CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032862	Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence	1 crisprs	NA	0	1	0	0
CP032861	Bacillus subtilis subsp. subtilis strain N1-1 chromosome, complete genome	0 crisprs	DinG,cas3,csa3,WYL,DEDDh	0	0	13	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032862_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032862_1

1815-1983

Orphan

Consensus_repeat	Method
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032862_1

>merge|CP032862|1|1815-1983|CRISPRCasFinder
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGGTGCGACTTGTCGTGATGTGGCAGCTGAAGAAAGAGATCGATGCCAGGCATCCAGGAGCGAACCAGCTGCAGCTGAAGAAAAGATGCTGCCGGTACCGGAAACCAGGAAGCCAGG

>CP032862|1|1|1815-1983|CRISPRCasFinder
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGG	TGCGACTTGTCGTGATGTGGCAGCTGAAGAAAGAGATCGATGCCAGGCATCCAGGAGCG
AACCAGCTGCAGCTGAAGAAAAGATGCTGCCGGTACCGGAAACCAGGAAGCCAGG

Protein	Signature genes	Signature genes Name	Protein_function
CP032862.1\|AYK89015.1\|9525_10044_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375153
CP032862.1\|AYK89016.1\|10427_11600_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240271
CP032862.1\|AYK89004.1\|407_743_+\|hypothetical-protein	unknown	unknown	unknown
CP032862.1\|AYK89007.1\|2111_2738_-\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|377417
CP032862.1\|AYK89011.1\|4475_5651_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212669
CP032862.1\|AYK89005.1\|779_1397_-\|hypothetical-protein	unknown	unknown	unknown
CP032862.1\|AYK89009.1\|3495_3768_+\|hypothetical-protein	unknown	unknown	unknown
CP032862.1\|AYK89013.1\|7036_8143_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
CP032862.1\|AYK89012.1\|6316_6565_+\|hypothetical-protein	unknown	unknown	unknown
CP032862.1\|AYK89008.1\|2770_3160_-\|hypothetical-protein	unknown	unknown	unknown
CP032862.1\|AYK89014.1\|8444_8930_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
CP032862.1\|AYK89010.1\|4060_4465_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP032862.1\|AYK89015.1\|9525_10044_+\|hypothetical-protein	gnl\|CDD\|375153	pfam17362, pXO2-34, Family of unknown function. This is a family of unknown function found in Bacilli.	0.00149194
CP032862.1\|AYK89013.1\|7036_8143_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.62343e-11
CP032862.1\|AYK89016.1\|10427_11600_+\|hypothetical-protein	gnl\|CDD\|240271	PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional.	1.08138e-09
CP032862.1\|AYK89014.1\|8444_8930_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.84971e-09
CP032862.1\|AYK89011.1\|4475_5651_-\|hypothetical-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	1.37571e-19
CP032862.1\|AYK89007.1\|2111_2738_-\|VanZ-family-protein	gnl\|CDD\|377417	pfam04892, VanZ, VanZ like family. This family contains several examples of the VanZ protein, but also contains examples of phosphotransbutyrylases.	5.85001e-26

>CP032862.1|AYK89005.1|779_1397_-|hypothetical-protein
MKANFKYWSIAAVLGISLFDFMGTSKVEAAEVKESLPIEEKILSQDEIEAKKEEIASQIKIFDENNKEIHPYTTEQLKSMIRLTEEQPTDNPIKVLKKTYSSGYFDFYYNIWLGKGTYGKTFKDPSTLIVTYKGTARKFSVSAFYDDGRGGAKGRAQKVTLPGGWKGQFHMNWNLKKGKSYHIKFENEGNTDKLITINQATLWYN
>CP032862.1|AYK89004.1|407_743_+|hypothetical-protein
MKKKFIGFLVLASFLLMFNTASYASGTDENTEKSTAELLESVMDDFGLFSFQIGRTDPTITIGMDQTKSESKLREYLDDNLSEEAKKKYEIYIFKEDIDKLKQEHQKSLQE
>CP032862.1|AYK89007.1|2111_2738_-|VanZ-family-protein
MLLNSFIIPYVVYAYVLFVVYRLFAVFVQKKPRYTIEKSIYILATFVYLTGVICMTLFPIPTDPLLIHDRAAEGFQETNNLIPFNTMKDALTGSSLSVTVYQLGGNIILLFPLGCFLPLLFNRMRQAKRVIIAGFIASLIIETSQFTISSAIGLTYRSFDVDDLILNTLGSALGYLFYKFVYPMVRQELFEVDSTNKTSRKQKVRKHI
>CP032862.1|AYK89008.1|2770_3160_-|hypothetical-protein
MKKIKKVLVSSALSFTLLLPVTAPAALAASKHDFWFEFKHQVTSKTYSRGASNIKIYTHADTGGSGGTFNIELYRKQKKGKAKYLGSKKFSQNGSTTNSYGNKTKGKFYFIMKKKNNGASTGGYGDIYN
>CP032862.1|AYK89009.1|3495_3768_+|hypothetical-protein
MKKKTTNQVEERKVRSDKKTRVNPSLDANTHEKLKKLAISCDMTKTQLAAEILKMALNNESVIDWYQKKYNKDDSYRIILARINGELHYS
>CP032862.1|AYK89010.1|4060_4465_-|hypothetical-protein
MGKNKRIPLFNVRTTQMSDEMYDFVLEQISTFSKGKSKGTFREYAFQLIERDMQQQKEEQQNREKDRHVHDELIAMREEMKKEFRDLRKKIDQGSIYVEHKTADPKSASETIEEGQLITEKITGTIEEEYDYDF
>CP032862.1|AYK89011.1|4475_5651_-|hypothetical-protein
MNISRMNVDFGNSMYMNLIDGYFFELPTNVVEISKEAAEGKFTSIVEDPADLKDRLLVSTVIDETERYFLVGELAEPEVLGNQHIKKLHNKVESHIPYVTFLAATAYYQALKGKREDNEVTIEYFQTMLPIWLLKKLDKFSEMQKRMASKFLGTHQVKVLTLGLEKELTIKVEDAACRIESEVARWAIKKNFDLEDKDYAEQFKNYDVVFCDLGGGTDDLVLLPAGLKPPKSRDSFVSNTEAPFLAHLEKLRKEKLLEHFDSVRELEKFIYSNIGKTKMERRDGNTGQKFDLTDIIKKSLKEYTEIKIAQAENTFPAPKDKVYKYLYFGGVGEVLEESISVVTEERYGRDISESNHIVAEDARLLNLYGLEVLSRAEQVKKQANEKEAQSI
>CP032862.1|AYK89012.1|6316_6565_+|hypothetical-protein
MARTAINGPENVDKPLGCLAHYGAGNYGQASMQRHTIECDRVREHETNPIEVAYRTSIVCKKVMAGESLAIARQSWKPQTSL
>CP032862.1|AYK89013.1|7036_8143_+|tetratricopeptide-repeat-protein
MLSKVKKVPSPYVGNLLNKWHDYIMQEKVHESIEKRTEIKQLLSQAEDNKDLVDYFILLDHRHSLCFDQEASMGDVVNMLSKGSHDLLINFYFELFAGDYEFFKKNYVKAISFYEKAEQKLSSIPNIEETKFAEFHYKIGVAYYEIDQHLVSVNKVTKARDIYKKSDMWNLEAIQCSLVVGINLYDMGRLDDADAYFRDALTEALDHGYDKPITKIYHNLGLVHWQKGSLELALHYFREAYSHEWLRDSPKGQQTVYMLSRVLYTMGQNEEAYHWYELGIEMARKFDDHEYKAKHDILYHLYEQPSIDEVKQSLAFLEERNLWPDVSKIAKGISELYEKKGDLVTSHEFLKRAFYAKEQIQRITEALG
>CP032862.1|AYK89014.1|8444_8930_-|XRE-family-transcriptional-regulator
MGNREQFDLSKYLLEKRKQKGLSQTQVANDTGLSSAYISMLEKGERKRPTQAVIKKLATALSIPNIEMLQIMEYIASMEEDHVKEKDKDTSKQIKLFDLTGLTEASINQIQNQIDQLKSSENNSVIRFFDVTGLSEKDIERVKEEIELLKIRNEYMKLKKD
>CP032862.1|AYK89015.1|9525_10044_+|hypothetical-protein
MAKVKLLEKKMTEKDVLEYGSSLRLFDGSTHVLIGKDCLHTHTKNKRPISQCYSDIRNVKNVEGVIVGKRVSPHSSLLFTTEAFQPARKVTQVYKAPKMPRRSTQVRPRNTSGRAKKVSVLLSETGYANVHQLKQVLLDAGAKKVQTYNTSRGIAIVCHPNPNYLLQKVISE
>CP032862.1|AYK89016.1|10427_11600_+|hypothetical-protein
MRKKLAAGIVAGAIILGVPGYTIFHSYQANAEEARVLDNATDAVNSLYASKKYNYLADGVSKNDIQKAQKLVSDVADSKKQKSLAEKASNAAIMLEASNAVKEDIVDGVIVDDLTKSILSVTKESVDKVKPISKDLYKDLSKDLSKAYDQIEQIDKTKKLLKDAKKDWNSYKKIEKEVNKISNQTAKKSLKKQLETLKKRIEDQESISKKAKEKLNEIEKTSQKDSDSKAANDSSQVSTNDNENATSSAASSNTSATQNKSGSSSNSSSSSGSSNSGYSSYSNGSSKSSSNTKSYSNSSSSRSYTSKSNSGSTSHSESKKSRTGSSSAGSSNKSSSSKSSSSTSKSKQSQNNTMKNANDFVNDFNSGNYNHVGSGNNGTGNNYDVYERGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP018185	Bacillus subtilis strain KH2 plasmid, complete sequence	60755-60813	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP017764	Bacillus subtilis strain 29R7-12 plasmid unnamed1, complete sequence	37952-38010	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP032868	Bacillus subtilis subsp. subtilis strain N4-2 plasmid unnamed1, complete sequence	33414-33472	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP032864	Bacillus subtilis subsp. subtilis strain N2-2 plasmid unnamed1, complete sequence	47417-47475	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP032866	Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence	31651-31709	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP021893	Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence	5175-5233	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP021893	Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence	71103-71161	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP041370	Bacillus sp. M4U3P1 plasmid unnamed1, complete sequence	57654-57712	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	20251-20309	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	84850-84908	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP032862	Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence	1870-1928	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NC_015148	Bacillus subtilis subsp. natto plasmid pLS20 DNA, complete sequence, strain: IFO 3335	60682-60740	1.0
CP032862_1	1.1\|1870\|59\|CP032862\|CRISPRCasFinder	1870-1928	59	NZ_CP014473	Bacillus subtilis subsp. natto strain CGMCC 2108 plasmid unnamed2, complete sequence	60682-60740	1.0

1. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP018185 (Bacillus subtilis strain KH2 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

2. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP017764 (Bacillus subtilis strain 29R7-12 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

3. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP032868 (Bacillus subtilis subsp. subtilis strain N4-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

4. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP032864 (Bacillus subtilis subsp. subtilis strain N2-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

5. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP032866 (Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

6. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP021893 (Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

7. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP021893 (Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

8. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP041370 (Bacillus sp. M4U3P1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

9. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP020024 (Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

10. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP020024 (Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

11. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP032862 (Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

12. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NC_015148 (Bacillus subtilis subsp. natto plasmid pLS20 DNA, complete sequence, strain: IFO 3335) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

13. spacer 1.1|1870|59|CP032862|CRISPRCasFinder matches to NZ_CP014473 (Bacillus subtilis subsp. natto strain CGMCC 2108 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

309922 : 316017

Staphylococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK85299.1\|309922_311008_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1
AYK85300.1\|311018_311666_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
AYK85301.1\|311680_312877_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
AYK85302.1\|312909_313374_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
AYK85303.1\|313486_313861_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK85304.1\|313874_314399_-	DUF309 domain-containing protein	NA	NA	NA	NA
AYK88862.1\|314678_315434_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
AYK85305.1\|315423_316017_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4

DBSCAN-SWA_2

528452 : 539142

Bacillus_phage(75.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK85532.1\|528452_529889_-	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.6e-07	30.6
AYK85533.1\|530016_530574_+	SMI1/KNR4 family protein	O64022	Bacillus_phage	7.0e-102	95.7
AYK85534.1\|530672_532475_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.3e-218	87.0
AYK85535.1\|532484_532943_+	antitoxin YobK	NA	NA	NA	NA
AYK85536.1\|533035_533494_+	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	2.8e-72	85.5
AYK85537.1\|533549_534104_+	SMI1/KNR4 family protein	O64025	Bacillus_phage	4.3e-96	91.3
AYK85538.1\|534163_534697_+	N-acetyltransferase	O64026	Bacillus_phage	2.9e-97	97.2
AYK85539.1\|534985_535069_-\|holin	putative holin-like toxin	NA	NA	NA	NA
AYK85540.1\|535328_535688_+	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
AYK85541.1\|537894_539142_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6

DBSCAN-SWA_3

632197 : 708243

Bacillus_phage(54.35%)

head,portal,plate,tail,holin,terminase,integrase,protease,coat,capsid,transposase

attL 665786:665801|attR 709632:709647

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK85618.1\|632197_633550_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
AYK85619.1\|633711_634110_-	hypothetical protein	NA	NA	NA	NA
AYK85620.1\|634363_634552_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
AYK85621.1\|634726_634927_+\|coat	spore coat protein CotC	NA	NA	NA	NA
AYK85622.1\|635172_635529_+	hypothetical protein	NA	NA	NA	NA
AYK85623.1\|635688_636408_+	hypothetical protein	NA	NA	NA	NA
AYK85624.1\|636450_636738_+	hypothetical protein	NA	NA	NA	NA
AYK85625.1\|636860_637700_-	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
AYK85626.1\|637974_638139_-	hypothetical protein	NA	NA	NA	NA
AYK85627.1\|638269_638494_-	hypothetical protein	NA	NA	NA	NA
AYK85628.1\|638545_638809_+	hypothetical protein	NA	NA	NA	NA
AYK85629.1\|639409_639844_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
AYK85630.1\|640762_641188_+	endonuclease	NA	NA	NA	NA
AYK85631.1\|641598_642783_+	alanine racemase 2	NA	NA	NA	NA
AYK85632.1\|642884_644300_-	sugar porter family MFS transporter	NA	NA	NA	NA
AYK85633.1\|644712_645348_+	thermonuclease family protein	A0A1P8CWK6	Bacillus_phage	2.2e-72	68.5
AYK85634.1\|645477_646725_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AYK85635.1\|647208_648123_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
AYK85636.1\|648119_648437_-\|transposase	transposase	NA	NA	NA	NA
AYK85637.1\|648618_650118_-	xylulokinase	NA	NA	NA	NA
AYK85638.1\|650268_651606_-	xylose isomerase	NA	NA	NA	NA
AYK85639.1\|651843_652998_+	ROK family protein	NA	NA	NA	NA
AYK85640.1\|653135_654737_-	glycoside hydrolase family 43 protein	NA	NA	NA	NA
AYK85641.1\|654875_655790_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
AYK85642.1\|655786_656104_-\|transposase	transposase	NA	NA	NA	NA
AYK85643.1\|656176_657568_-	MFS transporter	NA	NA	NA	NA
AYK85644.1\|658364_658835_-	hypothetical protein	NA	NA	NA	NA
AYK85645.1\|658974_659139_-	hypothetical protein	NA	NA	NA	NA
AYK85646.1\|660650_660881_-	XRE family transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
AYK85647.1\|661422_661803_-	hypothetical protein	NA	NA	NA	NA
AYK85648.1\|661880_662780_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYK85649.1\|662776_663931_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.4e-24	22.6
AYK88876.1\|664092_665640_+\|transposase	IS21 family transposase	NA	NA	NA	NA
AYK85650.1\|665636_666395_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
665786:665801	attL	NA	NA	NA	NA
AYK88877.1\|667437_667872_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AYK85651.1\|668055_668307_-	hypothetical protein	NA	NA	NA	NA
AYK85652.1\|668605_669457_-	toxin	O64021	Bacillus_phage	1.4e-85	60.3
AYK85653.1\|669637_670129_-	hypothetical protein	NA	NA	NA	NA
AYK85654.1\|670367_670658_-	hypothetical protein	NA	NA	NA	NA
AYK85655.1\|671254_671455_+	hypothetical protein	NA	NA	NA	NA
AYK85656.1\|671491_672577_+	DUF4917 family protein	NA	NA	NA	NA
AYK88878.1\|672592_672664_-	hypothetical protein	NA	NA	NA	NA
AYK85657.1\|672833_674597_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.3e-121	52.3
AYK85658.1\|674615_675080_+	SMI1/KNR4 family protein	NA	NA	NA	NA
AYK85659.1\|675125_676103_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.0e-64	71.4
AYK85660.1\|676158_676422_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
AYK85661.1\|676436_676649_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
AYK85662.1\|676700_676871_-	XkdX family protein	NA	NA	NA	NA
AYK85663.1\|676867_677167_-	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
AYK85664.1\|677182_678304_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.8e-196	92.5
AYK85665.1\|679928_681803_-	autolysin	D6R400	Bacillus_phage	5.5e-50	27.8
AYK85666.1\|681816_682650_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
AYK85667.1\|682662_686403_-	hypothetical protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
AYK85668.1\|686465_686648_-	hypothetical protein	NA	NA	NA	NA
AYK85669.1\|686659_687022_-	hypothetical protein	NA	NA	NA	NA
AYK85670.1\|687081_687666_-\|tail	major tail protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
AYK85671.1\|687671_688079_-	hypothetical protein	NA	NA	NA	NA
AYK85672.1\|688075_688468_-\|tail	phage tail protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
AYK85673.1\|688467_688794_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AYK85674.1\|688783_689077_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
AYK85675.1\|689131_689515_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
AYK85676.1\|689542_690751_-\|capsid	phage major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	4.9e-76	49.8
AYK85677.1\|690798_691395_-\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	3.3e-49	53.8
AYK85678.1\|691387_692614_-\|portal	phage portal protein	A0A1J0MFU3	Staphylococcus_phage	2.4e-70	39.4
AYK85679.1\|692618_692825_-	hypothetical protein	NA	NA	NA	NA
AYK85680.1\|692841_694575_-\|terminase	terminase large subunit	A0A2H4JCI4	uncultured_Caudovirales_phage	2.1e-144	48.9
AYK85681.1\|694564_695050_-\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	4.2e-18	36.0
AYK85682.1\|695288_695495_-	hypothetical protein	NA	NA	NA	NA
AYK88879.1\|695497_695881_-	HNH endonuclease	A0A075M5R4	Enterococcus_phage	1.2e-17	43.3
AYK88880.1\|696252_696666_-	ArpU family transcriptional regulator	D6R428	Bacillus_phage	2.1e-63	97.0
AYK85683.1\|696919_697435_-	hypothetical protein	D6R425	Bacillus_phage	8.7e-91	93.0
AYK85684.1\|697469_698009_-	nuclease	Q9ZXC2	Bacillus_phage	1.8e-94	96.1
AYK85685.1\|698005_698443_-	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
AYK85686.1\|698642_701060_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	88.7
AYK85687.1\|701120_701558_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.3e-79	97.2
AYK85688.1\|701578_701893_-	hypothetical protein	Q9ZXC6	Bacillus_phage	1.5e-53	99.0
AYK85689.1\|701882_702818_-	hypothetical protein	Q9ZXC7	Bacillus_phage	2.0e-170	96.5
AYK85690.1\|702821_703376_-	hypothetical protein	Q9ZXC8	Bacillus_phage	3.1e-94	96.2
AYK85691.1\|703571_703847_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-19	47.1
AYK88881.1\|703843_704035_-	hypothetical protein	Q9ZXD0	Bacillus_phage	7.1e-06	53.1
AYK85692.1\|704095_704407_-	DNA-binding protein	NA	NA	NA	NA
AYK85693.1\|704422_705187_-	Rha family transcriptional regulator	A8ATN0	Listeria_phage	1.0e-47	49.1
AYK85694.1\|705301_705520_-	XRE family transcriptional regulator	A0A0K2CZL1	Paenibacillus_phage	2.1e-17	63.2
AYK85695.1\|705644_706031_+	XRE family transcriptional regulator	R9W020	Paenibacillus_phage	9.0e-08	31.4
AYK85696.1\|706014_707070_+	ImmA/IrrE family metallo-endopeptidase	A0A0F6N3H6	Staphylococcus_phage	1.7e-08	24.2
AYK85697.1\|707085_708243_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	8.3e-65	38.9
709632:709647	attR	NA	NA	NA	NA

DBSCAN-SWA_4

712943 : 719515

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK85702.1\|712943_713912_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
AYK85703.1\|714552_715320_+	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
AYK85704.1\|715383_716004_-	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
AYK85705.1\|716053_717043_-	ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
AYK85706.1\|717060_719163_-	ribonucleotide-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
AYK85707.1\|719122_719515_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3

DBSCAN-SWA_5

1130869 : 1204495

uncultured_Caudovirales_phage(24.39%)

terminase,portal,plate,holin,tail,protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK86111.1\|1130869_1131829_+\|protease	serine protease	A0A127AWU5	Bacillus_phage	5.6e-75	49.5
AYK86112.1\|1132244_1134533_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
AYK86113.1\|1134707_1135178_+\|tRNA	tRNA-specific adenosine deaminase	S4VYZ2	Pandoravirus	1.8e-26	45.8
AYK86114.1\|1135425_1135836_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
AYK86115.1\|1135977_1136421_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK86116.1\|1136451_1136877_-	organic hydroperoxide resistance protein OhrA	NA	NA	NA	NA
AYK86117.1\|1137002_1138250_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	4.2e-99	50.1
AYK86118.1\|1138261_1139359_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.3e-71	42.1
AYK86119.1\|1139709_1140612_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AYK86120.1\|1140682_1141000_-	multidrug efflux SMR transporter subunit YkkD	NA	NA	NA	NA
AYK86121.1\|1140999_1141338_-	multidrug resistance protein YkkC	NA	NA	NA	NA
AYK86122.1\|1141559_1142078_-	N-acetyltransferase	NA	NA	NA	NA
AYK86123.1\|1142067_1142595_-	DinB family protein	NA	NA	NA	NA
AYK86124.1\|1142686_1143418_-	DUF421 domain-containing protein	NA	NA	NA	NA
AYK86125.1\|1143566_1143791_+	hypothetical protein	NA	NA	NA	NA
AYK86126.1\|1143867_1145067_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
AYK88893.1\|1145304_1145823_-	acyl-CoA thioesterase	NA	NA	NA	NA
AYK86127.1\|1146931_1147981_+	6-phosphogluconolactonase	NA	NA	NA	NA
AYK86128.1\|1148023_1149013_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.2e-17	33.5
AYK86129.1\|1149025_1149916_-	NlpC/P60 family protein	A0A0A8WIF2	Clostridium_phage	5.3e-19	45.8
AYK86130.1\|1149932_1151012_-	dipeptide epimerase	NA	NA	NA	NA
AYK86131.1\|1151008_1151968_-	LD-carboxypeptidase	NA	NA	NA	NA
AYK88894.1\|1152055_1153705_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK86132.1\|1153707_1154715_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-15	28.7
AYK86133.1\|1154719_1155682_-	ABC transporter permease	NA	NA	NA	NA
AYK86134.1\|1155687_1156614_-	ABC transporter permease	NA	NA	NA	NA
AYK86135.1\|1156630_1157455_-	aminopeptidase	NA	NA	NA	NA
AYK86136.1\|1157584_1158403_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AYK86137.1\|1158571_1159921_+\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	3.4e-25	34.1
AYK86138.1\|1160420_1161392_-	glycosyltransferase	I1TED8	Salmonella_phage	2.5e-62	41.3
AYK88895.1\|1161403_1163554_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
AYK86139.1\|1163770_1164721_-	ring-cleaving dioxygenase	NA	NA	NA	NA
AYK86140.1\|1165109_1166426_+	amino acid permease	NA	NA	NA	NA
AYK86141.1\|1166701_1167319_+	DUF47 domain-containing protein	NA	NA	NA	NA
AYK86142.1\|1167331_1168333_+	low-affinity inorganic phosphate transporter	NA	NA	NA	NA
AYK86143.1\|1168442_1169189_+	type II toxin-antitoxin system SpoIISA family toxin	NA	NA	NA	NA
AYK86144.1\|1169188_1169359_+	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
AYK86145.1\|1169444_1169582_+	hypothetical protein	NA	NA	NA	NA
AYK86146.1\|1170524_1170788_-\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
AYK86147.1\|1170800_1171070_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	64.8
AYK86148.1\|1171122_1171962_-\|portal	phage portal protein	NA	NA	NA	NA
AYK86149.1\|1172008_1172173_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
AYK86150.1\|1172169_1172499_-\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
AYK86151.1\|1172510_1174574_-\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
AYK86152.1\|1174576_1174849_-	hypothetical protein	NA	NA	NA	NA
AYK86153.1\|1174845_1175424_-	phage-like element PBSX protein XkdU	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
AYK86154.1\|1175407_1176454_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
AYK86155.1\|1176446_1176872_-	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
AYK86156.1\|1176929_1177196_-	phage-like element PBSX protein XkdR	S6C459	Thermus_phage	1.7e-05	36.4
AYK86157.1\|1177195_1178173_-	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
AYK86158.1\|1178188_1178848_-	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
AYK86159.1\|1183843_1183984_-	hypothetical protein	NA	NA	NA	NA
AYK86160.1\|1184025_1184472_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
AYK86161.1\|1184563_1185007_-	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
AYK86162.1\|1185008_1186409_-\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
AYK86163.1\|1186405_1186624_-	hypothetical protein	NA	NA	NA	NA
AYK86164.1\|1186627_1187068_-\|portal	phage portal protein	NA	NA	NA	NA
AYK86165.1\|1187080_1187566_-	phage-like element PBSX protein XkdI	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
AYK86166.1\|1187562_1187919_-	phage-like element PBSX protein XkdH	NA	NA	NA	NA
AYK86167.1\|1187915_1188299_-	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
AYK86168.1\|1188320_1189256_-	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
AYK86169.1\|1189281_1190109_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
AYK86170.1\|1190128_1191616_-	phage-like element PBSX protein XkdE	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
AYK86171.1\|1191619_1192921_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
AYK86172.1\|1192917_1193715_-\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
AYK86173.1\|1193830_1194340_-	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
AYK86174.1\|1194455_1194662_-	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
AYK86175.1\|1194658_1195009_-\|portal	phage portal protein	NA	NA	NA	NA
AYK86176.1\|1195093_1195261_-	hypothetical protein	NA	NA	NA	NA
AYK86177.1\|1195260_1196061_-	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
AYK86178.1\|1195960_1196797_-\|portal	phage portal protein	S6BFM4	Thermus_phage	6.7e-24	27.8
AYK86179.1\|1196783_1196963_-	hypothetical protein	NA	NA	NA	NA
AYK86180.1\|1197141_1197483_+	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
AYK86181.1\|1197645_1198242_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
AYK86182.1\|1198285_1199122_-	manganese catalase family protein	NA	NA	NA	NA
AYK86183.1\|1199198_1199801_-	hypothetical protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
AYK86184.1\|1199905_1200283_+	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
AYK86185.1\|1200322_1201276_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8
AYK86186.1\|1201673_1201808_-	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
AYK86187.1\|1201797_1202934_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
AYK86188.1\|1203345_1204495_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2

DBSCAN-SWA_6

1239204 : 1288745

Bacillus_phage(55.56%)

tRNA,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK86218.1\|1239204_1239438_+\|coat	spore coat protein	NA	NA	NA	NA
AYK86219.1\|1239570_1240551_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
AYK86220.1\|1240569_1240791_-	hypothetical protein	NA	NA	NA	NA
AYK86221.1\|1241099_1241429_+	DUF4306 domain-containing protein	NA	NA	NA	NA
AYK86222.1\|1241560_1241755_+	DUF4177 domain-containing protein	NA	NA	NA	NA
AYK86223.1\|1241794_1242274_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AYK86224.1\|1242502_1242898_+	hypothetical protein	NA	NA	NA	NA
AYK86225.1\|1243116_1243623_+	N-acetyltransferase	NA	NA	NA	NA
AYK86226.1\|1243753_1244965_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
AYK86227.1\|1245037_1245529_-	DUF2992 family protein	NA	NA	NA	NA
AYK86228.1\|1245698_1246646_-	mannose-6-phosphate isomerase ManA	NA	NA	NA	NA
AYK86229.1\|1248759_1250706_-	PRD domain-containing protein	NA	NA	NA	NA
AYK86230.1\|1251013_1251331_-	hypothetical protein	NA	NA	NA	NA
AYK86231.1\|1251445_1251763_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AYK86232.1\|1252195_1252387_+	hypothetical protein	NA	NA	NA	NA
AYK86233.1\|1252889_1253090_+	hypothetical protein	NA	NA	NA	NA
AYK86234.1\|1253218_1253734_+	hypothetical protein	NA	NA	NA	NA
AYK86235.1\|1254408_1255002_-	hypothetical protein	NA	NA	NA	NA
AYK86236.1\|1255857_1256250_-	hypothetical protein	NA	NA	NA	NA
AYK86237.1\|1256264_1256576_-	hypothetical protein	NA	NA	NA	NA
AYK86238.1\|1256713_1256953_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK86239.1\|1257327_1257615_+	hypothetical protein	NA	NA	NA	NA
AYK86240.1\|1257772_1258078_+	hypothetical protein	NA	NA	NA	NA
AYK86241.1\|1258121_1259369_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AYK86242.1\|1259501_1259960_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AYK86243.1\|1259962_1261738_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	5.8e-126	57.3
AYK86244.1\|1262085_1263201_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	2.4e-146	71.9
AYK86245.1\|1263558_1263786_+	hypothetical protein	NA	NA	NA	NA
AYK86246.1\|1263874_1264141_-	YgiT-type zinc finger protein	NA	NA	NA	NA
AYK86247.1\|1264181_1264769_-	hypothetical protein	NA	NA	NA	NA
AYK86248.1\|1267135_1267351_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK86249.1\|1267416_1268934_+	glycosyltransferase	NA	NA	NA	NA
AYK86250.1\|1270630_1271800_-	hypothetical protein	M4ZSB3	Bacillus_phage	2.0e-87	41.8
AYK88897.1\|1272739_1273015_-	XRE family transcriptional regulator	NA	NA	NA	NA
AYK86251.1\|1273180_1273552_+	helix-turn-helix domain-containing protein	A0A2H4J6F9	uncultured_Caudovirales_phage	5.1e-16	46.8
AYK86252.1\|1273914_1274436_+	hypothetical protein	NA	NA	NA	NA
AYK86253.1\|1274448_1274796_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.6e-18	67.6
AYK86254.1\|1276659_1276839_-	hypothetical protein	NA	NA	NA	NA
AYK86255.1\|1276833_1278024_+	DUF819 domain-containing protein	NA	NA	NA	NA
AYK86256.1\|1278093_1278639_+	N-acetyltransferase	NA	NA	NA	NA
AYK86257.1\|1278671_1279844_-	cystathionine beta-lyase MetC	NA	NA	NA	NA
AYK88898.1\|1279836_1280958_-	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	3.7e-17	26.3
AYK86258.1\|1281313_1282036_+	esterase family protein	NA	NA	NA	NA
AYK86259.1\|1282072_1282588_+	hypothetical protein	NA	NA	NA	NA
AYK86260.1\|1282591_1283014_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK86261.1\|1283086_1283341_-	hypothetical protein	NA	NA	NA	NA
AYK86262.1\|1283457_1285737_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	3.5e-91	34.9
AYK86263.1\|1285810_1286065_-	sporulation-specific transcription factor SpoVIF	NA	NA	NA	NA
AYK86264.1\|1286197_1286347_-	sporulation protein YjcZ	NA	NA	NA	NA
AYK86265.1\|1286428_1286635_-	hypothetical protein	NA	NA	NA	NA
AYK86266.1\|1286915_1287272_-	DUF1360 domain-containing protein	NA	NA	NA	NA
AYK86267.1\|1287431_1287818_+\|coat	spore coat protein	NA	NA	NA	NA
AYK86268.1\|1287857_1288178_+\|coat	spore coat protein	NA	NA	NA	NA
AYK86269.1\|1288262_1288745_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_7

1831352 : 1839718

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK86760.1\|1831352_1831940_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0
AYK86761.1\|1831936_1832977_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
AYK86762.1\|1833078_1834509_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
AYK86763.1\|1834484_1836713_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
AYK86764.1\|1836696_1837380_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AYK86765.1\|1837376_1837631_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AYK86766.1\|1837623_1838349_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
AYK86767.1\|1838422_1839718_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7

DBSCAN-SWA_8

2562263 : 2669666

103

Bacillus_phage(28.0%)

holin,protease,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK87404.1\|2562263_2563388_+\|transposase	IS4 family transposase IS4Bsu1	NA	NA	NA	NA
AYK87405.1\|2563658_2564111_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK87406.1\|2565350_2566190_-	pentapeptide repeat-containing protein	NA	NA	NA	NA
AYK87407.1\|2566335_2566725_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AYK87408.1\|2566792_2567581_+	hypothetical protein	NA	NA	NA	NA
AYK87409.1\|2567618_2568353_-	MerR family transcriptional regulator	NA	NA	NA	NA
AYK87410.1\|2568513_2569824_-	MFS transporter	NA	NA	NA	NA
AYK87411.1\|2569924_2570245_+	hypothetical protein	NA	NA	NA	NA
AYK87412.1\|2570256_2570703_+	hypothetical protein	NA	NA	NA	NA
AYK87413.1\|2570735_2571665_-	manganese-dependent inorganic pyrophosphatase	NA	NA	NA	NA
AYK87414.1\|2571870_2572248_+	HxlR family transcriptional regulator	NA	NA	NA	NA
AYK87415.1\|2572907_2573057_+	hypothetical protein	NA	NA	NA	NA
AYK87416.1\|2573281_2574211_+	DUF2232 domain-containing protein	NA	NA	NA	NA
AYK87417.1\|2574247_2576227_+	DHH family phosphoesterase	NA	NA	NA	NA
AYK87418.1\|2576223_2576673_+	50S ribosomal protein L9	NA	NA	NA	NA
AYK87419.1\|2576709_2578767_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
AYK87420.1\|2578872_2580081_-	MFS transporter	NA	NA	NA	NA
AYK87421.1\|2580153_2580294_-	YycC family protein	NA	NA	NA	NA
AYK87422.1\|2580414_2580618_+	hypothetical protein	NA	NA	NA	NA
AYK87423.1\|2580665_2580866_-	DUF2188 domain-containing protein	NA	NA	NA	NA
AYK87424.1\|2581035_2582400_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	3.6e-128	54.8
AYK87425.1\|2582519_2582939_+	VOC family protein	NA	NA	NA	NA
AYK88941.1\|2585466_2586174_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.4e-45	41.2
AYK87426.1\|2586181_2588017_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.4e-36	33.5
AYK88942.1\|2588006_2589374_+	hypothetical protein	NA	NA	NA	NA
AYK87427.1\|2589360_2590203_+	two-component system YycFG regulatory protein	NA	NA	NA	NA
AYK87428.1\|2590224_2591019_+	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	9.8e-41	35.6
AYK87429.1\|2591100_2592303_+\|protease	serine protease	W5SAB9	Pithovirus	5.9e-13	40.4
AYK87430.1\|2592617_2594003_-	arginine utilization regulatory protein RocR	NA	NA	NA	NA
AYK88943.1\|2594229_2594514_+	ArsR family transcriptional regulator	A0A218MNF3	uncultured_virus	2.8e-06	41.3
AYK88944.1\|2594513_2595149_+	SdpI family protein	NA	NA	NA	NA
AYK87431.1\|2595332_2595887_+	SdpA family antimicrobial peptide system protein	NA	NA	NA	NA
AYK87432.1\|2595871_2596825_+	hypothetical protein	NA	NA	NA	NA
AYK87433.1\|2596886_2597489_+	sporulation delaying protein family toxin	NA	NA	NA	NA
AYK87434.1\|2597820_2599026_+	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.0e-29	28.5
AYK87435.1\|2599248_2600652_+	amino-acid permease RocE	NA	NA	NA	NA
AYK87436.1\|2600724_2601615_+	arginase	A0A1V0SJM8	Klosneuvirus	2.0e-26	29.1
AYK87437.1\|2601851_2601968_-	phosphatase RapG inhibitor	NA	NA	NA	NA
AYK87438.1\|2601968_2603066_-	transcriptional regulator	D6R410	Bacillus_phage	6.0e-73	39.3
AYK87439.1\|2603176_2603647_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK87440.1\|2603788_2604526_+	hypothetical protein	NA	NA	NA	NA
AYK87441.1\|2604536_2605694_+	hypothetical protein	NA	NA	NA	NA
AYK87442.1\|2605709_2605958_+	DUF2651 domain-containing protein	NA	NA	NA	NA
AYK87443.1\|2606062_2606233_+	hypothetical protein	NA	NA	NA	NA
AYK87444.1\|2606295_2607522_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.1e-11	29.3
AYK87445.1\|2607555_2607969_-	hypothetical protein	NA	NA	NA	NA
AYK87446.1\|2608153_2608324_+	CxxH/CxxC protein	NA	NA	NA	NA
AYK87447.1\|2608404_2608884_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AYK87448.1\|2609171_2610080_+	hypothetical protein	NA	NA	NA	NA
AYK87449.1\|2610036_2612871_+	DEAD/DEAH box helicase	A7WKM3	Acidianus_filamentous_virus	6.0e-08	26.4
AYK87450.1\|2612957_2613158_+	hypothetical protein	NA	NA	NA	NA
AYK87451.1\|2613422_2613740_+\|transposase	transposase	NA	NA	NA	NA
AYK87452.1\|2613736_2614651_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
AYK88945.1\|2615034_2615298_+	hypothetical protein	NA	NA	NA	NA
AYK87453.1\|2615996_2616275_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	7.3e-44	100.0
AYK87454.1\|2616259_2616706_+	hypothetical protein	A0A1P8CWQ3	Bacillus_phage	3.2e-57	97.5
AYK87455.1\|2616786_2617701_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
AYK87456.1\|2617697_2618015_-\|transposase	transposase	NA	NA	NA	NA
AYK87457.1\|2619072_2621106_+	DUF2813 domain-containing protein	NA	NA	NA	NA
AYK87458.1\|2621086_2622970_+	ATP-dependent helicase	S5MMD7	Bacillus_phage	6.6e-19	21.8
AYK87459.1\|2623204_2624668_-	hypothetical protein	A0A0S2MYH0	Enterococcus_phage	1.0e-11	36.0
AYK87460.1\|2625079_2625466_+	hypothetical protein	NA	NA	NA	NA
AYK88946.1\|2625595_2627143_+\|transposase	IS21 family transposase	NA	NA	NA	NA
AYK87461.1\|2627139_2627898_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
AYK87462.1\|2628137_2628317_-	hypothetical protein	NA	NA	NA	NA
AYK87463.1\|2628317_2628758_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	3.4e-11	34.4
AYK87464.1\|2629238_2629589_+	hypothetical protein	NA	NA	NA	NA
AYK87465.1\|2630039_2631965_-	fructose-bisphosphatase class III	NA	NA	NA	NA
AYK87466.1\|2632445_2633075_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
AYK87467.1\|2633095_2633818_+	peptide ABC transporter permease	NA	NA	NA	NA
AYK87468.1\|2633908_2634619_-	GntR family transcriptional regulator	NA	NA	NA	NA
AYK87469.1\|2635185_2636625_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
AYK87470.1\|2636735_2638265_-	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.0e-33	29.3
AYK87471.1\|2638278_2638842_-	peroxiredoxin	NA	NA	NA	NA
AYK87472.1\|2639307_2640714_-	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	E3SJC4	Synechococcus_phage	1.7e-32	30.6
AYK87473.1\|2640736_2642083_-	gluconate permease	NA	NA	NA	NA
AYK87474.1\|2642111_2643653_-	gluconokinase	NA	NA	NA	NA
AYK87475.1\|2643645_2644377_-	gluconate operon transcriptional regulator	NA	NA	NA	NA
AYK87476.1\|2644572_2645721_+	glycerate kinase	W6LM47	Streptococcus_phage	1.4e-48	42.3
AYK87477.1\|2645813_2646845_+	general stress protein 30	NA	NA	NA	NA
AYK87478.1\|2646884_2647577_-	LrgB family protein	NA	NA	NA	NA
AYK87479.1\|2647546_2647951_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
AYK87480.1\|2648177_2648609_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK87481.1\|2648667_2649738_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYK87482.1\|2649868_2650444_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYK87483.1\|2650537_2651572_+	cupin domain-containing protein	NA	NA	NA	NA
AYK87484.1\|2651690_2651879_-	hypothetical protein	NA	NA	NA	NA
AYK87485.1\|2651980_2653450_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AYK87486.1\|2653450_2655634_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.7e-50	30.8
AYK87487.1\|2655797_2656052_-	hypothetical protein	NA	NA	NA	NA
AYK87488.1\|2656329_2657454_-\|transposase	IS4 family transposase IS4Bsu1	NA	NA	NA	NA
AYK87489.1\|2657775_2657997_+	hypothetical protein	NA	NA	NA	NA
AYK87490.1\|2658041_2658260_+\|bacteriocin	bacteriocin leader domain-containing protein	NA	NA	NA	NA
AYK87491.1\|2658463_2658865_-	hypothetical protein	NA	NA	NA	NA
AYK87492.1\|2658882_2659083_-	transcriptional regulator	NA	NA	NA	NA
AYK87493.1\|2660274_2660526_+	hypothetical protein	NA	NA	NA	NA
AYK87494.1\|2660693_2662574_+	molecular chaperone HtpG	A0A1V0SAD6	Catovirus	1.1e-93	33.4
AYK87495.1\|2664119_2664632_-	HPP family protein	NA	NA	NA	NA
AYK87496.1\|2665388_2665859_+	hypothetical protein	NA	NA	NA	NA
AYK87497.1\|2665962_2666277_-	DUF2628 domain-containing protein	L7TIP7	Escherichia_phage	1.6e-10	47.0
AYK87498.1\|2666506_2667439_-	aldo/keto reductase	NA	NA	NA	NA
AYK87499.1\|2667492_2668248_-	DeoR family transcriptional regulator	NA	NA	NA	NA
AYK87500.1\|2668541_2669666_+\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

2816565 : 2931123

113

Bacillus_phage(23.53%)

bacteriocin,holin,lysis,protease,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK87631.1\|2816565_2817807_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
AYK87632.1\|2818057_2818573_-	MarR family transcriptional regulator	NA	NA	NA	NA
AYK87633.1\|2818723_2819437_+	TIGR02206 family membrane protein	NA	NA	NA	NA
AYK87634.1\|2819547_2820408_+	glycosyltransferase family 8 protein	A0A2P0VP84	Tetraselmis_virus	1.9e-05	26.4
AYK87635.1\|2820460_2821303_-	levansucrase and sucrase synthesis operon antiterminator	NA	NA	NA	NA
AYK87636.1\|2821356_2822736_-	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
AYK87637.1\|2825326_2826649_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AYK87638.1\|2826740_2827418_+	DUF2711 family protein	NA	NA	NA	NA
AYK87639.1\|2827456_2827837_-	VOC family protein	NA	NA	NA	NA
AYK87640.1\|2827957_2829145_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.2e-74	42.0
AYK87641.1\|2829179_2829377_-	YwbE family protein	NA	NA	NA	NA
AYK87642.1\|2829410_2830613_-	MFS transporter	NA	NA	NA	NA
AYK87643.1\|2830717_2831395_-\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
AYK87644.1\|2831376_2831763_-\|holin	holin-like protein CidA	NA	NA	NA	NA
AYK87645.1\|2831868_2832774_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK87646.1\|2832781_2833600_+	hydroxyethylthiazole kinase	NA	NA	NA	NA
AYK87647.1\|2833596_2834265_+	thiamine phosphate synthase	NA	NA	NA	NA
AYK87648.1\|2834421_2835864_+	iron transporter	NA	NA	NA	NA
AYK87649.1\|2835860_2837018_+	Efem/EfeO family lipoprotein	NA	NA	NA	NA
AYK87650.1\|2837036_2838287_+	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
AYK87651.1\|2838569_2839172_+	DsbA family protein	NA	NA	NA	NA
AYK87652.1\|2839201_2840743_-	cation acetate symporter	NA	NA	NA	NA
AYK87653.1\|2840739_2841048_-	DUF485 domain-containing protein	NA	NA	NA	NA
AYK87654.1\|2841490_2841649_-	DNA-binding anti-repressor SinI	NA	NA	NA	NA
AYK87655.1\|2842003_2842675_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYK87656.1\|2842692_2843076_+	GtrA family protein	NA	NA	NA	NA
AYK87657.1\|2843153_2844326_+	galactokinase	NA	NA	NA	NA
AYK87658.1\|2844329_2845871_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AYK88950.1\|2845941_2846187_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AYK88951.1\|2846702_2847668_+	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
AYK87659.1\|2847695_2849645_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AYK87660.1\|2849658_2850273_+	Quinol oxidase subunit 3	NA	NA	NA	NA
AYK87661.1\|2850274_2850649_+	quinol oxidase subunit 4	NA	NA	NA	NA
AYK87662.1\|2850690_2850954_-	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
AYK87663.1\|2851182_2852328_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK87664.1\|2852536_2853718_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AYK87665.1\|2853823_2854573_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
AYK87666.1\|2855784_2858205_-	peptidase S8	A0A217EQY2	Bacillus_phage	5.3e-21	38.2
AYK88952.1\|2858734_2859037_+	hypothetical protein	NA	NA	NA	NA
AYK87667.1\|2859946_2860717_-	transporter	NA	NA	NA	NA
AYK87668.1\|2861018_2862404_+	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
AYK87669.1\|2862400_2863840_+	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.7e-22	26.8
AYK87670.1\|2863933_2864182_+	hypothetical protein	NA	NA	NA	NA
AYK87671.1\|2864272_2865088_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AYK87672.1\|2865279_2866086_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AYK87673.1\|2866099_2866777_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
AYK87674.1\|2866801_2868172_-	aldehyde dehydrogenase	NA	NA	NA	NA
AYK87675.1\|2868339_2868657_+	hypothetical protein	NA	NA	NA	NA
AYK87676.1\|2868676_2869999_+	purine permease	NA	NA	NA	NA
AYK87677.1\|2870060_2870432_+	DUF423 domain-containing protein	NA	NA	NA	NA
AYK87678.1\|2870475_2871021_-\|coat	spore coat protein GerQ	NA	NA	NA	NA
AYK87679.1\|2871168_2871348_+	hypothetical protein	NA	NA	NA	NA
AYK87680.1\|2871340_2872111_+	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	4.4e-06	28.6
AYK87681.1\|2872115_2873540_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
AYK87682.1\|2873560_2874730_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.2e-15	28.1
AYK87683.1\|2874730_2875600_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK87684.1\|2875599_2876721_+\|coat	spore coat protein	NA	NA	NA	NA
AYK87685.1\|2876713_2877436_+\|coat	spore coat protein	NA	NA	NA	NA
AYK87686.1\|2877438_2878458_+\|coat	spore coat protein	NA	NA	NA	NA
AYK87687.1\|2878482_2879223_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.5e-48	41.9
AYK87688.1\|2879222_2880170_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
AYK87689.1\|2880183_2881035_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	38.9
AYK87690.1\|2881027_2881483_+\|coat	spore coat protein	NA	NA	NA	NA
AYK87691.1\|2881806_2882271_+	hypothetical protein	NA	NA	NA	NA
AYK87692.1\|2882448_2883723_+	catabolic NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
AYK87693.1\|2883949_2885497_+	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AYK87694.1\|2885570_2887271_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
AYK87695.1\|2887270_2888683_+	amino acid permease	NA	NA	NA	NA
AYK87696.1\|2888892_2890131_+	MFS transporter	NA	NA	NA	NA
AYK87697.1\|2890282_2890897_+	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
AYK87698.1\|2890886_2891594_+	bacilysin biosynthesis protein BacB	NA	NA	NA	NA
AYK88953.1\|2891596_2892358_+	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
AYK87699.1\|2892376_2893795_+	alanine-anticapsin ligase BacD	NA	NA	NA	NA
AYK87700.1\|2893791_2894976_+	MFS transporter	NA	NA	NA	NA
AYK87701.1\|2894976_2896191_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AYK87702.1\|2896206_2896986_-	SDR family oxidoreductase	NA	NA	NA	NA
AYK87703.1\|2897118_2897883_-	heme-binding protein	NA	NA	NA	NA
AYK87704.1\|2898152_2899124_+	phosphate acetyltransferase	NA	NA	NA	NA
AYK87705.1\|2899269_2900169_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
AYK87706.1\|2900217_2901063_+	lipoate--protein ligase family protein	NA	NA	NA	NA
AYK87707.1\|2901231_2902122_+	DMT family transporter	NA	NA	NA	NA
AYK87708.1\|2902265_2903042_-	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
AYK87709.1\|2903256_2903481_+	DUF1450 domain-containing protein	NA	NA	NA	NA
AYK87710.1\|2903642_2904944_+	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
AYK87711.1\|2904979_2905480_+	YwgA family protein	NA	NA	NA	NA
AYK87712.1\|2905591_2906062_+	transcriptional regulator	NA	NA	NA	NA
AYK87713.1\|2906061_2907462_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
AYK87714.1\|2907541_2907697_+	hypothetical protein	NA	NA	NA	NA
AYK87715.1\|2908306_2910223_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.9e-143	43.4
AYK87716.1\|2910342_2910762_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK87717.1\|2910804_2910993_-	2-hydroxymuconate tautomerase	NA	NA	NA	NA
AYK87718.1\|2911101_2911761_+\|protease	site-2 protease family protein	NA	NA	NA	NA
AYK87719.1\|2911774_2912293_+	hypothetical protein	NA	NA	NA	NA
AYK87720.1\|2912431_2912866_+	hypothetical protein	NA	NA	NA	NA
AYK87721.1\|2912893_2914969_-	penicillin-binding protein	NA	NA	NA	NA
AYK87722.1\|2915170_2916001_+	spermidine synthase	NA	NA	NA	NA
AYK87723.1\|2916061_2916934_+	agmatinase	NA	NA	NA	NA
AYK87724.1\|2916868_2917426_-	YbaK/EbsC family protein	NA	NA	NA	NA
AYK87725.1\|2917523_2917643_-	phosphatase RapF inhibitor	NA	NA	NA	NA
AYK87726.1\|2917626_2918772_-	transcriptional regulator	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
AYK87727.1\|2919001_2920357_+	YncE family protein	NA	NA	NA	NA
AYK87728.1\|2920395_2921772_+	YncE family protein	NA	NA	NA	NA
AYK87729.1\|2921777_2922479_-\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA
AYK87730.1\|2922475_2923756_-	insulinase family protein	NA	NA	NA	NA
AYK88954.1\|2923760_2924921_-	insulinase family protein	NA	NA	NA	NA
AYK87731.1\|2924910_2926221_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
AYK87732.1\|2926213_2926933_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.2
AYK87733.1\|2926929_2927091_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
AYK87734.1\|2927103_2928450_-	subtilosin maturase AlbA	NA	NA	NA	NA
AYK87735.1\|2928474_2928627_-\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
AYK87736.1\|2928583_2928715_-\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
AYK87737.1\|2929027_2929456_+	DUF1934 domain-containing protein	NA	NA	NA	NA
AYK87738.1\|2929452_2931123_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_10

3051418 : 3117745

Bacillus_phage(18.18%)

holin,protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK87865.1\|3051418_3052507_+\|coat	spore coat protein	NA	NA	NA	NA
AYK87866.1\|3052635_3053763_+\|coat	spore coat protein CotH	NA	NA	NA	NA
AYK87867.1\|3053822_3054500_+	DUF2642 domain-containing protein	NA	NA	NA	NA
AYK87868.1\|3054556_3055885_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	6.4e-45	28.9
AYK87869.1\|3056095_3057004_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	6.8e-14	25.6
AYK87870.1\|3057161_3058874_+	acetolactate synthase AlsS	NA	NA	NA	NA
AYK87871.1\|3058935_3059703_+	acetolactate decarboxylase	NA	NA	NA	NA
AYK87872.1\|3059800_3060328_+	flavodoxin family protein	NA	NA	NA	NA
AYK87873.1\|3060367_3060664_-	DUF3892 domain-containing protein	NA	NA	NA	NA
AYK87874.1\|3060819_3061356_-	cell wall-binding protein	NA	NA	NA	NA
AYK87875.1\|3061437_3062355_-	ribose ABC transporter substrate-binding protein RbsB	NA	NA	NA	NA
AYK87876.1\|3062367_3063336_-	ribose ABC transporter permease	NA	NA	NA	NA
AYK87877.1\|3063337_3064819_-	sugar ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.5e-13	27.0
AYK87878.1\|3064834_3065230_-	D-ribose pyranase	NA	NA	NA	NA
AYK87879.1\|3065226_3066108_-	ribokinase	NA	NA	NA	NA
AYK87880.1\|3066100_3067090_-	LacI family transcriptional regulator	NA	NA	NA	NA
AYK87881.1\|3067616_3067811_-	hypothetical protein	NA	NA	NA	NA
AYK87882.1\|3067871_3069053_+	poly-gamma-glutamate synthase PgsB	NA	NA	NA	NA
AYK87883.1\|3069067_3069517_+	poly-gamma-glutamate biosynthesis protein PgsC	NA	NA	NA	NA
AYK87884.1\|3069535_3070678_+	PGA biosynthesis protein CapA	NA	NA	NA	NA
AYK87885.1\|3070692_3070860_+	hypothetical protein	NA	NA	NA	NA
AYK88961.1\|3071000_3072242_+	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase	S5MM68	Bacillus_phage	1.8e-17	41.1
AYK87886.1\|3072275_3073136_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AYK87887.1\|3073283_3074270_-	LytR family transcriptional regulator	NA	NA	NA	NA
AYK87888.1\|3075954_3077079_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
AYK87889.1\|3077075_3078182_-	spore gernimation protein	NA	NA	NA	NA
AYK87890.1\|3078187_3079639_-	spore germination protein	NA	NA	NA	NA
AYK87891.1\|3079908_3080859_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
AYK87892.1\|3080988_3083631_+	beta-N-acetylglucosaminidase	Q4ZC50	Staphylococcus_virus	1.8e-38	44.9
AYK87893.1\|3083659_3084823_-	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
AYK87894.1\|3084842_3085625_-	glycosyltransferase	NA	NA	NA	NA
AYK87895.1\|3085987_3086377_+	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.4e-16	41.9
AYK87896.1\|3086520_3088656_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
AYK87897.1\|3088967_3091544_+	glycosyltransferase	NA	NA	NA	NA
AYK87898.1\|3093244_3094072_+	ABC transporter permease	NA	NA	NA	NA
AYK87899.1\|3094092_3095004_+	teichoic acids export ABC transporter ATP-binding subunit TagH	NA	NA	NA	NA
AYK87900.1\|3096241_3097120_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	5.7e-82	53.4
AYK87901.1\|3097449_3098592_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A2P1ELS7	Moumouvirus	3.8e-30	29.9
AYK87902.1\|3098720_3100073_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
AYK87903.1\|3100199_3100559_-\|holin	phage holin family protein	NA	NA	NA	NA
AYK87904.1\|3100560_3100758_-	PspC domain-containing protein	NA	NA	NA	NA
AYK87905.1\|3100762_3101860_-	DUF4097 domain-containing protein	NA	NA	NA	NA
AYK87906.1\|3101884_3102211_-	hypothetical protein	NA	NA	NA	NA
AYK87907.1\|3102428_3102659_+	hypothetical protein	NA	NA	NA	NA
AYK87908.1\|3102852_3103674_-	flagellin	NA	NA	NA	NA
AYK87909.1\|3104012_3106886_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	0.0e+00	57.4
AYK87910.1\|3106893_3108879_-	excinuclease ABC subunit B	NA	NA	NA	NA
AYK87911.1\|3109064_3109295_-	protein CsbA	NA	NA	NA	NA
AYK87912.1\|3109740_3112236_+	phosphotransferase	NA	NA	NA	NA
AYK87913.1\|3112311_3112881_+	TetR family transcriptional regulator	NA	NA	NA	NA
AYK87914.1\|3112911_3114246_+	MFS transporter	NA	NA	NA	NA
AYK87915.1\|3114293_3115487_-\|protease	serine protease	NA	NA	NA	NA
AYK87916.1\|3115565_3115919_-	swarming motility protein SwrAA	NA	NA	NA	NA
AYK87917.1\|3116302_3117745_-\|protease	carboxy-terminal processing protease CtpB	A0A0R6PIZ1	Moraxella_phage	6.3e-22	27.8

DBSCAN-SWA_11

3225829 : 3263411

Bacillus_phage(30.77%)

portal,plate,tail,integrase,holin,protease,capsid

attL 3226722:3226775|attR 3263550:3263603

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK88016.1\|3225829_3226423_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.6e-54	55.8
3226722:3226775	attL	NA	NA	NA	NA
AYK88017.1\|3226968_3227958_+	DNA integration/recombination/inversion protein	A0A0U4IBS1	Pseudomonas_phage	2.7e-08	28.1
AYK88018.1\|3228116_3228848_+	helix-turn-helix domain-containing protein	A0A288WFX2	Bacillus_phage	6.7e-20	32.7
AYK88019.1\|3228878_3229061_-	hypothetical protein	NA	NA	NA	NA
AYK88020.1\|3229120_3229354_-	transcriptional regulator	NA	NA	NA	NA
AYK88021.1\|3229942_3230278_+	hypothetical protein	NA	NA	NA	NA
AYK88022.1\|3230479_3230695_-	XRE family transcriptional regulator	A0A1P8CWW6	Bacillus_phage	1.7e-08	50.8
AYK88023.1\|3230815_3231991_+	hypothetical protein	NA	NA	NA	NA
AYK88024.1\|3232524_3233067_+	hypothetical protein	NA	NA	NA	NA
AYK88025.1\|3233428_3233770_+	hypothetical protein	NA	NA	NA	NA
AYK88026.1\|3233762_3233963_+	hypothetical protein	NA	NA	NA	NA
AYK88027.1\|3234594_3234843_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK88028.1\|3234839_3235223_+	hypothetical protein	NA	NA	NA	NA
AYK88029.1\|3235290_3235662_+	DUF134 domain-containing protein	NA	NA	NA	NA
AYK88030.1\|3236522_3236801_+	hypothetical protein	NA	NA	NA	NA
AYK88031.1\|3236797_3237340_+	hypothetical protein	NA	NA	NA	NA
AYK88032.1\|3238384_3238564_+	hypothetical protein	NA	NA	NA	NA
AYK88033.1\|3238816_3239128_+	hypothetical protein	NA	NA	NA	NA
AYK88034.1\|3239501_3239711_+	hypothetical protein	NA	NA	NA	NA
AYK88035.1\|3239740_3240289_-\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	7.0e-38	51.6
AYK88036.1\|3242148_3242583_+	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.5e-27	49.3
AYK88037.1\|3242587_3244258_+\|portal	phage portal protein	A0A2H4J180	uncultured_Caudovirales_phage	1.5e-155	55.3
AYK88038.1\|3244257_3245070_+\|capsid	minor capsid protein	A0A0N9SJR1	Paenibacillus_phage	8.1e-75	52.7
AYK88039.1\|3245175_3245736_+	ribonucleoside-triphosphate reductase	NA	NA	NA	NA
AYK88040.1\|3245767_3246676_+\|capsid	phage major capsid protein	A0A0N9S7T7	Paenibacillus_phage	1.4e-80	52.5
AYK88041.1\|3246732_3246924_+	hypothetical protein	NA	NA	NA	NA
AYK88042.1\|3246941_3247334_+	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	7.5e-18	39.5
AYK88043.1\|3247334_3247673_+	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	8.1e-21	47.3
AYK88044.1\|3247669_3248077_+	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	2.1e-31	55.5
AYK88045.1\|3248081_3248456_+	hypothetical protein	NA	NA	NA	NA
AYK88046.1\|3248496_3249066_+	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	1.0e-52	63.0
AYK88965.1\|3249152_3249509_+	hypothetical protein	NA	NA	NA	NA
AYK88047.1\|3249604_3249826_+	hypothetical protein	NA	NA	NA	NA
AYK88048.1\|3249830_3252653_+\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	6.7e-68	36.4
AYK88049.1\|3252656_3254075_+\|tail	phage tail protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.3e-56	42.4
AYK88050.1\|3254089_3255484_+	endopeptidase	A6M966	Geobacillus_virus	3.0e-37	30.3
AYK88051.1\|3255496_3257074_+	hypothetical protein	M4ZSB3	Bacillus_phage	3.3e-258	86.8
AYK88052.1\|3257110_3258334_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	4.1e-163	74.9
AYK88053.1\|3258349_3258643_+	hypothetical protein	M4ZR44	Bacillus_phage	1.6e-41	80.2
AYK88054.1\|3258643_3258814_+	XkdX family protein	M4ZS22	Bacillus_phage	1.1e-10	68.1
AYK88055.1\|3258838_3259042_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-09	46.5
AYK88056.1\|3259114_3260062_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	2.5e-91	62.7
AYK88057.1\|3260081_3260339_+\|holin	holin	A0A0U4JE55	Bacillus_phage	5.6e-22	57.6
AYK88058.1\|3260460_3260763_+	hypothetical protein	NA	NA	NA	NA
AYK88059.1\|3260804_3261437_-	hypothetical protein	Q0H249	Geobacillus_phage	7.2e-63	57.1
AYK88060.1\|3261423_3262608_-	DNA translocase FtsK	Q0H250	Geobacillus_phage	1.3e-108	53.4
AYK88061.1\|3262620_3262899_-	hypothetical protein	NA	NA	NA	NA
AYK88062.1\|3263177_3263411_+	helix-turn-helix domain-containing protein	B3RH35	Bacillus_virus	4.3e-21	62.0
3263550:3263603	attR	NA	NA	NA	NA

DBSCAN-SWA_12

3343195 : 3400961

Bacillus_phage(68.29%)

head,terminase,portal,tail,holin,protease,capsid,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK88133.1\|3343195_3343849_+\|holin	choline ABC transporter permease	NA	NA	NA	NA
AYK88134.1\|3343860_3344781_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK88135.1\|3344797_3345478_+	ABC transporter permease	NA	NA	NA	NA
AYK88136.1\|3345518_3347219_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-24	29.8
AYK88137.1\|3347346_3347673_-	HxlR family transcriptional regulator	NA	NA	NA	NA
AYK88138.1\|3347764_3348184_-	XRE family transcriptional regulator	S6C481	Thermus_phage	5.4e-14	62.7
AYK88139.1\|3348213_3348621_-	transcriptional regulator	S6C481	Thermus_phage	1.9e-16	64.8
AYK88140.1\|3348772_3349006_+	transcriptional regulator	NA	NA	NA	NA
AYK88141.1\|3349039_3349813_-	alpha/beta hydrolase	NA	NA	NA	NA
AYK88142.1\|3349961_3350192_+	preprotein translocase subunit SecG	NA	NA	NA	NA
AYK88143.1\|3350323_3351064_+	carboxylesterase	NA	NA	NA	NA
AYK88144.1\|3351082_3353422_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.4e-87	42.9
AYK88145.1\|3353566_3354037_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
AYK88146.1\|3355961_3357062_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK88147.1\|3357494_3357893_-	XRE family transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
AYK88148.1\|3358127_3358331_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK88149.1\|3358382_3358574_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
AYK88150.1\|3358598_3358817_+	hypothetical protein	NA	NA	NA	NA
AYK88151.1\|3358809_3359691_+	replication protein	V9QKF6	Oenococcus_phage	6.8e-27	33.1
AYK88152.1\|3359674_3360502_+	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
AYK88153.1\|3360816_3361365_+	hypothetical protein	NA	NA	NA	NA
AYK88154.1\|3361472_3361613_+	BH0509 family protein	NA	NA	NA	NA
AYK88155.1\|3361859_3362057_+	hypothetical protein	NA	NA	NA	NA
AYK88156.1\|3362099_3362462_+	VWA domain-containing protein	NA	NA	NA	NA
AYK88157.1\|3362458_3362776_+	hypothetical protein	NA	NA	NA	NA
AYK88158.1\|3362772_3363180_+	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
AYK88159.1\|3363176_3363434_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
AYK88160.1\|3363551_3364208_+	dUTPase	R9TQ23	Paenibacillus_phage	9.9e-39	46.0
AYK88161.1\|3364207_3364540_+	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
AYK88162.1\|3364536_3364956_+	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
AYK88163.1\|3364952_3365153_+	hypothetical protein	NA	NA	NA	NA
AYK88164.1\|3365406_3365859_+	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.4e-38	56.6
AYK88165.1\|3367049_3367433_+	hypothetical protein	NA	NA	NA	NA
AYK88166.1\|3367583_3368357_+	hypothetical protein	NA	NA	NA	NA
AYK88167.1\|3368747_3369494_+	hypothetical protein	NA	NA	NA	NA
AYK88970.1\|3369543_3369918_+	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
AYK88168.1\|3370297_3370831_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
AYK88169.1\|3370830_3372540_+\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	0.0e+00	92.3
AYK88170.1\|3372552_3372768_+	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
AYK88171.1\|3372773_3374021_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
AYK88172.1\|3374010_3374637_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
AYK88173.1\|3374673_3375876_+\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
AYK88174.1\|3375891_3376206_+	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
AYK88175.1\|3376234_3376726_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
AYK88176.1\|3376741_3377089_+\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
AYK88177.1\|3377021_3377393_+\|head,tail	head-tail adaptor protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
AYK88178.1\|3377385_3377769_+	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
AYK88179.1\|3377765_3378146_+	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
AYK88180.1\|3378146_3378758_+\|tail	phage tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
AYK88181.1\|3379152_3379332_+	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
AYK88182.1\|3379344_3383223_+\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
AYK88183.1\|3383222_3384062_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	8.5e-136	83.2
AYK88184.1\|3384073_3385780_+	alkaline phosphatase	D6R400	Bacillus_phage	9.4e-267	81.8
AYK88185.1\|3385816_3387391_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-264	88.7
AYK88186.1\|3387427_3388651_+	DUF2479 domain-containing protein	M4ZRP1	Bacillus_phage	6.5e-177	79.9
AYK88187.1\|3388666_3388966_+	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
AYK88188.1\|3388962_3389133_+	XkdX family protein	NA	NA	NA	NA
AYK88189.1\|3389186_3389609_+\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
AYK88190.1\|3389650_3390592_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
AYK88971.1\|3390631_3391234_-	hypothetical protein	NA	NA	NA	NA
AYK88191.1\|3391576_3391966_-	hypothetical protein	NA	NA	NA	NA
AYK88192.1\|3391980_3393564_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7
AYK88972.1\|3393725_3393914_-	hypothetical protein	A0A2H4J4T3	uncultured_Caudovirales_phage	1.4e-11	53.3
AYK88193.1\|3394423_3395218_+	SDR family oxidoreductase	NA	NA	NA	NA
AYK88194.1\|3395328_3395901_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYK88195.1\|3395897_3396257_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AYK88196.1\|3396820_3398707_+	FUSC family protein	NA	NA	NA	NA
AYK88197.1\|3399608_3400961_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8

DBSCAN-SWA_13

3966889 : 4023997

Staphylococcus_phage(20.0%)

integrase,tRNA,protease,coat,transposase

attL 3966565:3966619|attR 3977965:3978019

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3966565:3966619	attL	NA	NA	NA	NA
AYK88999.1\|3966889_3967777_+\|integrase	site-specific integrase	NA	NA	NA	NA
AYK88714.1\|3968114_3968411_+	hypothetical protein	NA	NA	NA	NA
AYK88715.1\|3969199_3970252_+	hypothetical protein	NA	NA	NA	NA
AYK88716.1\|3970556_3973763_+	type I restriction-modification system endonuclease	Q5YA94	Bacillus_phage	1.7e-06	29.5
AYK88717.1\|3973895_3975326_+	SAM-dependent methyltransferase	A0A220A2U4	Liberibacter_phage	2.6e-28	25.9
AYK88718.1\|3975322_3976642_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.3e-16	35.9
AYK88719.1\|3978145_3979296_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
3977965:3978019	attR	NA	NA	NA	NA
AYK88720.1\|3979430_3980255_-	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
AYK88721.1\|3981056_3981392_-	hypothetical protein	NA	NA	NA	NA
AYK88722.1\|3982204_3983929_+	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.4e-60	30.2
AYK88723.1\|3983925_3984444_+	acetolactate synthase small subunit	NA	NA	NA	NA
AYK88724.1\|3984467_3985496_+	ketol-acid reductoisomerase	NA	NA	NA	NA
AYK88725.1\|3985482_3987039_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	6.0e-10	39.4
AYK88726.1\|3987059_3988157_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AYK88727.1\|3988206_3989625_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AYK88728.1\|3989637_3990237_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AYK88729.1\|3990356_3991361_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AYK88730.1\|3991588_3992863_+	trigger factor	NA	NA	NA	NA
AYK88731.1\|3993134_3994397_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9
AYK88732.1\|3994550_3996209_+\|protease	ATP-dependent protease LonB	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
AYK88733.1\|3996389_3998714_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.7
AYK88734.1\|3998710_3999298_+	GTP-binding protein	NA	NA	NA	NA
AYK88735.1\|3999319_3999817_-	hypothetical protein	NA	NA	NA	NA
AYK88736.1\|4000046_4001414_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
AYK88737.1\|4001421_4002252_+	protein HemX	NA	NA	NA	NA
AYK88738.1\|4002284_4003229_+	hydroxymethylbilane synthase	NA	NA	NA	NA
AYK88739.1\|4003218_4004007_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
AYK88740.1\|4004003_4004978_+	porphobilinogen synthase	NA	NA	NA	NA
AYK88741.1\|4005007_4006300_+	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
AYK88742.1\|4006430_4008152_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
AYK88743.1\|4008184_4009210_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
AYK88744.1\|4009228_4009420_-	hypothetical protein	NA	NA	NA	NA
AYK88745.1\|4009867_4012510_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
AYK88746.1\|4012569_4013862_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AYK88747.1\|4014001_4014748_+	prepilin peptidase	NA	NA	NA	NA
AYK88748.1\|4014881_4015880_+	SPOR domain-containing protein	NA	NA	NA	NA
AYK88749.1\|4016032_4016602_+	septum formation protein Maf	NA	NA	NA	NA
AYK88750.1\|4016638_4017334_+	JAB domain-containing protein	NA	NA	NA	NA
AYK88751.1\|4017425_4018439_+	rod shape-determining protein	NA	NA	NA	NA
AYK88752.1\|4018469_4019342_+	cell shape-determining protein MreC	NA	NA	NA	NA
AYK88753.1\|4019338_4019857_+	rod shape-determining protein MreD	NA	NA	NA	NA
AYK88754.1\|4019909_4020590_+	septum site-determining protein MinC	NA	NA	NA	NA
AYK88755.1\|4020591_4021398_+	septum site-determining protein MinD	NA	NA	NA	NA
AYK88756.1\|4021547_4022342_+	stage IV sporulation protein FA	NA	NA	NA	NA
AYK88757.1\|4022334_4023201_+	stage IV sporulation protein FB	NA	NA	NA	NA
AYK88758.1\|4023347_4023656_+	50S ribosomal protein L21	NA	NA	NA	NA
AYK88759.1\|4023658_4023997_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP032862

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP032861

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection