CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032823	Arcobacter cryaerophilus ATCC 43158 chromosome, complete genome	0 crisprs	RT,DEDDh,cas3,cas4,csa3	0	0	5	0
CP032824	Arcobacter cryaerophilus ATCC 43158 plasmid pACRY43158, complete sequence	1 crisprs	csa3	0	1	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

35860 : 42939

Streptococcus_phage(16.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYJ79205.1\|35860_36793_+	cysteine synthase	A0A1X9I5K7	Streptococcus_phage	1.9e-80	54.7
AYJ79206.1\|36823_37054_+	DUF2061 domain-containing protein	A0A1B0XTK5	Freshwater_phage	7.0e-08	43.5
AYJ79207.1\|37062_37764_+	phosphoadenosine phosphosulfate reductase	A0A0K2CZZ1	Bacillus_phage	6.7e-09	34.5
AYJ79208.1\|37805_38717_+	sulfate adenylyltransferase, subunit CysD	NA	NA	NA	NA
AYJ79209.1\|38718_40113_+	sulfate adenylyltransferase, GTPase subunit CysN	A0A1V0SGC3	Hokovirus	2.5e-31	28.9
AYJ79210.1\|40123_41203_+	sulfite reductase, iron-sulfur subunit	NA	NA	NA	NA
AYJ79211.1\|41225_42377_-	drug resistance transporter, Bcr/CflA family	S4TR35	Salmonella_phage	8.3e-25	25.4
AYJ79212.1\|42501_42939_-	DNA-binding ferritin-like protein	A0A0A7RTZ1	Clostridium_phage	8.1e-13	35.1

DBSCAN-SWA_2

244048 : 250980

Campylobacter_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYJ79391.1\|244048_245041_-\|tRNA	phenylalanyl-tRNA synthetase, alpha subunit	A0A2K9L3A8	Tupanvirus	5.5e-33	36.0
AYJ79392.1\|245166_245511_+	histidine triad nucleotide-binding protein, Hint/PKCI branch	NA	NA	NA	NA
AYJ79393.1\|245539_246475_-	acetyl-CoA carboxylase, carboxyltransferase, alpha subunit	NA	NA	NA	NA
AYJ79394.1\|246522_247782_-	beta-ketoacyl-[acp] synthase II (KASII)	NA	NA	NA	NA
AYJ79395.1\|247891_248122_-	acyl carrier protein	M4QDG5	Prochlorococcus_phage	2.8e-09	67.9
AYJ79396.1\|248213_248957_-	3-oxoacyl-[acp] reductase	Q06VL0	Trichoplusia_ni_ascovirus	3.5e-16	28.6
AYJ79397.1\|249013_249778_-	7-carboxy-7-deazaguanine synthase	D5GV09	Campylobacter_virus	8.8e-55	45.2
AYJ79398.1\|249764_250292_-	6-carboxy-5,6,7,8-tetrahydropterin synthase	H6SU72	Campylobacter_virus	2.4e-43	50.3
AYJ79399.1\|250293_250980_-	7-cyano-7-deazaguanine synthase	A0A0E3JPW6	Enterobacteria_phage	4.3e-29	33.0

DBSCAN-SWA_3

751826 : 763192

Synechococcus_phage(33.33%)

integrase

attL 747937:747954|attR 753911:753928

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
747937:747954	attL	NA	NA	NA	NA
AYJ79892.1\|751826_752909_-\|integrase	site-specific tyrosine recombinase, phage integrase family (INT_Rci_Hp1_C domain)	B4XYR4	Lactobacillus_phage	4.8e-06	26.9
AYJ79893.1\|753253_753568_+	EPS-associated transcriptional regulator, MarR family	NA	NA	NA	NA
AYJ79894.1\|753569_754955_+	bifunctional mannose-6-phosphate isomerase / mannose-1-phosphate guanylyltransferase	A0A1V0SH58	Hokovirus	2.1e-59	34.9
753911:753928	attR	NA	NA	NA	NA
AYJ79895.1\|754956_755400_+	GDP-mannose mannosylhydrolase	NA	NA	NA	NA
AYJ79896.1\|755414_756560_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	4.7e-121	62.4
AYJ79897.1\|756572_757505_+	GDP-L-fucose synthetase	A0A1D8KU05	Synechococcus_phage	3.2e-59	39.9
AYJ79898.1\|757494_758658_+	aminotransferase, DegT/DnrJ/EryC1/StrS family	A0A0E3I7L6	Synechococcus_phage	4.0e-51	34.5
AYJ79899.1\|758654_759551_+	alpha-1,2-fucosyltransferase	A0A2H4UUT1	Bodo_saltans_virus	5.9e-26	39.1
AYJ79900.1\|759547_761257_+	ABC transporter, ATP-binding/permease components	W8CYL7	Bacillus_phage	6.6e-26	26.6
AYJ79901.1\|761253_762129_+	glucose-1-phosphate thymidylyltransferase, short form	K7QKA7	Escherichia_phage	9.6e-106	65.8
AYJ79902.1\|762121_763192_+	dTDP-D-glucose 4,6-dehydratase	H9NC62	Sphingomonas_phage	2.1e-78	45.6

DBSCAN-SWA_4

1319401 : 1328774

uncultured_virus(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYJ80440.1\|1319401_1321666_-	BvgS-like domain-containing diguanylate cyclase (NMT1 domain)	A0A127AWB9	Bacillus_phage	2.9e-21	37.8
AYJ80441.1\|1321702_1322467_-	D-alanyl-D-alanine carboxypeptidase, peptidase S11 family	B6DZZ7	Stx2-converting_phage	7.5e-14	29.9
AYJ80442.1\|1322747_1324376_-	60 kD chaperonin (cpn60)	A0A240F779	uncultured_virus	1.7e-172	63.4
AYJ80443.1\|1324449_1324707_-	10 kD chaperonin (cpn10)	A0A221S2B0	uncultured_virus	7.8e-08	37.8
AYJ80444.1\|1324830_1325703_-	geranyl diphosphate synthase / farnesyl diphosphate synthase	A0A1V0SE37	Indivirus	1.5e-13	28.4
AYJ80445.1\|1325703_1326033_-	YbaB/EbfC DNA-binding family protein	NA	NA	NA	NA
AYJ80446.1\|1326025_1326409_-	aspartate 1-decarboxylase	NA	NA	NA	NA
AYJ80447.1\|1326487_1327036_+	peptidyl-prolyl cis-trans isomerase B (WD40 domain-containing)	A0A2H4UTF4	Bodo_saltans_virus	9.8e-24	42.7
AYJ80448.1\|1327062_1327539_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
AYJ80449.1\|1327580_1328774_-	exodeoxyribonuclease VII, large subunit	A0A1V0SD82	Indivirus	4.0e-46	36.7

DBSCAN-SWA_5

1683385 : 1693898

Bacillus_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYJ80799.1\|1683385_1685440_-	UvrD/REP family helicase	A7KV33	Bacillus_phage	1.6e-106	37.3
AYJ80800.1\|1685555_1686452_+	transcriptional regulator, LysR family	NA	NA	NA	NA
AYJ80801.1\|1686455_1687421_-	radical SAM protein, TIGR01212 family	A0A2H4PQV5	Staphylococcus_phage	4.3e-14	30.6
AYJ80802.1\|1687420_1688767_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.4e-55	35.1
AYJ80803.1\|1688781_1689555_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
AYJ80804.1\|1689559_1690489_-	thioredoxin reductase	G3MA85	Bacillus_virus	1.7e-52	41.3
AYJ80805.1\|1690702_1691020_-	thioredoxin	A0A0K2FIM3	Achromobacter_phage	3.4e-13	36.6
AYJ80806.1\|1691219_1693898_+\|tRNA	alanyl-tRNA synthetase	A0A1V0SK38	Klosneuvirus	2.3e-70	32.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP032824

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032824_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032824_1

62043-62132

Orphan

Consensus_repeat	Method
GCAAAAAAAAGCTGTTAAAAATTCGGCTTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032824_1

>merge|CP032824|1|62043-62132|CRISPRCasFinder
GCAAAAAAAAGCTGTTAAAAATTCGGCTTAATTAAATACTAGTATAGCAATTGCAATATGGCAAAAAAAAGCTGTTAAAAATTCGGCTTA

>CP032824|1|1|62043-62132|CRISPRCasFinder
GCAAAAAAAAGCTGTTAAAAATTCGGCTTA	ATTAAATACTAGTATAGCAATTGCAATATG
GCAAAAAAAAGCTGTTAAAAATTCGGCTTA

Protein	Signature genes	Signature genes Name	Protein_function
CP032824.1\|AYJ81186.1\|66584_66836_+\|transcriptional-regulator,-XRE-family	unknown	unknown	gnl\|CDD\|238045
CP032824.1\|AYJ81188.1\|67086_67449_-\|putative-membrane-protein	unknown	unknown	unknown
CP032824.1\|AYJ81179.1\|60445_61006_-\|transcriptional-regulator,-XRE-family	unknown	unknown	gnl\|CDD\|238045
CP032824.1\|AYJ81181.1\|63838_64957_-\|putative-membrane-protein	unknown	unknown	unknown
CP032824.1\|AYJ81177.1\|56606_57749_+\|Fic-family-protein-(DUF4172-domain)	unknown	unknown	gnl\|CDD\|225718
CP032824.1\|AYJ81175.1\|52927_55399_+\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81187.1\|66891_67077_-\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81178.1\|58329_59520_+\|ATP-binding-protein-(AAA-domain)	unknown	unknown	gnl\|CDD\|224292
CP032824.1\|AYJ81173.1\|50516_51725_+\|site-specific-tyrosine-recombinase,-phage-integrase-family	unknown	unknown	gnl\|CDD\|274042
CP032824.1\|AYJ81172.1\|49785_49998_+\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81176.1\|55334_56351_-\|D-alanine--D-alanine-ligase	unknown	unknown	gnl\|CDD\|273498
CP032824.1\|AYJ81183.1\|65392_65611_-\|putative-membrane-protein	unknown	unknown	gnl\|CDD\|379161
CP032824.1\|AYJ81180.1\|61215_61383_-\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81184.1\|65646_65922_-\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81182.1\|65010_65403_-\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81185.1\|65932_66481_-\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81171.1\|49386_49539_+\|hypothetical-protein	unknown	unknown	unknown
CP032824.1\|AYJ81174.1\|51941_52880_+\|site-specific-tyrosine-recombinase,-phage-integrase-family	unknown	unknown	gnl\|CDD\|274042
CP032824.1\|AYJ81189.1\|67461_67743_-\|putative-membrane-protein	unknown	unknown	unknown
CP032824.1\|AYJ81190.1\|67747_68035_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP032824.1\|AYJ81176.1\|55334_56351_-\|D-alanine--D-alanine-ligase	gnl\|CDD\|273498	TIGR01205, D-alanine--D-alanine_ligase, D-alanine--D-alanine ligase. This model describes D-Ala--D-Ala ligase, an enzyme that makes a required precursor of the bacterial cell wall. It also describes some closely related proteins responsible for resistance to glycopeptide antibiotics such as vancomycin. The mechanism of glyopeptide antibiotic resistance involves the production of D-alanine-D-lactate (VanA and VanB families) or D-alanine-D-serine (VanC). The seed alignment contains only chromosomally encoded D-ala--D-ala ligases, but a number of antibiotic resistance proteins score above the trusted cutoff of this model. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	3.66539e-18
CP032824.1\|AYJ81183.1\|65392_65611_-\|putative-membrane-protein	gnl\|CDD\|379161	pfam13396, PLDc_N, Phospholipase_D-nuclease N-terminal. This family is often found at the very N-terminus of proteins from the phospholipase_D-nuclease family, PLDc, pfam00614. However, a large number of members are full-length within this family.	0.00228222
CP032824.1\|AYJ81179.1\|60445_61006_-\|transcriptional-regulator,-XRE-family	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	0.00875706
CP032824.1\|AYJ81186.1\|66584_66836_+\|transcriptional-regulator,-XRE-family	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.83744e-08
CP032824.1\|AYJ81177.1\|56606_57749_+\|Fic-family-protein-(DUF4172-domain)	gnl\|CDD\|225718	COG3177, COG3177, Fic family protein [Function unknown].	1.68555e-39
CP032824.1\|AYJ81174.1\|51941_52880_+\|site-specific-tyrosine-recombinase,-phage-integrase-family	gnl\|CDD\|274042	TIGR02224, Tyrosine_recombinase_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	2.25691e-82
CP032824.1\|AYJ81178.1\|58329_59520_+\|ATP-binding-protein-(AAA-domain)	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.49556e-27
CP032824.1\|AYJ81173.1\|50516_51725_+\|site-specific-tyrosine-recombinase,-phage-integrase-family	gnl\|CDD\|274042	TIGR02224, Tyrosine_recombinase_XerC, tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK. [DNA metabolism, DNA replication, recombination, and repair].	4.67297e-25

>CP032824.1|AYJ81180.1|61215_61383_-|hypothetical-protein
MIDLIFKVLLLVVIFAVLVVFILIKEIKRRREEIIEKIKVYIPFTSRPNPISFII
>CP032824.1|AYJ81179.1|60445_61006_-|transcriptional-regulator,-XRE-family
MIKSSVQKILMVASKKIRAERIALELSQEEFANFVDIKYSTYKTFEQKGKITFENYVKILMKINKEEQFNKFLEGFEFNDQKERANKKNENDNMYLKPIIEPSQKYIILDKKLFGEELFYSVEDGHRYEIPNFINIVLNKWNEKRLMLLLKYFGPERLAYHVIERKDINLLKSFNKHKAHIYKQLN
>CP032824.1|AYJ81178.1|58329_59520_+|ATP-binding-protein-(AAA-domain)
MDLATLQKISTQILSREVPIYKRYLYSKIDFNSKLIGIKGARGAGKSTILLQYAKSLNYPISKILYVSCDHPAMSGVSLYDIAEAFYARGGKLFIIDEIHKNENFSKDLKAIYDVFDLQVLFSGSSALQIEYSSADLSRRAVIHTLGVLSLREFCELQTNQTFQSYSLEDILKNHEDITFEILKKIRPLEQFNNYLKYGCYPFYKESLSDYSMKLLEVINLTIDSDLCGIYNIEPSKLDKLKKIIYMLCSTKPYELNISKLSSAVGTSWPTLQKYLERMDAGSLIHIVRAGEGMRAINKPDKLLLDNPNLFVVACGNGDIGSIRESFFVSQLVLHNQVHYHDKGDFIINDNYVFEIGGASKDASQLKGNKNGYVVNDDVEIGFDNKIPLWLFGFLY
>CP032824.1|AYJ81177.1|56606_57749_+|Fic-family-protein-(DUF4172-domain)
MKENIIKWIWQHKDYPNFKYDKSKLTDLLTQIEYNRGQLDGISKLFNRDDITKIEIETLTDEAINTSLIEGELLKRESVRSSFKKKLDKDFDARSDKYSTIATDNLVEILIDSNLNKKELHIDRLHGWHNCLFEHTQYSKLNKIDIAKFRSHSDMEVISGAIGYEKVHYKAIPVEKIDKNIENFLKYCNESFENLYIKAAIVHIWFVIIHPYDDGNGRIARAITDYVLSQNNTNTQFKLYSISTAINKDRKAYYDILDKTTNLFLNREFDITAWIIWHLNILNNAMEEALKNIEYLIQKTKFWDEHRNKALNERQIKVLNKILDVGNENFEGGLNTKKYISLTKVSKATAVRDITALVEFGCIKQIIGTAGRNVRYEIKF
>CP032824.1|AYJ81176.1|55334_56351_-|D-alanine--D-alanine-ligase
MYNNIVLVADIFEHTEENINFNSTTLEKPSQEYIDDVVRALTIYSKQVFVCNSPKELNNYLVKNSVEFVMTIYGGEISRNRLALVPAICESMNVKFLGADVYNRIICQDKNLCKTFAKRFNILSPNSILIYDENDISLIKSLKLPLVVKPNYEGSSIGISNKNIVNTFVKAITLIKELLEIFKQPIIVEEFIGGQEVNITLVGDNKNINIFEVIEDIHIEDINFFNNNLYTLEYKQLYCEKFSHKVITDKFDVETKNYIIDMYRHMGKIDYLRVDGKILNNKFYLIELTPDPYCGRESSFSKAIMSNGYTYEESIGLLIQNCSKYYQTQYSNEIIHTL
>CP032824.1|AYJ81175.1|52927_55399_+|hypothetical-protein
MNLYNETPFVNRYKILSFFSKHIENNLGKAVSIIYSRKGIGKSRLCKEILKDIKTTSTKVKVSINCSKVDFSQDGFYIKQIAKEINKNSLTISSISIEKFLQIDSENDHNELIYKIANDYMEKSSVLKNVKDVISKFFSIGNFNSDKIFDSNVAESIKLSYKYIEYCAKNNYFVINIENIQNIDITSLNFLVKLASKIENIYLLLEYTISNNKNSLSLDELQNSLIEVTDLKIETKELEQLNENELIKLLESNNDLLRQYIKTSYTKWDGNLRPFVNLHYNLPISNEEVKNFISNSNNTINNLVTNDLLDLQTKEIFLLIFIAVHGDSVELNLINQIHNINIMTDISNIFDFELELNRLVKKRFLVEYNKSYMINDDTILDILLNLSSFSSKKILATQLWLTIYTQVYNNDNNHFISKSTIIFNILKFSVQLQEKQNILKYLNELMFLFRNSTPIWVKNWIQKILDSFKNSTNEYINNLIKIRLSEITQNLSLYDTSYSLLNSIRSHDDNLLLAKAILLENNSKPHESLDIINSIIEKDNLNTRLYLLCKINQISSLRSLNNYKKAEQIFKKLLDMDEYKNYLEFGFVLRLAGTIYDSKKALPFVIESIEHFHNHNALIQELHSRIELSVIHIYNEEFELAQEQLEITSKISQKNFIESYIITNNLAIVNLYQNKDIENTYTMLKRCLSMVQTPFDKLALHINLLISANCLNLDKELILNLCATIDELCLLDNISDKEIKRISYLNLMLSCKKIGNDEQLDIYKRRFEHIIVQSNKYELDTKFKMLINNELGLSMQENCVGHFITCELSHWSIEFDNILNNFE
>CP032824.1|AYJ81174.1|51941_52880_+|site-specific-tyrosine-recombinase,-phage-integrase-family
MKIDKLLQDFLFHCKFEKNLNPKTIAAYTMDIEQFKTFKDIQSMCINEVDKDILKEYIQHLYTLELKPKSIKRKLATLKAFFTHLEFDEIITISPFRKMRVSIKEQKLLPKTIEIQNIRKLFKYIYKIKSDSNNIEQYSYKALTRDIAILELLFATGLRVSEVSNIKYNDINLSTGNIKVLGKGGKERTIQICDQEVKIALKEYLSIFKDEILKKEWFFINRLGNKFTEHSIANMIKKYQTKANIQQHLTPHMFRHSFATMLLEEGVDIRYIQGMLGHSSISTTQIYTQINMKQQRKLLSTKHPRRNFQFLS
>CP032824.1|AYJ81173.1|50516_51725_+|site-specific-tyrosine-recombinase,-phage-integrase-family
MVKKNQYELIENSVIDDGAFLLEPYDDWKENIAFWIAQYLSQKCDEQSRRFVTEYNIPKIISIKEAILNSKDIEAIGKYVNELGVLKFKAIKQYYNNIYPFYHYMLERKAYSIKNITTTLLANYFSNTEEKQKKDLAAEKIIKVDIPKNIKNIWELSYASKINRLTVLLNFIKFIENSNIDKESENEVFLFDIERSKISKSIQKEKRVLSVLTPKDGFQKFFNAIELVQYKDEVRERNILMLKLLMYLGIRVSELVYLKKDDITIDKNIVKFNIIGKGNKQRLLYVTYSHIKKHMIKYEKIRTESPDGFYFTTNKGKQVNDRYINTIVHNTLVAAQIEVTKKSSVHMLRHSVASYLKHTLKMDNASISKWLGHEDIRTTMIYLHYTEQEIIDMAKSFKKIGN
>CP032824.1|AYJ81172.1|49785_49998_+|hypothetical-protein
MVFNVKDNNYEPINFYELDSDYHDNIRVINNDRMKTKIFEVSGLKLIRIRPKNNESPNIEQVIKAIEDIK
>CP032824.1|AYJ81171.1|49386_49539_+|hypothetical-protein
MNKNIDFTIEELYVLLQNKSWNNLEMAYNYAKNWEELNIAKEIIFEYKKK
>CP032824.1|AYJ81181.1|63838_64957_-|putative-membrane-protein
MKSLIIKIAILTAIMFGLSGCAHKKVYNGDPSIYLKNNSKTKVYYKDFSEDLALKATKKLVEDLNGSAGIISLNLFTITNPNEVSSFRDAKYTVAKNDLGKKVEGGKFKLSSDGTKIIFEKQYNNLVSRLEEYQNIANYISFPIISGDIKDFASVVNKRDTYLTTKVHVDQENSDMQELIFFTRYSGLHNLVKNDIKKQIELGGWEMVDSPEKADKEIYFELSRDYDPVELRYLAALKKGIKFSSLESDTNKFKFYENQGYNGDHIVIGQSAMDLASASNGNVVSAVIGLTVAGVFSLLSDKPKKEENKPKKQEVSGSFVSLRVIDKVKKTDNVKIYDTFFDNVKADTKKDLLRKINETINIDPDSKEYNIN
>CP032824.1|AYJ81182.1|65010_65403_-|hypothetical-protein
MKNKLINLLFLTTLSITFIGCYDDQDKKEIVKIRESLDEIKQELIQTKTTLNEIKNQQKPIKVELPSQETLDYFVKVYKLSTEEKPSAEFIKYYEKDGRTYVIIQVNNKVCDLPLLKTSNGWTANGVSCK
>CP032824.1|AYJ81183.1|65392_65611_-|putative-membrane-protein
MGMPSGISLFIISLFMIMPLVMLVNVAISEFKDNINKIVWIIIILVLYPIGWILYLIFGRKQRVKKGENSEK
>CP032824.1|AYJ81184.1|65646_65922_-|hypothetical-protein
MKMKNLKILLSTILIGAAFIGCSSTPDEKTVKSLAALYNIKSAKENDIKIVKSFEKDGKLVYILQIKGMICEMPMIEIDKQWNAIGMKCGG
>CP032824.1|AYJ81185.1|65932_66481_-|hypothetical-protein
MKRILLLSSSVALATLLFTGCGIKTTEYNPSADNVQTLRDFKDLKLNVSNFTSTNKGESSVLCRLAETVSTPKGEPFSTYIENALLSELKMAGNYDKNSNINLSGNINKVYGSSMFGNAYWEINATINSSNGKSLTVNTKRDYPSAYLASTACNNMGTSFEPTVNQLVSDILNHKDFPELIK
>CP032824.1|AYJ81186.1|66584_66836_+|transcriptional-regulator,-XRE-family
MEVDFSNSSKEEIEFFYKKISTNIKKYRLEKGLSQEKLALDIGVKSIAFYSNCESNRYQKHFNLEHLYKISKSLNINIEDLFK
>CP032824.1|AYJ81187.1|66891_67077_-|hypothetical-protein
MKNYILIILFLIIPSIILFFSNINDSKEAAIFLFIGGLVVSFLNYKKDKDERVMRFLNKWL
>CP032824.1|AYJ81188.1|67086_67449_-|putative-membrane-protein
MQITVIIFLTLITLFELKIYKSNIKSLKSYIGYYKFIKSNKNIKFKKDEKISIINSKNKIVKTSSNSFVVSIAIFIFILYLNISLLVNILLILIFIFSILKYIKIKKYGNYVYNYYKNQL
>CP032824.1|AYJ81189.1|67461_67743_-|putative-membrane-protein
MIPRGFFYKYMFLFLICFLKGKLLLWVFIFYIATAFYYNSNDGTVLVSFMAILFFLFGIKFYLEDNLKEELYRYKKYLVLKRKRANKIKVVNK
>CP032824.1|AYJ81190.1|67747_68035_-|hypothetical-protein
MNQNRLDKYSKTNEKIVPWTLFIIFLISIPILYILSIEKVRFDITNDFNSNKTIICKIHDIKIEVSKDDGWIIDDSYKFVKGPTRLIISRCETKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP032824_1	1.1\|62073\|30\|CP032824\|CRISPRCasFinder	62073-62102	30	NZ_CP032824	Arcobacter cryaerophilus ATCC 43158 plasmid pACRY43158, complete sequence	62073-62102	0	1.0
CP032824_1	1.1\|62073\|30\|CP032824\|CRISPRCasFinder	62073-62102	30	NZ_MK715471	Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence	10127-10156	0	1.0

1. spacer 1.1|62073|30|CP032824|CRISPRCasFinder matches to NZ_CP032824 (Arcobacter cryaerophilus ATCC 43158 plasmid pACRY43158, complete sequence) position: , mismatch: 0, identity: 1.0

attaaatactagtatagcaattgcaatatg	CRISPR spacer
attaaatactagtatagcaattgcaatatg	Protospacer
******************************

2. spacer 1.1|62073|30|CP032824|CRISPRCasFinder matches to NZ_MK715471 (Arcobacter cryaerophilus strain M830MA plasmid pM830MA, complete sequence) position: , mismatch: 0, identity: 1.0

attaaatactagtatagcaattgcaatatg	CRISPR spacer
attaaatactagtatagcaattgcaatatg	Protospacer
******************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP032823

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP032824

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection