.

1156. spacer 7.2|4412627|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP031836 (Lactobacillus amylolyticus strain L5 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gatctgattccggcaatcacaacattcaataa	CRISPR spacer
tccgtgaatccggcaatcactacattcgttac	Protospacer
  . *** ************ ******. **

1157. spacer 7.2|4412627|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP020458 (Lactobacillus amylolyticus strain L6 plasmid pL6-1, complete sequence) position: , mismatch: 9, identity: 0.719

gatctgattccggcaatcacaacattcaataa	CRISPR spacer
tccgtgaatccggcaatcactacattcgttac	Protospacer
  . *** ************ ******. **

1158. spacer 7.9|4413054|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP026198 (Enterobacteriaceae bacterium ENNIH3 plasmid pKPC-c606, complete sequence) position: , mismatch: 9, identity: 0.719

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
tgaaaggacatgccctgaacggcaggaaaaag	Protospacer
.*. *******  **************  . *

1159. spacer 7.9|4413054|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP025983 (Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence) position: , mismatch: 9, identity: 0.719

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
tgaaaggacatgccctgaacggcaggaaaaag	Protospacer
.*. *******  **************  . *

1160. spacer 7.13|4412629|32|CP026982|PILER-CR matches to NZ_CP031836 (Lactobacillus amylolyticus strain L5 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

gatctgattccggcaatcacaacattcaataa	CRISPR spacer
tccgtgaatccggcaatcactacattcgttac	Protospacer
  . *** ************ ******. **

1161. spacer 7.13|4412629|32|CP026982|PILER-CR matches to NZ_CP020458 (Lactobacillus amylolyticus strain L6 plasmid pL6-1, complete sequence) position: , mismatch: 9, identity: 0.719

gatctgattccggcaatcacaacattcaataa	CRISPR spacer
tccgtgaatccggcaatcactacattcgttac	Protospacer
  . *** ************ ******. **

1162. spacer 7.20|4413056|32|CP026982|PILER-CR matches to NZ_CP026198 (Enterobacteriaceae bacterium ENNIH3 plasmid pKPC-c606, complete sequence) position: , mismatch: 9, identity: 0.719

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
tgaaaggacatgccctgaacggcaggaaaaag	Protospacer
.*. *******  **************  . *

1163. spacer 7.20|4413056|32|CP026982|PILER-CR matches to NZ_CP025983 (Enterobacteriaceae bacterium A-F18 plasmid pAF18_1, complete sequence) position: , mismatch: 9, identity: 0.719

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
tgaaaggacatgccctgaacggcaggaaaaag	Protospacer
.*. *******  **************  . *

1164. spacer 8.1|4415196|32|CP026982|CRISPRCasFinder,CRT matches to NC_048639 (Pseudomonas phage ZC08, complete genome) position: , mismatch: 9, identity: 0.719

tactcaggtagagcttgctgaaagggttggaa	CRISPR spacer
tagatcaaaagaacatgctgaaagggttggaa	Protospacer
**  . .. ***.* *****************

1165. spacer 8.1|4415196|32|CP026982|CRISPRCasFinder,CRT matches to NC_048638 (Pseudomonas phage ZC03, complete genome) position: , mismatch: 9, identity: 0.719

tactcaggtagagcttgctgaaagggttggaa	CRISPR spacer
tagatcaaaagaacatgctgaaagggttggaa	Protospacer
**  . .. ***.* *****************

1166. spacer 8.2|4415257|33|CP026982|CRISPRCasFinder,CRT matches to NZ_CP039495 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_2, complete sequence) position: , mismatch: 9, identity: 0.727

tctccggtaataccggaaggttacaaattagca	CRISPR spacer
tctccggtaattccggagggttacgcgcttgtg	Protospacer
*********** *****.******. ..* *..

1167. spacer 8.2|4415257|33|CP026982|CRISPRCasFinder,CRT matches to MK714353 (Klebsiella phage ST13-OXA48phi12.5, complete genome) position: , mismatch: 9, identity: 0.727

tctccggtaataccggaaggttacaaattagca	CRISPR spacer
tctccggtaattccggatggttacgtgatggtg	Protospacer
*********** ***** ******. . *.*..

1168. spacer 8.2|4415257|33|CP026982|CRISPRCasFinder,CRT matches to MN013086 (Klebsiella phage vB_Kpn_Chronis, complete genome) position: , mismatch: 9, identity: 0.727

tctccggtaataccggaaggttacaaattagca	CRISPR spacer
tctccggtaattccggatggttacgtgatggtg	Protospacer
*********** ***** ******. . *.*..

1169. spacer 8.14|4415990|32|CP026982|CRISPRCasFinder,CRT matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 9, identity: 0.719

atccaaacaaggttcttgatgttctccatgtc	CRISPR spacer
cgccggtgcaggttcttgctgttctccttgtc	Protospacer
  **..   ********* ******** ****

1170. spacer 8.18|4415257|34|CP026982|PILER-CR matches to NZ_CP039495 (Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000669 plasmid pCFSAN000669_2, complete sequence) position: , mismatch: 9, identity: 0.735

tctccggtaataccggaaggttacaaattagcac	CRISPR spacer
tctccggtaattccggagggttacgcgcttgtgc	Protospacer
*********** *****.******. ..* *..*

1171. spacer 8.18|4415257|34|CP026982|PILER-CR matches to MK714353 (Klebsiella phage ST13-OXA48phi12.5, complete genome) position: , mismatch: 9, identity: 0.735

tctccggtaataccggaaggttacaaattagcac	CRISPR spacer
tctccggtaattccggatggttacgtgatggtgc	Protospacer
*********** ***** ******. . *.*..*

1172. spacer 8.18|4415257|34|CP026982|PILER-CR matches to MN013086 (Klebsiella phage vB_Kpn_Chronis, complete genome) position: , mismatch: 9, identity: 0.735

tctccggtaataccggaaggttacaaattagcac	CRISPR spacer
tctccggtaattccggatggttacgtgatggtgc	Protospacer
*********** ***** ******. . *.*..*

1173. spacer 8.30|4415990|33|CP026982|PILER-CR matches to NZ_LR134454 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 12, complete sequence) position: , mismatch: 9, identity: 0.727

atccaaacaaggttcttgatgttctccatgtcc	CRISPR spacer
cgccggtgcaggttcttgctgttctccttgtcc	Protospacer
  **..   ********* ******** *****

1174. spacer 2.13|884480|32|CP026982|CRISPRCasFinder,CRT matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 10, identity: 0.688

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
acggtggcgaccgtgacaacgacgggattcgg	Protospacer
**** *************.**** .   .* .

1175. spacer 2.16|884661|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 10, identity: 0.688

tttatggatgcgcgggcgttagattttgctat	CRISPR spacer
cagatggatgcgcgggcgctggatttccccga	Protospacer
.  ***************.*.*****. *..

1176. spacer 2.20|884902|32|CP026982|CRISPRCasFinder,CRT matches to CP000876 (Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence) position: , mismatch: 10, identity: 0.688

acgagtttctgccgcttgccctgctttctgct	CRISPR spacer
ccagccgcgtgccgcttgtcctgcttcctgct	Protospacer
 *.. . . *********.*******.*****

1177. spacer 2.26|885264|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 10, identity: 0.688

ttcgatagcggagtacaccgccgcgtttagct	CRISPR spacer
cgcgatggcggagtacaccggcgcgccgaaga	Protospacer
. ****.************* ****.. *.

1178. spacer 2.37|884483|32|CP026982|PILER-CR matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 10, identity: 0.688

acggaggcgaccgtgacagcgaccattaccca	CRISPR spacer
acggtggcgaccgtgacaacgacgggattcgg	Protospacer
**** *************.**** .   .* .

1179. spacer 2.40|884664|32|CP026982|PILER-CR matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 10, identity: 0.688

tttatggatgcgcgggcgttagattttgctat	CRISPR spacer
cagatggatgcgcgggcgctggatttccccga	Protospacer
.  ***************.*.*****. *..

1180. spacer 2.44|884905|32|CP026982|PILER-CR matches to CP000876 (Herpetosiphon aurantiacus DSM 785 plasmid pHAU01, complete sequence) position: , mismatch: 10, identity: 0.688

acgagtttctgccgcttgccctgctttctgct	CRISPR spacer
ccagccgcgtgccgcttgtcctgcttcctgct	Protospacer
 *.. . . *********.*******.*****

1181. spacer 2.50|885267|32|CP026982|PILER-CR matches to NZ_CP018784 (Curtobacterium pusillum strain AA3 plasmid pCPAA3, complete sequence) position: , mismatch: 10, identity: 0.688

ttcgatagcggagtacaccgccgcgtttagct	CRISPR spacer
cgcgatggcggagtacaccggcgcgccgaaga	Protospacer
. ****.************* ****.. *.

1182. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 10, identity: 0.688

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgaagcacgacagccgggtt	Protospacer
. .*********** ****.******  * ..

1183. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP033074 (Buttiauxella sp. 3AFRM03 plasmid pBTX_120, complete sequence) position: , mismatch: 10, identity: 0.688

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgaagcacgacagccgggtt	Protospacer
. .*********** ****.******  * ..

1184. spacer 3.18|903588|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN512538 (Vibrio phage Seahorse, complete genome) position: , mismatch: 10, identity: 0.688

ttgataaacacgcacacggcgcagtgatgagc	CRISPR spacer
aacgagaacacgcacacggcgcaatgatgcct	Protospacer
   . .*****************.*****  .

1185. spacer 3.18|903588|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_008043 (Ruegeria sp. TM1040 megaplasmid, complete sequence) position: , mismatch: 10, identity: 0.688

ttgataaacacgcacacggcgcagtgatgagc	CRISPR spacer
gcaggtgacgcgaacacggcgcagtgatgagg	Protospacer
 ...  .**.** ******************

1186. spacer 3.25|904001|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN228696 (Sinorhizobium phage ort11, complete genome) position: , mismatch: 10, identity: 0.688

acttctaacacgcctttatggtcatcatatac	CRISPR spacer
tcttctatcacgcctgtatggtcacttctgaa	Protospacer
 ****** ******* ********.. .  *

1187. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026927 (Agrobacterium tumefaciens strain 1D1609 plasmid pAt1D1609a, complete sequence) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
ccgatacgtcaagcgtgacgttatccagtgcc	Protospacer
  .  *****.**********.******..*.

1188. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
agtcgatttcgatcgtgacggcatccagcacg	Protospacer
.. ..*. **** ******* **********

1189. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LN997849 (Magnetospirillum sp. XM-1 isolate XM1 plasmid II, complete sequence) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
gtggaacgtcgagcgcggcgtcatccatgtgg	Protospacer
* . ***********.*.*********

1190. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MK620899 (Gordonia phage GodonK, complete genome) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
tgtcctcgtcgagcgtgatgtcgtccagctcg	Protospacer
 . .  ************.***.****** *

1191. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MK620899 (Gordonia phage GodonK, complete genome) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
tgtcctcgtcgagcgtgatgtcgtccagctcg	Protospacer
 . .  ************.***.****** *

1192. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN096369 (Gordonia phage Phendrix, complete genome) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
tgtcctcgtcgagcgtgatgtcgtccagctcg	Protospacer
 . .  ************.***.****** *

1193. spacer 3.26|904061|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to MN096369 (Gordonia phage Phendrix, complete genome) position: , mismatch: 10, identity: 0.688

gaataacgtcgagcgtgacgtcatccagcact	CRISPR spacer
tgtcctcgtcgagcgtgatgtcgtccagctcg	Protospacer
 . .  ************.***.****** *

1194. spacer 3.29|904241|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP045419 (Pseudoalteromonas sp. THAF3 plasmid pTHAF3_a, complete sequence) position: , mismatch: 10, identity: 0.688

actattaccgtgacggtgaatttactgttaac	CRISPR spacer
gcccgccaggtaacggtgtatttactgttaac	Protospacer
.*.  .   **.****** *************

1195. spacer 7.5|4412810|32|CP026982|CRT,CRISPRCasFinder matches to MN693122 (Marine virus AFVG_25M460, complete genome) position: , mismatch: 10, identity: 0.688

atatcgccaaaaaatatggttggatgatgttc	CRISPR spacer
gatttagaaaataatgtggttggatgatgtta	Protospacer
.  *..  *** ***.***************

1196. spacer 7.6|4412871|32|CP026982|CRT,CRISPRCasFinder matches to MK290739 (Pectobacterium phage Q19, complete genome) position: , mismatch: 10, identity: 0.688

tcagttaaatccatagcgttaactcaacagga	CRISPR spacer
atagttaaagccataacgttaactccttatat	Protospacer
 .******* *****.*********  .* .

1197. spacer 7.9|4413054|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP054609 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
cggttggacattccctgaacggctagccaaat	Protospacer
**** ******* ********** .* . .

1198. spacer 7.9|4413054|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP054611 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
cggttggacattccctgaacggctagccaaat	Protospacer
**** ******* ********** .* . .

1199. spacer 7.10|4413115|32|CP026982|CRT,CRISPRCasFinder matches to NZ_AP018258 (Calothrix sp. NIES-4071 plasmid plasmid3 DNA, complete genome) position: , mismatch: 10, identity: 0.688

tcgcggacgtattcttgcaaaccgcgaacctg	CRISPR spacer
ttctcgacgtattcgagcaaaccgcgaaagcc	Protospacer
*. . *********  ************  .

1200. spacer 7.12|4413237|32|CP026982|CRT,CRISPRCasFinder matches to NZ_CP012265 (Cronobacter condimenti 1330 strain LMG 26250 plasmid pCCO1, complete sequence) position: , mismatch: 10, identity: 0.688

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
aaagcagacgtaaaaaaaccctgccgaagcag	Protospacer
    ****************** * **.. .*

1201. spacer 7.16|4412812|32|CP026982|PILER-CR matches to MN693122 (Marine virus AFVG_25M460, complete genome) position: , mismatch: 10, identity: 0.688

atatcgccaaaaaatatggttggatgatgttc	CRISPR spacer
gatttagaaaataatgtggttggatgatgtta	Protospacer
.  *..  *** ***.***************

1202. spacer 7.17|4412873|32|CP026982|PILER-CR matches to MK290739 (Pectobacterium phage Q19, complete genome) position: , mismatch: 10, identity: 0.688

tcagttaaatccatagcgttaactcaacagga	CRISPR spacer
atagttaaagccataacgttaactccttatat	Protospacer
 .******* *****.*********  .* .

1203. spacer 7.20|4413056|32|CP026982|PILER-CR matches to NZ_CP054609 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
cggttggacattccctgaacggctagccaaat	Protospacer
**** ******* ********** .* . .

1204. spacer 7.20|4413056|32|CP026982|PILER-CR matches to NZ_CP054611 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

cggtaggacattacctgaacggcaggatcgcg	CRISPR spacer
cggttggacattccctgaacggctagccaaat	Protospacer
**** ******* ********** .* . .

1205. spacer 7.21|4413117|32|CP026982|PILER-CR matches to NZ_AP018258 (Calothrix sp. NIES-4071 plasmid plasmid3 DNA, complete genome) position: , mismatch: 10, identity: 0.688

tcgcggacgtattcttgcaaaccgcgaacctg	CRISPR spacer
ttctcgacgtattcgagcaaaccgcgaaagcc	Protospacer
*. . *********  ************  .

1206. spacer 7.23|4413239|32|CP026982|PILER-CR matches to NZ_CP012265 (Cronobacter condimenti 1330 strain LMG 26250 plasmid pCCO1, complete sequence) position: , mismatch: 10, identity: 0.688

tctccagacgtaaaaaaaccctccggagaggg	CRISPR spacer
aaagcagacgtaaaaaaaccctgccgaagcag	Protospacer
    ****************** * **.. .*

1207. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030922 (Escherichia coli strain KL53 plasmid pKL53-S, complete sequence) position: , mismatch: 11, identity: 0.656

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgaagcacgacagccgtttt	Protospacer
. .*********** ****.******   ...

1208. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030922 (Escherichia coli strain KL53 plasmid pKL53-S, complete sequence) position: , mismatch: 11, identity: 0.656

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgaagcacgacagccgtttt	Protospacer
. .*********** ****.******   ...

1209. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030922 (Escherichia coli strain KL53 plasmid pKL53-S, complete sequence) position: , mismatch: 11, identity: 0.656

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgaagcacgacagccgtttt	Protospacer
. .*********** ****.******   ...

1210. spacer 3.1|902568|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP030922 (Escherichia coli strain KL53 plasmid pKL53-S, complete sequence) position: , mismatch: 11, identity: 0.656

gctggctcgatgcgcagcatgacagcgcgccc	CRISPR spacer
agcggctcgatgcgaagcacgacagccgtttt	Protospacer
. .*********** ****.******   ...

1211. spacer 3.17|903528|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 11, identity: 0.656

tggtgcgtgtcgcggcggcggtagagggtgat	CRISPR spacer
acgtgggtgtcgcggcgggggtagatacgctc	Protospacer
  *** ************ ****** .    .

1212. spacer 3.21|903761|32|CP026982|CRISPRCasFinder,CRT,PILER-CR matches to LR745207 (uncultured phage genome assembly, chromosome: 1) position: , mismatch: 11, identity: 0.656

tcagatgccgttgatctggcacatgccgttat	CRISPR spacer
agtcttgccgttgatctggcgtatgccgcccg	Protospacer
     ***************..******..

1213. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP047377 (Aeromonas salmonicida subsp. salmonicida strain J410 plasmid p1AsJ410, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1214. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP048224 (Aeromonas salmonicida subsp. salmonicida strain J223 plasmid pASal5, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1215. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022183 (Aeromonas salmonicida strain S68 plasmid pS68-2, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1216. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NC_009350 (Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1217. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP038103 (Aeromonas salmonicida subsp. salmonicida strain SHY16-3432 plasmid pAsa5-3432, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1218. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP017145 (Aeromonas salmonicida subsp. masoucida strain RFAS1 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1219. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022178 (Aeromonas salmonicida strain S44 plasmid pS44-3, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1220. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP022172 (Aeromonas salmonicida strain S121 plasmid pS121-3, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1221. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_CP047375 (Aeromonas salmonicida subsp. salmonicida strain J409 plasmid p1AsJ409, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1222. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to NZ_KY555069 (Aeromonas salmonicida subsp. salmonicida strain 01-B526 plasmid pAsa5, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

1223. spacer 8.15|4416051|32|CP026982|CRISPRCasFinder,CRT matches to CP052035 (Aeromonas salmonicida subsp. salmonicida strain J411 plasmid p1AsJ411, complete sequence) position: , mismatch: 11, identity: 0.656

gattcatcccctccagacttgaggcccaactg	CRISPR spacer
cccgcatcccctccagactcggggccccgggc	Protospacer
  . ***************.*.***** .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

442566 : 451139

Dickeya_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH17334.1\|442566_443391_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-13	31.0
AYH17335.1\|443402_444212_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-29	38.9
AYH17336.1\|444415_444985_+	peptidylprolyl isomerase A	A0A1V0S9I2	Catovirus	3.9e-07	31.9
AYH17337.1\|445069_446347_-	pectate lyase	A0A1B1IPS8	uncultured_Mediterranean_phage	2.9e-34	32.9
AYH17338.1\|446509_447634_-	pectate lyase	A0A140XB77	Dickeya_phage	1.7e-59	77.5
AYH17339.1\|448341_449466_-	pectate lyase	A0A140XB77	Dickeya_phage	1.8e-56	73.2
AYH17340.1\|450014_451139_-	pectate lyase	A0A140XB77	Dickeya_phage	1.7e-54	71.7

DBSCAN-SWA_2

1625556 : 1631764

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH18287.1\|1625556_1626702_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.6e-81	45.3
AYH18288.1\|1626743_1627589_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	2.8e-46	40.8
AYH18289.1\|1627585_1628122_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	1.3e-57	58.1
AYH18290.1\|1628123_1628993_-	glucose-1-phosphate thymidylyltransferase	A0A291LA53	Escherichia_phage	2.7e-108	66.3
AYH18291.1\|1629227_1630124_+	GalU regulator GalF	A0A127AW70	Bacillus_phage	3.5e-47	40.8
AYH18292.1\|1630357_1631764_+	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	A0A1D7RI04	Synechococcus_phage	2.5e-31	29.6

DBSCAN-SWA_3

1725535 : 1769811

Burkholderia_phage(45.0%)

plate,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH18374.1\|1725535_1726468_+\|tRNA	tRNA dihydrouridine(16) synthase DusC	NA	NA	NA	NA
AYH18375.1\|1726663_1728076_+	S-methylmethionine permease	NA	NA	NA	NA
AYH18376.1\|1728068_1729010_+	homocysteine S-methyltransferase	NA	NA	NA	NA
AYH18377.1\|1729032_1729581_+	hypothetical protein	NA	NA	NA	NA
AYH18378.1\|1729917_1730460_+	class IV adenylate cyclase	NA	NA	NA	NA
AYH18379.1\|1730519_1730876_+	FMN-binding protein	NA	NA	NA	NA
AYH18380.1\|1731189_1732137_+	D-alanyl-D-alanine endopeptidase	NA	NA	NA	NA
AYH18381.1\|1732205_1732892_-	glutathione S-transferase family protein	NA	NA	NA	NA
AYH18382.1\|1733039_1733810_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
AYH18383.1\|1733841_1735494_-	ABC transporter permease	NA	NA	NA	NA
AYH18384.1\|1735490_1736501_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-29	35.3
AYH18385.1\|1736578_1737598_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AYH18386.1\|1738012_1739359_+	aspartate aminotransferase family protein	M9MUV3	Rhodococcus_phage	1.4e-10	31.9
AYH18387.1\|1739704_1742011_+	beta-glucosidase BglX	NA	NA	NA	NA
AYH18388.1\|1742131_1742671_+	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
AYH18389.1\|1742945_1743593_-	LysE family translocator	NA	NA	NA	NA
AYH18390.1\|1743645_1744479_-	AraC family transcriptional regulator	NA	NA	NA	NA
AYH18391.1\|1744693_1746793_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	1.0e-41	25.6
AYH18392.1\|1747301_1748726_+	serine 3-dehydrogenase	NA	NA	NA	NA
AYH18393.1\|1748829_1749141_+	proteinase inhibitor	NA	NA	NA	NA
AYH18394.1\|1749158_1750886_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	9.6e-25	33.2
AYH18395.1\|1750914_1752243_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
AYH18396.1\|1752245_1753613_+	peptidase	NA	NA	NA	NA
AYH18397.1\|1753829_1754159_+	hypothetical protein	A4JWP3	Burkholderia_virus	1.2e-24	58.3
AYH18398.1\|1754160_1754772_+	lytic transglycosylase domain-containing protein	Q5ZQZ1	Pseudomonas_phage	6.1e-59	56.0
AYH18399.1\|1754761_1755436_+	hypothetical protein	NA	NA	NA	NA
AYH18400.1\|1755425_1755755_+	hypothetical protein	Q6QIC4	Burkholderia_phage	2.5e-19	50.0
AYH18401.1\|1755747_1756059_+	hypothetical protein	Q6QIC3	Burkholderia_phage	8.3e-20	45.5
AYH18402.1\|1756302_1756770_+	hypothetical protein	NA	NA	NA	NA
AYH18403.1\|1756766_1756964_+	hypothetical protein	Q6QIB1	Burkholderia_phage	5.4e-09	58.8
AYH18404.1\|1756953_1758381_+\|tail	phage tail protein	A4JWK5	Burkholderia_virus	9.5e-204	73.6
AYH18405.1\|1758380_1758905_+\|tail	phage major tail tube protein	Q6QIA9	Burkholderia_phage	9.5e-69	66.7
AYH18406.1\|1759047_1759368_+\|tail	phage tail assembly protein	NA	NA	NA	NA
AYH21272.1\|1759312_1759456_+\|tail	GpE family phage tail protein	NA	NA	NA	NA
AYH21273.1\|1759678_1762126_+\|tail	phage tail tape measure protein	A4JWL0	Burkholderia_virus	6.0e-89	31.1
AYH18407.1\|1762125_1763055_+	hypothetical protein	Q6QIA4	Burkholderia_phage	3.4e-45	42.4
AYH18408.1\|1763044_1763257_+	hypothetical protein	A4JWL2	Burkholderia_virus	5.8e-17	57.1
AYH18409.1\|1763244_1764405_+	phage protein D	Q6QIA2	Burkholderia_phage	2.1e-84	50.0
AYH18410.1\|1764401_1764983_+\|plate	phage baseplate assembly protein V	Q6QIA1	Burkholderia_phage	6.1e-24	45.6
AYH18411.1\|1765042_1765390_+\|plate	baseplate protein	Q6QIA0	Burkholderia_phage	9.5e-33	62.0
AYH18412.1\|1765380_1766484_+\|plate	baseplate protein	Q6QI99	Burkholderia_phage	1.7e-104	54.6
AYH18413.1\|1766476_1767058_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	7.3e-62	61.2
AYH18414.1\|1768929_1769223_-	hypothetical protein	NA	NA	NA	NA
AYH18415.1\|1769247_1769811_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	6.6e-68	76.2

DBSCAN-SWA_4

2530864 : 2639800

121

Cronobacter_phage(28.21%)

tRNA,tail,portal,integrase,head,bacteriocin,protease,capsid,terminase,holin

attL 2561792:2561806|attR 2639089:2639103

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH19075.1\|2530864_2532517_-	hypothetical protein	F1BUJ7	Cronobacter_phage	3.2e-171	54.3
AYH19076.1\|2532513_2533062_-	hypothetical protein	F1BUJ9	Cronobacter_phage	1.0e-49	59.9
AYH19077.1\|2533033_2533756_-	hypothetical protein	F1BUK1	Cronobacter_phage	7.0e-46	43.7
AYH19078.1\|2534574_2534880_-	hypothetical protein	NA	NA	NA	NA
AYH19079.1\|2534888_2535116_-	hypothetical protein	NA	NA	NA	NA
AYH19080.1\|2535139_2536432_-	hypothetical protein	F1BUK3	Cronobacter_phage	1.2e-51	39.0
AYH19081.1\|2536441_2537074_-	hypothetical protein	F1BUK5	Cronobacter_phage	2.8e-54	57.7
AYH19082.1\|2537066_2538251_-	hypothetical protein	F1BUK6	Cronobacter_phage	2.2e-161	72.3
AYH19083.1\|2538240_2538576_-	DUF2590 domain-containing protein	F1BUK8	Cronobacter_phage	5.2e-36	71.8
AYH19084.1\|2538575_2540606_-\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	3.6e-164	47.3
AYH19085.1\|2540602_2540785_-	hypothetical protein	A5X9I8	Aeromonas_virus	2.9e-09	63.0
AYH19086.1\|2540793_2541051_-	hypothetical protein	A5X9I7	Aeromonas_virus	1.1e-20	60.5
AYH19087.1\|2541047_2541227_-	hypothetical protein	F1BUL1	Cronobacter_phage	3.0e-14	69.5
AYH19088.1\|2541183_2541540_-	hypothetical protein	F1BUL2	Cronobacter_phage	5.4e-23	57.7
AYH19089.1\|2541539_2541881_-	hypothetical protein	F1BUL3	Cronobacter_phage	3.8e-42	79.2
AYH19090.1\|2541867_2542173_-\|holin	holin	Q6K1I2	Salmonella_virus	1.3e-17	57.3
AYH19091.1\|2542182_2542638_-	DUF2597 domain-containing protein	F1BUL4	Cronobacter_phage	1.7e-53	66.9
AYH19092.1\|2542634_2543777_-	DUF2586 domain-containing protein	F1BUL5	Cronobacter_phage	6.6e-139	68.5
AYH19093.1\|2543794_2544472_-	hypothetical protein	F1BUL6	Cronobacter_phage	3.0e-67	57.4
AYH19094.1\|2544468_2544969_-\|tail	phage tail protein	F1BUL7	Cronobacter_phage	2.2e-38	47.5
AYH19095.1\|2544965_2545418_-\|head	head completion protein	F1BUL8	Cronobacter_phage	2.2e-45	58.0
AYH19096.1\|2545511_2545703_-	hypothetical protein	NA	NA	NA	NA
AYH19097.1\|2545705_2546419_-\|terminase	terminase	F1BUM0	Cronobacter_phage	5.1e-65	53.0
AYH19098.1\|2546431_2547460_-\|capsid	phage major capsid protein, P2 family	F1BUM2	Cronobacter_phage	5.5e-137	74.0
AYH19099.1\|2547491_2548307_-\|capsid	phage capsid protein	F1BUM4	Cronobacter_phage	3.6e-46	52.3
AYH19100.1\|2548494_2550279_+\|terminase	terminase	F1BUM5	Cronobacter_phage	3.8e-250	73.8
AYH19101.1\|2550275_2551295_+\|portal	phage portal protein	F1BUM7	Cronobacter_phage	3.5e-136	68.8
AYH19102.1\|2551294_2551618_+	transcriptional regulator	F1BUM8	Cronobacter_phage	9.1e-38	75.7
AYH19103.1\|2551662_2552040_-	type II toxin-antitoxin system YafO family toxin	NA	NA	NA	NA
AYH19104.1\|2552050_2552653_-	hypothetical protein	NA	NA	NA	NA
AYH19105.1\|2552758_2552998_-	hypothetical protein	NA	NA	NA	NA
AYH19106.1\|2553332_2556029_-	bifunctional DNA primase/helicase	A0A077K8T2	Ralstonia_phage	8.0e-236	47.5
AYH19107.1\|2556065_2556284_-	hypothetical protein	A0A286S1P6	Klebsiella_phage	3.6e-06	39.1
AYH19108.1\|2556286_2556847_-	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	2.9e-23	33.9
AYH19109.1\|2556856_2557192_-	hypothetical protein	NA	NA	NA	NA
AYH19110.1\|2557188_2557464_-	hypothetical protein	Q1JS60	Enterobacteria_phage	8.0e-43	85.6
AYH19111.1\|2557586_2557868_+	transcriptional regulator	Q1JS83	Enterobacteria_phage	2.5e-31	70.3
AYH21308.1\|2558001_2558997_+\|integrase	integrase	Q83VS6	Escherichia_phage	1.9e-142	72.6
AYH19112.1\|2559112_2559409_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	5.5e-13	40.0
AYH19113.1\|2559413_2561801_-\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	5.1e-08	28.9
2561792:2561806	attL	NA	NA	NA	NA
AYH19114.1\|2561815_2562799_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	4.5e-35	39.3
AYH19115.1\|2563127_2563484_-	50S ribosomal protein L20	NA	NA	NA	NA
AYH19116.1\|2563527_2563725_-	50S ribosomal protein L35	NA	NA	NA	NA
AYH19117.1\|2563838_2564381_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	2.8e-15	33.5
AYH19118.1\|2564383_2566312_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	7.4e-127	36.3
AYH19119.1\|2566576_2567968_-	amino acid permease	NA	NA	NA	NA
AYH19120.1\|2568090_2568354_-	hypothetical protein	NA	NA	NA	NA
AYH19121.1\|2568603_2569395_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
AYH19122.1\|2569610_2570777_-	oligogalacturonate lyase	NA	NA	NA	NA
AYH19123.1\|2571118_2572000_-\|protease	protease HtpX	NA	NA	NA	NA
AYH19124.1\|2572163_2573012_-	glycerophosphodiester phosphodiesterase	M1HTS7	Paramecium_bursaria_Chlorella_virus	2.1e-09	32.1
AYH19125.1\|2573042_2574380_-	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AYH19126.1\|2574659_2575883_-	MFS transporter	NA	NA	NA	NA
AYH19127.1\|2576067_2576817_-	DNA-binding response regulator	A0A2R2ZGH8	Clostridioides_phage	9.0e-12	25.4
AYH19128.1\|2576813_2578559_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	9.3e-52	27.7
AYH19129.1\|2578708_2580877_-	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
AYH19130.1\|2580873_2581056_-	hypothetical protein	NA	NA	NA	NA
AYH19131.1\|2581260_2581518_-	hypothetical protein	NA	NA	NA	NA
AYH19132.1\|2581913_2582648_+	phage repressor protein C	E5AGE6	Erwinia_phage	1.2e-77	61.0
AYH19133.1\|2583139_2583490_+	DNA-binding protein	A4JWM4	Burkholderia_virus	5.4e-28	50.4
AYH19134.1\|2583960_2585067_+	4Fe-4S binding protein	NA	NA	NA	NA
AYH21309.1\|2585188_2585404_-	isocitrate dehydrogenase	Q77Z09	Phage_21	2.9e-16	77.8
AYH19135.1\|2585542_2585755_+	hypothetical protein	NA	NA	NA	NA
AYH19136.1\|2585760_2593065_-	hypothetical protein	A0A1I9KFG8	Aeromonas_phage	7.7e-241	37.0
AYH19137.1\|2593301_2593724_+	hypothetical protein	NA	NA	NA	NA
AYH19138.1\|2593716_2594079_+	hypothetical protein	NA	NA	NA	NA
AYH19139.1\|2595474_2595750_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AYH19140.1\|2595749_2596130_-	hypothetical protein	A0A1I9KFD7	Aeromonas_phage	2.6e-15	38.2
AYH19141.1\|2596131_2596800_-	hypothetical protein	A0A1I9KFE8	Aeromonas_phage	1.1e-45	52.1
AYH19142.1\|2596808_2597180_-	hypothetical protein	A0A088CC37	Shigella_phage	1.5e-28	52.8
AYH19143.1\|2597201_2598866_-	DUF1983 domain-containing protein	A0A2L1IV54	Escherichia_phage	1.0e-79	43.2
AYH19144.1\|2598862_2600488_-	hypothetical protein	A0A075M3B5	Escherichia_Stx1-converting_recombinant_phage	2.4e-163	52.8
AYH19145.1\|2600793_2601303_+	hypothetical protein	NA	NA	NA	NA
AYH19146.1\|2601374_2602757_-	hypothetical protein	NA	NA	NA	NA
AYH19147.1\|2602849_2605162_-	hypothetical protein	A0A2D2W7C0	Pectobacterium_phage	2.0e-41	31.9
AYH19148.1\|2605158_2605821_-	hypothetical protein	Q08J85	Stx2-converting_phage	4.2e-53	45.8
AYH19149.1\|2605820_2606402_-	hypothetical protein	A0A2L1IV64	Escherichia_phage	5.3e-28	39.2
AYH19150.1\|2606401_2606839_-	hypothetical protein	A0A2R2Z354	Escherichia_phage	2.7e-24	46.9
AYH19151.1\|2606895_2607279_-	hypothetical protein	NA	NA	NA	NA
AYH19152.1\|2607340_2608564_-\|capsid	N4-gp56 family major capsid protein	A0A088CC32	Shigella_phage	5.9e-178	75.4
AYH19153.1\|2608624_2609674_-	hypothetical protein	A0A2R2Z355	Escherichia_phage	6.2e-51	39.5
AYH19154.1\|2609902_2610748_-	DUF2971 domain-containing protein	NA	NA	NA	NA
AYH19155.1\|2610757_2612890_-\|portal	portal protein	A0A088CE71	Shigella_phage	4.2e-256	65.7
AYH19156.1\|2612889_2614605_-\|terminase	terminase	A0A2R2Z350	Escherichia_phage	8.1e-250	74.4
AYH19157.1\|2614601_2615471_-\|terminase	terminase	A0A1I9KFG9	Aeromonas_phage	4.5e-31	36.6
AYH21310.1\|2615535_2615793_-	hypothetical protein	A0A2P1JUA7	Erwinia_phage	1.3e-34	74.1
AYH19158.1\|2616497_2616818_-	hypothetical protein	NA	NA	NA	NA
AYH19159.1\|2616934_2617477_-	hypothetical protein	H9C185	Pectobacterium_phage	4.3e-56	69.8
AYH19160.1\|2617561_2617804_-	hypothetical protein	NA	NA	NA	NA
AYH19161.1\|2617800_2618121_-	MFS transporter	A0A088FVG2	Escherichia_phage	1.1e-24	50.0
AYH19162.1\|2618120_2618714_-	DUF3380 domain-containing protein	H2DE58	Erwinia_phage	6.1e-72	69.9
AYH19163.1\|2618854_2619250_-	hypothetical protein	NA	NA	NA	NA
AYH19164.1\|2619251_2620061_-	hypothetical protein	NA	NA	NA	NA
AYH19165.1\|2620150_2620915_-	BRO-like protein	Q6J1W3	Lactobacillus_phage	3.6e-08	32.8
AYH19166.1\|2621135_2622005_-	methyltransferase domain-containing protein	NA	NA	NA	NA
AYH19167.1\|2622051_2622360_-	DUF1364 domain-containing protein	A0A223LHA7	Pseudoalteromonas_phage	1.1e-13	50.0
AYH19168.1\|2622362_2623010_-	DUF1367 domain-containing protein	K7PKS6	Enterobacteria_phage	5.2e-24	34.8
AYH19169.1\|2623006_2623672_-	phage N-6-adenine-methyltransferase	A5LH72	Enterobacteria_phage	4.9e-86	67.3
AYH19170.1\|2623668_2624811_-	recombination-associated protein RdgC	S4TWL4	Salmonella_phage	1.3e-99	61.9
AYH19171.1\|2624807_2625626_-	hypothetical protein	H2DE84	Erwinia_phage	1.0e-45	50.3
AYH19172.1\|2625612_2626539_-	helix-turn-helix domain-containing protein	Q8W642	Enterobacteria_phage	7.2e-35	63.0
AYH19173.1\|2626535_2626709_-	DUF4222 domain-containing protein	NA	NA	NA	NA
AYH19174.1\|2626686_2626878_-	hypothetical protein	NA	NA	NA	NA
AYH19175.1\|2626874_2627231_-	hypothetical protein	NA	NA	NA	NA
AYH19176.1\|2627247_2627493_-	transcriptional regulator	A0A2D1GLN0	Escherichia_phage	1.4e-25	74.3
AYH21311.1\|2627809_2628523_+	helix-turn-helix transcriptional regulator	K7P7I4	Enterobacteria_phage	4.0e-70	74.9
AYH19177.1\|2628567_2629011_+	hypothetical protein	NA	NA	NA	NA
AYH21312.1\|2629120_2629312_+	hypothetical protein	NA	NA	NA	NA
AYH19178.1\|2629374_2629659_-	hypothetical protein	NA	NA	NA	NA
AYH19179.1\|2630330_2630603_+	hypothetical protein	NA	NA	NA	NA
AYH19180.1\|2630727_2630988_+	KTSC domain-containing protein	A9YWW2	Burkholderia_phage	1.9e-17	56.0
AYH19181.1\|2631064_2631400_+	hypothetical protein	NA	NA	NA	NA
AYH19182.1\|2631697_2632540_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	9.0e-69	49.5
AYH19183.1\|2632526_2634077_+	hypothetical protein	A0A2H4J6P1	uncultured_Caudovirales_phage	5.1e-110	47.6
AYH19184.1\|2634115_2635255_+	hypothetical protein	M4MHC3	Vibrio_phage	1.3e-33	26.4
AYH19185.1\|2635251_2635674_+	hypothetical protein	NA	NA	NA	NA
AYH19186.1\|2635690_2636497_+	hypothetical protein	A0A248SL66	Klebsiella_phage	2.1e-62	51.2
AYH19187.1\|2636677_2636965_+	hypothetical protein	A0A1I9LJN4	Stx_converting_phage	6.9e-29	65.2
AYH19188.1\|2637043_2637280_+	excisionase	NA	NA	NA	NA
AYH19189.1\|2637269_2638409_+\|integrase	integrase	Q77Z04	Phage_21	3.1e-120	59.4
AYH19190.1\|2638546_2639800_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-15	77.8
2639089:2639103	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3078153 : 3144016

Escherichia_phage(28.95%)

portal,head,plate,bacteriocin,capsid,tail,integrase

attL 3071574:3071633|attR 3153185:3153265

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3071574:3071633	attL	NA	NA	NA	NA
AYH19546.1\|3078153_3078420_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AYH19547.1\|3078416_3080219_-	S-type Pyocin	NA	NA	NA	NA
AYH19548.1\|3080379_3081969_-	shufflon system plasmid conjugative transfer pilus tip adhesin PilV	NA	NA	NA	NA
AYH21334.1\|3082058_3082304_-	hypothetical protein	NA	NA	NA	NA
AYH19549.1\|3082363_3082720_-	hypothetical protein	NA	NA	NA	NA
AYH19550.1\|3083100_3083502_+	DNA-binding protein	NA	NA	NA	NA
AYH19551.1\|3083640_3084351_+	hypothetical protein	A0A2K9R7T9	Dishui_lake_phycodnavirus	3.5e-05	51.1
AYH19552.1\|3084538_3084823_-	conjugal transfer protein TraD	NA	NA	NA	NA
AYH19553.1\|3084825_3085074_-	hypothetical protein	NA	NA	NA	NA
AYH19554.1\|3085702_3085984_+	hypothetical protein	NA	NA	NA	NA
AYH21335.1\|3086048_3087449_+	conjugal transfer protein	NA	NA	NA	NA
AYH19555.1\|3087622_3088207_+	hypothetical protein	NA	NA	NA	NA
AYH19556.1\|3088601_3089255_-	hypothetical protein	NA	NA	NA	NA
AYH19557.1\|3089272_3089827_-	DNA-directed RNA polymerase subunit beta	NA	NA	NA	NA
AYH19558.1\|3090461_3090839_+	hypothetical protein	NA	NA	NA	NA
AYH19559.1\|3091025_3091355_+	hypothetical protein	NA	NA	NA	NA
AYH19560.1\|3091436_3092426_-	hypothetical protein	NA	NA	NA	NA
AYH19561.1\|3092492_3093179_-	hypothetical protein	NA	NA	NA	NA
AYH19562.1\|3093324_3093519_-	hypothetical protein	NA	NA	NA	NA
AYH19563.1\|3095116_3095851_+	DNA-binding protein	M1Q742	Cellulophaga_phage	1.3e-26	45.7
AYH19564.1\|3095995_3096268_-	hypothetical protein	NA	NA	NA	NA
AYH19565.1\|3096582_3097065_+	DUF4756 domain-containing protein	NA	NA	NA	NA
AYH19566.1\|3097071_3097773_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AYH19567.1\|3097774_3098167_-	amino acid-binding protein	NA	NA	NA	NA
AYH19568.1\|3098159_3098483_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AYH21336.1\|3098601_3098844_-	DNA-binding protein	NA	NA	NA	NA
AYH19569.1\|3098914_3099265_-	hypothetical protein	NA	NA	NA	NA
AYH21337.1\|3099304_3099541_-	hypothetical protein	NA	NA	NA	NA
AYH19570.1\|3099620_3099917_-	hypothetical protein	NA	NA	NA	NA
AYH19571.1\|3099997_3100312_-	hypothetical protein	NA	NA	NA	NA
AYH19572.1\|3100344_3100563_-	AlpA family transcriptional regulator	A0A2H4J8C8	uncultured_Caudovirales_phage	3.9e-08	49.1
AYH19573.1\|3100750_3101626_-	hypothetical protein	NA	NA	NA	NA
AYH19574.1\|3102060_3103332_+	nucleotidyltransferase	NA	NA	NA	NA
AYH19575.1\|3103396_3103945_+	hypothetical protein	NA	NA	NA	NA
AYH19576.1\|3104834_3106106_+\|integrase	integrase	B7SYF8	Stenotrophomonas_phage	2.0e-72	40.0
AYH19577.1\|3106958_3107756_+	DgsA anti-repressor MtfA	NA	NA	NA	NA
AYH19578.1\|3108369_3108594_+	hypothetical protein	NA	NA	NA	NA
AYH19579.1\|3108714_3109404_-	HNH endonuclease	NA	NA	NA	NA
AYH19580.1\|3109405_3110416_-\|integrase	integrase	Q94N03	Haemophilus_virus	1.0e-111	59.6
AYH19581.1\|3110498_3111347_-	DUF4435 domain-containing protein	NA	NA	NA	NA
AYH19582.1\|3111343_3112690_-	hypothetical protein	NA	NA	NA	NA
AYH21338.1\|3112705_3113293_-	CI repressor	Q6K1G0	Salmonella_virus	3.5e-51	46.9
AYH19583.1\|3113410_3113623_+	DNA-binding protein	NA	NA	NA	NA
AYH19584.1\|3113668_3114178_+	hypothetical protein	A0A0M4QWN1	Salmonella_phage	6.2e-49	56.5
AYH19585.1\|3114227_3114491_-	hypothetical protein	NA	NA	NA	NA
AYH19586.1\|3114483_3114723_+	hypothetical protein	NA	NA	NA	NA
AYH19587.1\|3114853_3115288_+	tellurite resistance protein	Q1MVI3	Enterobacteria_phage	1.1e-62	87.1
AYH19588.1\|3115287_3115449_+	DUF3927 domain-containing protein	NA	NA	NA	NA
AYH19589.1\|3115698_3116199_+	replication protein B	A0A0F7LBQ6	Escherichia_phage	5.7e-55	60.6
AYH19590.1\|3116261_3116510_+	DUF2732 domain-containing protein	A0A0F7LBR4	Escherichia_phage	1.1e-09	58.2
AYH19591.1\|3116509_3116818_+	hypothetical protein	NA	NA	NA	NA
AYH19592.1\|3116817_3117042_+	hypothetical protein	Q6K1F5	Salmonella_virus	3.6e-17	59.5
AYH19593.1\|3117229_3119527_+	replication endonuclease	A0A0F7LBQ2	Escherichia_phage	1.7e-266	61.9
AYH19594.1\|3119675_3119864_+	hypothetical protein	NA	NA	NA	NA
AYH19595.1\|3120282_3120741_+	hypothetical protein	NA	NA	NA	NA
AYH19596.1\|3120734_3121040_+	DUF1493 domain-containing protein	NA	NA	NA	NA
AYH19597.1\|3121073_3122099_-\|portal	phage portal protein	F1BUR7	Erwinia_phage	2.3e-151	74.6
AYH19598.1\|3122095_3123865_-	oxidoreductase	F1BUR2	Erwinia_phage	7.5e-283	81.1
AYH19599.1\|3124004_3124859_+\|capsid	capsid scaffolding protein	Q94MB7	Escherichia_virus	1.9e-98	67.4
AYH19600.1\|3124906_3126022_+\|capsid	phage major capsid protein, P2 family	Q778Y7	Enterobacteria_phage	1.2e-145	70.8
AYH19601.1\|3126025_3126685_+	hypothetical protein	F1BUQ7	Erwinia_phage	8.3e-70	64.7
AYH19602.1\|3126776_3127280_+\|head	head completion/stabilization protein	S4TNY1	Salmonella_phage	9.5e-50	58.9
AYH19603.1\|3127279_3127483_+\|tail	phage tail protein	A0A0F7LCN2	Escherichia_phage	1.8e-20	68.7
AYH19604.1\|3127473_3127695_+	hypothetical protein	A0A218M4L5	Erwinia_phage	3.7e-14	49.3
AYH19605.1\|3127678_3128188_+	lysozyme	A0A218M4K3	Erwinia_phage	6.4e-62	71.0
AYH19606.1\|3128184_3128628_+	P2 LysB	NA	NA	NA	NA
AYH19607.1\|3128717_3129173_+\|tail	phage tail protein	A0A0F7LA33	Escherichia_phage	8.6e-50	64.5
AYH19608.1\|3129165_3129615_+	phage virion morphogenesis protein	F1BUP7	Erwinia_phage	3.1e-44	61.1
AYH19609.1\|3129643_3129985_-	addiction module antidote protein, HigA family	A0A222YWD7	Escherichia_phage	8.4e-42	75.5
AYH19610.1\|3129996_3130311_-	hypothetical protein	A0A222YWE2	Escherichia_phage	4.7e-31	65.0
AYH19611.1\|3130654_3131284_+	hypothetical protein	G9L689	Escherichia_phage	7.5e-36	61.4
AYH19612.1\|3131329_3132187_-	hypothetical protein	NA	NA	NA	NA
AYH19613.1\|3132185_3132821_+\|plate	phage baseplate assembly protein V	A0A2I8TV69	Erwinia_phage	2.2e-88	77.3
AYH19614.1\|3132817_3133162_+\|plate	baseplate assembly protein	F1BUP4	Erwinia_phage	7.0e-36	65.8
AYH19615.1\|3133166_3134075_+\|plate	baseplate assembly protein	Q858V6	Yersinia_virus	1.1e-128	78.5
AYH19616.1\|3134067_3134679_+\|tail	phage tail protein I	F1BUP2	Erwinia_phage	2.5e-76	69.0
AYH19617.1\|3137135_3138305_+\|tail	phage tail protein	Q37844	Escherichia_phage	3.5e-188	83.7
AYH19618.1\|3138317_3138839_+\|tail	phage major tail tube protein	A0A218M4J0	Erwinia_phage	5.7e-74	77.3
AYH19619.1\|3138899_3139196_+\|tail	phage tail assembly protein	A0A0F7LDQ8	Escherichia_phage	3.0e-27	68.2
AYH19620.1\|3139210_3139330_+\|tail	GpE family phage tail protein	A0A0F7LCR6	Escherichia_phage	2.2e-13	84.6
AYH19621.1\|3139322_3142070_+\|tail	phage tail tape measure protein	F1BUT7	Erwinia_phage	9.2e-163	52.3
AYH19622.1\|3142071_3142557_+\|tail	phage tail protein	S4TUC3	Salmonella_phage	7.0e-50	60.2
AYH19623.1\|3142553_3143711_+	hypothetical protein	A0A0M5M5V5	Salmonella_phage	2.8e-145	66.4
AYH19624.1\|3143797_3144016_+	late control protein B	Q37973	Salmonella_virus	1.1e-23	65.3
3153185:3153265	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3180902 : 3242891

uncultured_Caudovirales_phage(18.18%)

transposase,tail,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH19663.1\|3180902_3182014_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.3e-06	29.7
AYH19664.1\|3183143_3183404_-	hypothetical protein	NA	NA	NA	NA
AYH19665.1\|3183417_3189183_-\|protease	serine protease	NA	NA	NA	NA
AYH19666.1\|3189176_3190364_-	hypothetical protein	NA	NA	NA	NA
AYH19667.1\|3190503_3191541_-\|transposase	IS630 family transposase	NA	NA	NA	NA
AYH19668.1\|3191570_3191768_+	hypothetical protein	NA	NA	NA	NA
AYH19669.1\|3191879_3192062_+	hypothetical protein	NA	NA	NA	NA
AYH19670.1\|3192215_3193487_+	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	3.3e-75	40.0
AYH19671.1\|3193522_3193969_-	hypothetical protein	A0A2H4J2P5	uncultured_Caudovirales_phage	3.2e-25	48.1
AYH19672.1\|3195869_3196097_-	hypothetical protein	NA	NA	NA	NA
AYH19673.1\|3196622_3197009_-	hypothetical protein	NA	NA	NA	NA
AYH19674.1\|3200768_3201257_-	hypothetical protein	NA	NA	NA	NA
AYH19675.1\|3201259_3201982_-	hypothetical protein	NA	NA	NA	NA
AYH19676.1\|3202947_3203232_-	conjugal transfer protein TraD	NA	NA	NA	NA
AYH19677.1\|3203260_3203548_-	hypothetical protein	NA	NA	NA	NA
AYH19678.1\|3203858_3204515_-	AraC family transcriptional regulator	NA	NA	NA	NA
AYH19679.1\|3204610_3205009_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
AYH19680.1\|3205689_3206391_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AYH19681.1\|3206392_3206785_-	amino acid-binding protein	NA	NA	NA	NA
AYH19682.1\|3206777_3207101_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AYH19683.1\|3207212_3207482_-	DNA-binding protein	NA	NA	NA	NA
AYH19684.1\|3207524_3207875_-	hypothetical protein	NA	NA	NA	NA
AYH19685.1\|3207914_3208151_-	hypothetical protein	NA	NA	NA	NA
AYH19686.1\|3208527_3208842_-	hypothetical protein	NA	NA	NA	NA
AYH19687.1\|3208871_3209090_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	3.9e-08	46.4
AYH21342.1\|3210032_3210455_+	N-acetyltransferase	NA	NA	NA	NA
AYH19688.1\|3211269_3214350_-	AcrB/AcrD/AcrF family protein	NA	NA	NA	NA
AYH19689.1\|3214346_3215456_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AYH19690.1\|3215531_3216146_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYH19691.1\|3216233_3217721_+	RND transporter	NA	NA	NA	NA
AYH19692.1\|3217798_3218584_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYH19693.1\|3218794_3220294_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	4.5e-103	47.5
AYH19694.1\|3220401_3221583_+	galactonate dehydratase	Q6A202	Oenococcus_phage	4.0e-99	45.8
AYH19695.1\|3222390_3222867_-	DUF1348 domain-containing protein	NA	NA	NA	NA
AYH19696.1\|3223536_3224625_-	NADH:flavin oxidoreductase/NADH oxidase	NA	NA	NA	NA
AYH19697.1\|3224676_3225018_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AYH19698.1\|3225097_3225619_+	cupin	NA	NA	NA	NA
AYH19699.1\|3225703_3226165_+	DUF1456 domain-containing protein	Q9EYF4	Enterobacteria_phage	2.7e-51	64.7
AYH19700.1\|3226255_3227212_-\|transposase	transposase	Q2A0A7	Sodalis_phage	3.9e-84	63.9
AYH19701.1\|3227369_3228203_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AYH19702.1\|3228228_3230937_-	nitrate reductase	NA	NA	NA	NA
AYH21343.1\|3230933_3235121_-	nitrite reductase (NAD(P)H) small subunit	NA	NA	NA	NA
AYH19703.1\|3235140_3235935_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.7e-27	35.6
AYH19704.1\|3235945_3236860_-	nitrate ABC transporter, permease protein	NA	NA	NA	NA
AYH19705.1\|3236872_3238132_-	nitrate ABC transporter substrate-binding protein	NA	NA	NA	NA
AYH19706.1\|3238874_3240164_-	ANTAR domain-containing protein	NA	NA	NA	NA
AYH19707.1\|3240459_3242262_+\|tail	phage tail protein	M1TAS6	Escherichia_phage	1.2e-65	35.0
AYH19708.1\|3242273_3242891_+\|tail	tail fiber assembly protein	A0A218M4J2	Erwinia_phage	1.4e-31	38.7

DBSCAN-SWA_7

3355831 : 3364396

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH19803.1\|3355831_3357046_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	5.4e-123	54.7
AYH19804.1\|3357190_3357520_+	hypothetical protein	NA	NA	NA	NA
AYH19805.1\|3357534_3357999_+	hypothetical protein	NA	NA	NA	NA
AYH19806.1\|3358217_3358415_+	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	6.6e-07	45.3
AYH19807.1\|3358411_3358858_+	hypothetical protein	A0A1W6JPH9	Morganella_phage	7.7e-27	57.7
AYH19808.1\|3358871_3359669_+	antA/AntB antirepressor family protein	A0A0H5BBY8	Pseudomonas_phage	1.6e-22	45.7
AYH19809.1\|3360125_3360317_+	host cell division inhibitor Icd-like protein	NA	NA	NA	NA
AYH19810.1\|3360306_3360492_+	hypothetical protein	NA	NA	NA	NA
AYH19811.1\|3360481_3360682_+	hypothetical protein	NA	NA	NA	NA
AYH19812.1\|3360674_3360860_+	hypothetical protein	A0A1W6JPF0	Morganella_phage	9.0e-06	45.8
AYH19813.1\|3360856_3361057_+	hypothetical protein	NA	NA	NA	NA
AYH19814.1\|3361053_3361683_+	hypothetical protein	NA	NA	NA	NA
AYH19815.1\|3361693_3364396_+	DUF927 domain-containing protein	A0A1W6JPG0	Morganella_phage	4.9e-294	57.1

DBSCAN-SWA_8

3682152 : 3687555

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYH20066.1\|3682152_3682392_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	3.5e-18	58.1
AYH20067.1\|3682402_3682810_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A220BYR7	Staphylococcus_phage	1.4e-06	27.7
AYH20068.1\|3682806_3684954_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	4.9e-204	51.0
AYH20069.1\|3684978_3685941_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	1.9e-139	74.2
AYH20070.1\|3686297_3687035_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.0e-39	38.4
AYH20071.1\|3687090_3687555_+	ribonuclease HI	J9Q745	Salmonella_phage	1.7e-48	57.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026982

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection