CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032866	Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence	1 crisprs	NA	0	1	0	0
CP032865	Bacillus subtilis subsp. subtilis strain N3-1 chromosome, complete genome	0 crisprs	cas3,csa3,DEDDh,DinG,WYL	0	0	11	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032866_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032866_1

31596-31764

Orphan

Consensus_repeat	Method
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032866_1

>merge|CP032866|1|31596-31764|CRISPRCasFinder
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGGTGCGACTTGTCGTGATGTGGCAGCTGAAGAAAGAGATCGATGCCAGGCATCCAGGAGCGAACCAGCTGCAGCTGAAGAAAAGATGCTGCCGGTACCGGAAACCAGGAAGCCAGG

>CP032866|1|1|31596-31764|CRISPRCasFinder
AACCAGCTGCAGCTGAAGAAAAGATGTTGCCGGTACCGGAAACCAGGAAGCCAGG	TGCGACTTGTCGTGATGTGGCAGCTGAAGAAAGAGATCGATGCCAGGCATCCAGGAGCG
AACCAGCTGCAGCTGAAGAAAAGATGCTGCCGGTACCGGAAACCAGGAAGCCAGG

Protein	Signature genes	Signature genes Name	Protein_function
CP032866.1\|AYK84937.1\|24203_24506_+\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84940.1\|25367_25820_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227664
CP032866.1\|AYK84938.1\|24796_25051_-\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84954.1\|36817_37924_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
CP032866.1\|AYK84942.1\|27081_27723_+\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84939.1\|25080_25371_-\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84945.1\|30188_30524_+\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84953.1\|36097_36346_+\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84943.1\|27857_28190_+\|YolD-like-family-protein	unknown	unknown	gnl\|CDD\|370161
CP032866.1\|AYK84948.1\|31892_32519_-\|VanZ-family-protein	unknown	unknown	gnl\|CDD\|377417
CP032866.1\|AYK84944.1\|28182_29448_+\|UV-damage-repair-protein-UvrX	unknown	unknown	gnl\|CDD\|235104
CP032866.1\|AYK84952.1\|34256_35432_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212669
CP032866.1\|AYK84946.1\|30560_31178_-\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84957.1\|40208_41381_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|240271
CP032866.1\|AYK84949.1\|32551_32941_-\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84951.1\|33841_34246_-\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84956.1\|39306_39825_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375153
CP032866.1\|AYK84950.1\|33276_33549_+\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84941.1\|26128_26359_+\|hypothetical-protein	unknown	unknown	unknown
CP032866.1\|AYK84955.1\|38225_38711_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775

Protein	Function_ID	Function_description	E-value
CP032866.1\|AYK84948.1\|31892_32519_-\|VanZ-family-protein	gnl\|CDD\|377417	pfam04892, VanZ, VanZ like family. This family contains several examples of the VanZ protein, but also contains examples of phosphotransbutyrylases.	5.85001e-26
CP032866.1\|AYK84940.1\|25367_25820_-\|hypothetical-protein	gnl\|CDD\|227664	COG5371, COG5371, Golgi nucleoside diphosphatase [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones].	0.00285974
CP032866.1\|AYK84954.1\|36817_37924_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.62343e-11
CP032866.1\|AYK84955.1\|38225_38711_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.84971e-09
CP032866.1\|AYK84944.1\|28182_29448_+\|UV-damage-repair-protein-UvrX	gnl\|CDD\|235104	PRK03103, PRK03103, DNA polymerase IV; Reviewed.	6.39022e-135
CP032866.1\|AYK84957.1\|40208_41381_+\|hypothetical-protein	gnl\|CDD\|240271	PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional.	1.08138e-09
CP032866.1\|AYK84956.1\|39306_39825_+\|hypothetical-protein	gnl\|CDD\|375153	pfam17362, pXO2-34, Family of unknown function. This is a family of unknown function found in Bacilli.	0.00149194
CP032866.1\|AYK84952.1\|34256_35432_-\|hypothetical-protein	gnl\|CDD\|212669	cd10227, ParM_like, Plasmid segregation protein ParM and similar proteins. ParM is a plasmid-encoded bacterial homolog of actin, which polymerizes into filaments similar to F-actin, and plays a vital role in plasmid segregation. ParM filaments segregate plasmids paired at midcell into the individual daughter cells. This subfamily also contains Thermoplasma acidophilum Ta0583, an active ATPase at physiological temperatures, which has a propensity to form filaments.	1.37571e-19
CP032866.1\|AYK84943.1\|27857_28190_+\|YolD-like-family-protein	gnl\|CDD\|370161	pfam08863, YolD, YolD-like protein. Members of this family are functionally uncharacterized. However it has been predicted that these proteins are functionally equivalent to the UmuD subunit of polymerase V from gram-negative bacteria. This family has been shown to belong to the WYL-like superfamily.	9.89407e-18

>CP032866.1|AYK84946.1|30560_31178_-|hypothetical-protein
MKANFKYWSIAAVLGISLFDFMGTSKVEAAEVKESLPIEEKILSQDEIEAKKEEIASQIKIFDENNKEIHPYTTEQLKSMIRLTEEQPTDNPIKVLKKTYSSGYFDFYYNIWLGKGTYGKTFKDPSTLIVTYKGTARKFSVSAFYDDGRGGAKGRAQKVTLPGGWKGQFHMNWNLKKGKSYHIKFENEGNTDKLITINQATLWYN
>CP032866.1|AYK84945.1|30188_30524_+|hypothetical-protein
MKKKFIGFLVLASFLLMFNTASYASGTDENTEKSTAELLESVMDDFGLFSFQIGRTDPTITIGMDQTKSESKLREYLDDNLSEEAKKKYEIYIFKEDIDKLKQEHQKSLQE
>CP032866.1|AYK84944.1|28182_29448_+|UV-damage-repair-protein-UvrX
MIDYDSLPKRTFLTVDMRSFYASASAVMLGLDPMKCYLAVVGDTERSGSVVLAASPALKKRFGIKTGSRLYEIPDHPQIHIVNPQMRMFIKLSTNITHLFYQFASPEDILTYSVDESIIRFDFLKRLWGTPMDLAKRIQNAIYRDFGVPATVGIGPNMLMSKLALDLEAKKSPSGIAEWTYEDVQTKLWPVHPLSKMWGIGRRMERNLNRMGIATVGQLANYPLELLENRFGIMGNQIYYHAHGVDLSELGTPIRQEQISFGKSQILLRDYNEEAEIKSVILEMCEEVASRARKAKKAGRTIHLGVGYSQTVGGGGFHRSLTIDQPTNITMKLYKACIALFKKFYQGQTVRSLSVTLGNVVDDNQFQMSLFEENSEKERQLGHVMDSIREKYGSDAILRAISYTTAGTALKRAKLVGGHQA
>CP032866.1|AYK84943.1|27857_28190_+|YolD-like-family-protein
MKWATSMMLPEHNEMLKQLNLEMEKMKRPENDEQKIEAMALIINEAKQGNQLLSISYFENGHISSLTGFVRSFKYIEREMLIKTNEGHIKAVSVDDLIEVELAEGEKFYD
>CP032866.1|AYK84942.1|27081_27723_+|hypothetical-protein
MKNIKHIKKMRNSILFSVVWRLLFLVLYPVILGAGLPLIGLNLPSATLFILSFIGCMMVCLTIATHISNLVNIREVLKQYASIERELVGTYSIDAKVLDDMLDNTMKKYHHQRSFDRDYNLADLHAIEELVQEERNGKYFDKYLAHDDSIKDEIRMAVVPKRVAEDLLYSVFNSKTTFGITGRKYYHKWHMARLDEQLLPFLQEKQEKMHKTN
>CP032866.1|AYK84941.1|26128_26359_+|hypothetical-protein
MAGQKQKRRLKKRFNHAGACRQSFCGNATGVTGAFLLLLNLCPRSLVKKWPGTMQLLLRDPPQAIRKLTDACYRAF
>CP032866.1|AYK84940.1|25367_25820_-|hypothetical-protein
MFFTSIVWHKEDLKSALESKGFLGTEKNIEACITNGFEQTLKERSVEEGWTILDDLIGSIESQLDKTQSKAYCSFWTYKASANEYPETQVRFCVYEDWLEEVLNRRFTDIPDISTFTSEYTYDQTKLIFEIATENKSESGLTILKEDEGE
>CP032866.1|AYK84939.1|25080_25371_-|hypothetical-protein
MNMNAAQAIQRKIKKEHVTPTKESLLKSIRESKYTTISKLLKYGDSNKVMTHIAELESQGEIIVFDDKIIAVSPRISLSLIGLLFFGTVIFGNLIA
>CP032866.1|AYK84938.1|24796_25051_-|hypothetical-protein
MILVRLDNSVTIYKPITADSGRIISSRYKDLPAHLEAASEIKVDYPFGMKKRLRYVEKLGFRLKETLHFDDTAPYSRNRQIWSK
>CP032866.1|AYK84937.1|24203_24506_+|hypothetical-protein
MAGQKQKRRLKKDLIMPAAAGILFAEMRPGLYGSLSAFFDLPSSFTREEMTRNNAAVASGSAAGNPEAYRCMLSGILEGSEMPRNVGRRFWPAYSPGADP
>CP032866.1|AYK84948.1|31892_32519_-|VanZ-family-protein
MLLNSFIIPYVVYAYVLFVVYRLFAVFVQKKPRYTIEKSIYILATFVYLTGVICMTLFPIPTDPLLIHDRAAEGFQETNNLIPFNTMKDALTGSSLSVTVYQLGGNIILLFPLGCFLPLLFNRMRQAKRVIIAGFIASLIIETSQFTISSAIGLTYRSFDVDDLILNTLGSALGYLFYKFVYPMVRQELFEVDSTNKTSRKQKVRKHI
>CP032866.1|AYK84949.1|32551_32941_-|hypothetical-protein
MKKIKKVLVSSALSFTLLLPVTAPAALAASKHDFWFEFKHQVTSKTYSRGASNIKIYTHADTGGSGGTFNIELYRKQKKGKAKYLGSKKFSQNGSTTNSYGNKTKGKFYFIMKKKNNGASTGGYGDIYN
>CP032866.1|AYK84950.1|33276_33549_+|hypothetical-protein
MKKKTTNQVEERKVRSDKKTRVNPSLDANTHEKLKKLAISCDMTKTQLAAEILKMALNNESVIDWYQKKYNKDDSYRIILARINGELHYS
>CP032866.1|AYK84951.1|33841_34246_-|hypothetical-protein
MGKNKRIPLFNVRTTQMSDEMYDFVLEQISTFSKGKSKGTFREYAFQLIERDMQQQKEEQQNREKDRHVHDELIAMREEMKKEFRDLRKKIDQGSIYVEHKTADPKSASETIEEGQLITEKITGTIEEEYDYDF
>CP032866.1|AYK84952.1|34256_35432_-|hypothetical-protein
MNISRMNVDFGNSMYMNLIDGYFFELPTNVVEISKEAAEGKFTSIVEDPADLKDRLLVSTVIDETERYFLVGELAEPEVLGNQHIKKLHNKVESHIPYVTFLAATAYYQALKGKREDNEVTIEYFQTMLPIWLLKKLDKFSEMQKRMASKFLGTHQVKVLTLGLEKELTIKVEDAACRIESEVARWAIKKNFDLEDKDYAEQFKNYDVVFCDLGGGTDDLVLLPAGLKPPKSRDSFVSNTEAPFLAHLEKLRKEKLLEHFDSVRELEKFIYSNIGKTKMERRDGNTGQKFDLTDIIKKSLKEYTEIKIAQAENTFPAPKDKVYKYLYFGGVGEVLEESISVVTEERYGRDISESNHIVAEDARLLNLYGLEVLSRAEQVKKQANEKEAQSI
>CP032866.1|AYK84953.1|36097_36346_+|hypothetical-protein
MARTAINGPENVDKPLGCLAHYGAGNYGQASMQRHTIECDRVREHETNPIEVAYRTSIVCKKVMAGESLAIARQSWKPQTSL
>CP032866.1|AYK84954.1|36817_37924_+|tetratricopeptide-repeat-protein
MLSKVKKVPSPYVGNLLNKWHDYIMQEKVHESIEKRTEIKQLLSQAEDNKDLVDYFILLDHRHSLCFDQEASMGDVVNMLSKGSHDLLINFYFELFAGDYEFFKKNYVKAISFYEKAEQKLSSIPNIEETKFAEFHYKIGVAYYEIDQHLVSVNKVTKARDIYKKSDMWNLEAIQCSLVVGINLYDMGRLDDADAYFRDALTEALDHGYDKPITKIYHNLGLVHWQKGSLELALHYFREAYSHEWLRDSPKGQQTVYMLSRVLYTMGQNEEAYHWYELGIEMARKFDDHEYKAKHDILYHLYEQPSIDEVKQSLAFLEERNLWPDVSKIAKGISELYEKKGDLVTSHEFLKRAFYAKEQIQRITEALG
>CP032866.1|AYK84955.1|38225_38711_-|XRE-family-transcriptional-regulator
MGNREQFDLSKYLLEKRKQKGLSQTQVANDTGLSSAYISMLEKGERKRPTQAVIKKLATALSIPNIEMLQIMEYIASMEEDHVKEKDKDTSKQIKLFDLTGLTEASINQIQNQIDQLKSSENNSVIRFFDVTGLSEKDIERVKEEIELLKIRNEYMKLKKD
>CP032866.1|AYK84956.1|39306_39825_+|hypothetical-protein
MAKVKLLEKKMTEKDVLEYGSSLRLFDGSTHVLIGKDCLHTHTKNKRPISQCYSDIRNVKNVEGVIVGKRVSPHSSLLFTTEAFQPARKVTQVYKAPKMPRRSTQVRPRNTSGRAKKVSVLLSETGYANVHQLKQVLLDAGAKKVQTYNTSRGIAIVCHPNPNYLLQKVISE
>CP032866.1|AYK84957.1|40208_41381_+|hypothetical-protein
MRKKLAAGIVAGAIILGVPGYTIFHSYQANAEEARVLDNATDAVNSLYASKKYNYLADGVSKNDIQKAQKLVSDVADSKKQKSLAEKASNAAIMLEASNAVKEDIVDGVIVDDLTKSILSVTKESVDKVKPISKDLYKDLSKDLSKAYDQIEQIDKTKKLLKDAKKDWNSYKKIEKEVNKISNQTAKKSLKKQLETLKKRIEDQESISKKAKEKLNEIEKTSQKDSDSKAANDSSQVSTNDNENATSSAASSNTSATQNKSGSSSNSSSSSGSSNSGYSSYSNGSSKSSSNTKSYSNSSSSRSYTSKSNSGSTSHSESKKSRTGSSSAGSSNKSSSSKSSSSTSKSKQSQNNTMKNANDFVNDFNSGNYNHVGSGNNGTGNNYDVYERGQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP018185	Bacillus subtilis strain KH2 plasmid, complete sequence	60755-60813	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP017764	Bacillus subtilis strain 29R7-12 plasmid unnamed1, complete sequence	37952-38010	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP032868	Bacillus subtilis subsp. subtilis strain N4-2 plasmid unnamed1, complete sequence	33414-33472	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP032864	Bacillus subtilis subsp. subtilis strain N2-2 plasmid unnamed1, complete sequence	47417-47475	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP032866	Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence	31651-31709	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP021893	Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence	5175-5233	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP021893	Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence	71103-71161	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP041370	Bacillus sp. M4U3P1 plasmid unnamed1, complete sequence	57654-57712	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	20251-20309	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP020024	Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence	84850-84908	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP032862	Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence	1870-1928	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NC_015148	Bacillus subtilis subsp. natto plasmid pLS20 DNA, complete sequence, strain: IFO 3335	60682-60740	1.0
CP032866_1	1.1\|31651\|59\|CP032866\|CRISPRCasFinder	31651-31709	59	NZ_CP014473	Bacillus subtilis subsp. natto strain CGMCC 2108 plasmid unnamed2, complete sequence	60682-60740	1.0

1. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP018185 (Bacillus subtilis strain KH2 plasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

2. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP017764 (Bacillus subtilis strain 29R7-12 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

3. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP032868 (Bacillus subtilis subsp. subtilis strain N4-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

4. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP032864 (Bacillus subtilis subsp. subtilis strain N2-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

5. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP032866 (Bacillus subtilis subsp. subtilis strain N3-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

6. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP021893 (Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

7. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP021893 (Bacillus subtilis subsp. subtilis strain SRCM100333 plasmid pBS333 sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

8. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP041370 (Bacillus sp. M4U3P1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

9. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP020024 (Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

10. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP020024 (Bacillus subtilis strain ATCC 21228 plasmid pLDW-15, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

11. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP032862 (Bacillus subtilis subsp. subtilis strain N1-1 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

12. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NC_015148 (Bacillus subtilis subsp. natto plasmid pLS20 DNA, complete sequence, strain: IFO 3335) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

13. spacer 1.1|31651|59|CP032866|CRISPRCasFinder matches to NZ_CP014473 (Bacillus subtilis subsp. natto strain CGMCC 2108 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	CRISPR spacer
tgcgacttgtcgtgatgtggcagctgaagaaagagatcgatgccaggcatccaggagcg	Protospacer
***********************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4786 : 104421

113

Bacillus_phage(56.36%)

tail,capsid,transposase,portal,holin,tRNA,coat,protease,integrase,terminase,head,plate

attL 37621:37680|attR 102399:102564

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK80837.1\|4786_6139_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
AYK80838.1\|6300_6699_-	hypothetical protein	NA	NA	NA	NA
AYK80839.1\|6952_7141_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
AYK80840.1\|7315_7516_+\|coat	spore coat protein CotC	NA	NA	NA	NA
AYK80841.1\|7761_8118_+	hypothetical protein	NA	NA	NA	NA
AYK80842.1\|8277_8997_+	hypothetical protein	NA	NA	NA	NA
AYK80843.1\|9039_9327_+	hypothetical protein	NA	NA	NA	NA
AYK80844.1\|9449_10289_-	thymidylate synthase	A0A1P8CX42	Bacillus_phage	5.6e-164	98.2
AYK80845.1\|10563_10728_-	hypothetical protein	NA	NA	NA	NA
AYK80846.1\|10858_11083_-	hypothetical protein	NA	NA	NA	NA
AYK80847.1\|11134_11398_+	hypothetical protein	NA	NA	NA	NA
AYK80848.1\|11998_12433_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1P8CX51	Bacillus_phage	5.8e-72	92.3
AYK80849.1\|13351_13777_+	endonuclease	NA	NA	NA	NA
AYK80850.1\|14187_15372_+	alanine racemase 2	NA	NA	NA	NA
AYK80851.1\|15473_16889_-	sugar porter family MFS transporter	NA	NA	NA	NA
AYK80852.1\|17301_17937_+	thermonuclease family protein	A0A1P8CWK6	Bacillus_phage	7.7e-73	68.5
AYK80853.1\|18066_19314_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AYK80854.1\|19798_21298_-	xylulokinase	NA	NA	NA	NA
AYK80855.1\|21448_22786_-	xylose isomerase	NA	NA	NA	NA
AYK80856.1\|23023_24178_+	ROK family protein	NA	NA	NA	NA
AYK80857.1\|24315_25917_-	glycoside hydrolase family 43 protein	NA	NA	NA	NA
AYK80858.1\|26055_26970_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	9.0e-06	22.9
AYK80859.1\|26966_27284_-\|transposase	transposase	NA	NA	NA	NA
AYK80860.1\|27356_28748_-	MFS transporter	NA	NA	NA	NA
AYK80861.1\|29544_30015_-	hypothetical protein	NA	NA	NA	NA
AYK80862.1\|30154_30319_-	hypothetical protein	NA	NA	NA	NA
AYK80863.1\|31830_32061_-	XRE family transcriptional regulator	A0A1P8CWU2	Bacillus_phage	2.1e-20	75.0
AYK80864.1\|32602_32983_-	hypothetical protein	NA	NA	NA	NA
AYK80865.1\|33060_33960_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYK80866.1\|33956_35111_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.4e-24	22.6
AYK84734.1\|35273_36821_+\|transposase	IS21 family transposase	NA	NA	NA	NA
AYK80867.1\|36817_37576_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
37621:37680	attL	NA	NA	NA	NA
AYK84735.1\|38618_39053_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AYK80868.1\|39236_39488_-	hypothetical protein	NA	NA	NA	NA
AYK80869.1\|39786_40638_-	toxin	O64021	Bacillus_phage	1.4e-85	60.3
AYK80870.1\|40818_41310_-	hypothetical protein	NA	NA	NA	NA
AYK80871.1\|41548_41839_-	hypothetical protein	NA	NA	NA	NA
AYK80872.1\|42435_42636_+	hypothetical protein	NA	NA	NA	NA
AYK80873.1\|42672_43758_+	DUF4917 family protein	NA	NA	NA	NA
AYK84736.1\|43773_43845_-	hypothetical protein	NA	NA	NA	NA
AYK80874.1\|44014_45778_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	3.3e-121	52.3
AYK80875.1\|45796_46261_+	SMI1/KNR4 family protein	NA	NA	NA	NA
AYK80876.1\|46306_47284_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	2.0e-64	71.4
AYK80877.1\|47339_47603_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	2.7e-24	66.7
AYK80878.1\|47617_47830_-	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-15	59.4
AYK80879.1\|47881_48052_-	XkdX family protein	NA	NA	NA	NA
AYK80880.1\|48048_48348_-	hypothetical protein	M4ZR44	Bacillus_phage	2.0e-39	79.2
AYK80881.1\|48363_49485_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	9.8e-196	92.5
AYK80882.1\|51109_52984_-	autolysin	D6R400	Bacillus_phage	5.5e-50	27.8
AYK80883.1\|52997_53831_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	3.5e-33	34.1
AYK80884.1\|53843_57584_-	hypothetical protein	A0A0S2SXL7	Bacillus_phage	9.1e-105	60.4
AYK80885.1\|57646_57829_-	hypothetical protein	NA	NA	NA	NA
AYK80886.1\|57840_58203_-	hypothetical protein	NA	NA	NA	NA
AYK80887.1\|58262_58847_-\|tail	major tail protein	U5U3Z7	Lactobacillus_phage	9.1e-28	36.5
AYK80888.1\|58852_59260_-	hypothetical protein	NA	NA	NA	NA
AYK80889.1\|59256_59649_-\|tail	phage tail protein	A0A0M5M1E5	Enterococcus_phage	3.0e-11	37.9
AYK80890.1\|59648_59975_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
AYK80891.1\|59964_60258_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JB77	uncultured_Caudovirales_phage	2.6e-07	33.0
AYK80892.1\|60312_60696_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-05	56.8
AYK80893.1\|60723_61932_-\|capsid	phage major capsid protein	A0A2H4J824	uncultured_Caudovirales_phage	4.9e-76	49.8
AYK80894.1\|61979_62576_-\|head,protease	HK97 family phage prohead protease	A0A1J0MFL1	Staphylococcus_phage	3.3e-49	53.8
AYK80895.1\|62568_63795_-\|portal	phage portal protein	A0A1J0MFU3	Staphylococcus_phage	2.4e-70	39.4
AYK80896.1\|63799_64006_-	hypothetical protein	NA	NA	NA	NA
AYK80897.1\|64022_65756_-\|terminase	terminase large subunit	A0A2H4JCI4	uncultured_Caudovirales_phage	2.1e-144	48.9
AYK80898.1\|65745_66231_-\|terminase	phage terminase small subunit P27 family	A0A1Q1PVW3	Staphylococcus_phage	4.2e-18	36.0
AYK80899.1\|66469_66676_-	hypothetical protein	NA	NA	NA	NA
AYK84737.1\|66678_67062_-	HNH endonuclease	A0A075M5R4	Enterococcus_phage	1.2e-17	43.3
AYK84738.1\|67433_67847_-	ArpU family transcriptional regulator	D6R428	Bacillus_phage	2.1e-63	97.0
AYK80900.1\|68100_68616_-	hypothetical protein	D6R425	Bacillus_phage	8.7e-91	93.0
AYK80901.1\|68650_69190_-	nuclease	Q9ZXC2	Bacillus_phage	1.8e-94	96.1
AYK80902.1\|69186_69624_-	hypothetical protein	Q9ZXC3	Bacillus_phage	4.8e-74	91.7
AYK80903.1\|69823_72241_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	88.7
AYK80904.1\|72301_72739_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	1.3e-79	97.2
AYK80905.1\|72759_73074_-	hypothetical protein	Q9ZXC6	Bacillus_phage	1.5e-53	99.0
AYK80906.1\|73063_73999_-	hypothetical protein	Q9ZXC7	Bacillus_phage	2.0e-170	96.5
AYK80907.1\|74002_74557_-	hypothetical protein	Q9ZXC8	Bacillus_phage	3.1e-94	96.2
AYK80908.1\|74752_75028_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.2e-19	47.1
AYK84739.1\|75024_75216_-	hypothetical protein	Q9ZXD0	Bacillus_phage	7.1e-06	53.1
AYK80909.1\|75276_75588_-	DNA-binding protein	NA	NA	NA	NA
AYK80910.1\|75603_76368_-	Rha family transcriptional regulator	A8ATN0	Listeria_phage	1.0e-47	49.1
AYK80911.1\|76482_76701_-	XRE family transcriptional regulator	A0A0K2CZL1	Paenibacillus_phage	2.1e-17	63.2
AYK80912.1\|76825_77212_+	XRE family transcriptional regulator	R9W020	Paenibacillus_phage	9.0e-08	31.4
AYK80913.1\|77195_78251_+	ImmA/IrrE family metallo-endopeptidase	A0A0F6N3H6	Staphylococcus_phage	1.7e-08	24.2
AYK80914.1\|78266_79424_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	8.3e-65	38.9
AYK80915.1\|79536_80871_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
AYK80916.1\|80929_81337_-	transcriptional repressor GlnR	NA	NA	NA	NA
AYK80917.1\|81446_82712_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AYK80918.1\|82729_83992_-	GTPase HflX	NA	NA	NA	NA
AYK80919.1\|84124_85093_-	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5
AYK80920.1\|85733_86501_+	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	1.2e-51	49.5
AYK80921.1\|86564_87185_-	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
AYK80922.1\|87234_88224_-	ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
AYK80923.1\|88241_90344_-	ribonucleotide-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
AYK80924.1\|90303_90696_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	2.5e-29	58.3
AYK80925.1\|90938_91169_-	hypothetical protein	NA	NA	NA	NA
AYK80926.1\|91250_91523_-	hypothetical protein	NA	NA	NA	NA
AYK80927.1\|91717_91939_-	RNA-binding protein Hfq	NA	NA	NA	NA
AYK80928.1\|91978_92923_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AYK80929.1\|93022_93436_-	hypothetical protein	NA	NA	NA	NA
AYK80930.1\|93524_93803_+	hypothetical protein	NA	NA	NA	NA
AYK80931.1\|93937_94255_+	multidrug resistance protein EbrA	NA	NA	NA	NA
AYK80932.1\|94268_94622_+	multidrug resistance protein EbrB	NA	NA	NA	NA
AYK80933.1\|94635_95088_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AYK80934.1\|95157_95865_-	hypothetical protein	F8WQ53	Bacillus_phage	3.2e-51	56.9
AYK80935.1\|96144_96378_-	hypothetical protein	NA	NA	NA	NA
AYK80936.1\|96602_97931_+\|protease	serine protease	A0A1B0T6A2	Bacillus_phage	1.2e-27	33.6
AYK80937.1\|98041_98866_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AYK80938.1\|98944_99301_+	hypothetical protein	NA	NA	NA	NA
AYK80939.1\|99439_100054_-	TetR family transcriptional regulator	NA	NA	NA	NA
AYK80940.1\|100174_100732_+	hypothetical protein	NA	NA	NA	NA
AYK80941.1\|100886_101342_+	hypothetical protein	NA	NA	NA	NA
AYK80942.1\|102388_103600_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
102399:102564	attR	NA	NA	NA	NA
AYK80943.1\|103887_104421_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5

DBSCAN-SWA_2

502055 : 577263

uncultured_Caudovirales_phage(25.0%)

tail,transposase,portal,holin,tRNA,protease,terminase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK81324.1\|502055_503015_+\|protease	serine protease	A0A127AWU5	Bacillus_phage	5.6e-75	49.5
AYK81325.1\|503430_505719_+	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
AYK81326.1\|505852_507205_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	1.4e-87	41.8
AYK81327.1\|507473_507944_+\|tRNA	tRNA-specific adenosine deaminase	S4VYZ2	Pandoravirus	1.8e-26	45.8
AYK81328.1\|508191_508602_-	organic hydroperoxide resistance protein	NA	NA	NA	NA
AYK81329.1\|508743_509187_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK81330.1\|509217_509643_-	organic hydroperoxide resistance protein OhrA	NA	NA	NA	NA
AYK81331.1\|509768_511016_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	4.2e-99	50.1
AYK81332.1\|511027_512125_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.3e-71	42.1
AYK81333.1\|512475_513378_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AYK81334.1\|513448_513766_-	multidrug efflux SMR transporter subunit YkkD	NA	NA	NA	NA
AYK81335.1\|513765_514104_-	multidrug resistance protein YkkC	NA	NA	NA	NA
AYK81336.1\|514325_514844_-	N-acetyltransferase	NA	NA	NA	NA
AYK81337.1\|514833_515361_-	DinB family protein	NA	NA	NA	NA
AYK81338.1\|515452_516184_-	DUF421 domain-containing protein	NA	NA	NA	NA
AYK81339.1\|516332_516557_+	hypothetical protein	NA	NA	NA	NA
AYK81340.1\|516633_517833_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
AYK84753.1\|518070_518589_-	acyl-CoA thioesterase	NA	NA	NA	NA
AYK81341.1\|519697_520747_+	6-phosphogluconolactonase	NA	NA	NA	NA
AYK81342.1\|520789_521779_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.2e-17	33.5
AYK81343.1\|521791_522682_-	NlpC/P60 family protein	A0A0A8WIF2	Clostridium_phage	5.3e-19	45.8
AYK81344.1\|522698_523778_-	dipeptide epimerase	NA	NA	NA	NA
AYK81345.1\|523774_524734_-	LD-carboxypeptidase	NA	NA	NA	NA
AYK84754.1\|524821_526471_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK81346.1\|526473_527481_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-15	28.7
AYK81347.1\|527485_528448_-	ABC transporter permease	NA	NA	NA	NA
AYK81348.1\|528453_529380_-	ABC transporter permease	NA	NA	NA	NA
AYK81349.1\|529396_530221_-	aminopeptidase	NA	NA	NA	NA
AYK81350.1\|530350_531169_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AYK81351.1\|531337_532687_+\|protease	serine protease HtrA	A0A1B1IT49	uncultured_Mediterranean_phage	3.4e-25	34.1
AYK81352.1\|533186_534158_-	glycosyltransferase	I1TED8	Salmonella_phage	2.5e-62	41.3
AYK84755.1\|534169_536320_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
AYK81353.1\|536536_537487_-	ring-cleaving dioxygenase	NA	NA	NA	NA
AYK81354.1\|537875_539192_+	amino acid permease	NA	NA	NA	NA
AYK81355.1\|539467_540085_+	DUF47 domain-containing protein	NA	NA	NA	NA
AYK81356.1\|540097_541099_+	low-affinity inorganic phosphate transporter	NA	NA	NA	NA
AYK81357.1\|541208_541955_+	type II toxin-antitoxin system SpoIISA family toxin	NA	NA	NA	NA
AYK81358.1\|541954_542125_+	type II toxin-antitoxin system SpoIISB family antitoxin	NA	NA	NA	NA
AYK81359.1\|542210_542348_+	hypothetical protein	NA	NA	NA	NA
AYK81360.1\|542385_543279_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.2e-83	69.2
AYK81361.1\|543291_543555_-\|holin	holin	A0A2H4J6M0	uncultured_Caudovirales_phage	6.1e-24	64.4
AYK81362.1\|543567_543837_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.4e-23	64.8
AYK81363.1\|543889_544729_-\|portal	phage portal protein	NA	NA	NA	NA
AYK81364.1\|544775_544940_-	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
AYK81365.1\|544936_545266_-\|portal	phage portal protein	A0A2H4JCI0	uncultured_Caudovirales_phage	1.3e-15	40.7
AYK81366.1\|545277_547341_-\|terminase	terminase	A0A2H4J4R1	uncultured_Caudovirales_phage	2.6e-29	34.5
AYK81367.1\|547343_547616_-	hypothetical protein	NA	NA	NA	NA
AYK81368.1\|547612_548191_-	phage-like element PBSX protein XkdU	A0A2H4J717	uncultured_Caudovirales_phage	3.9e-15	34.2
AYK81369.1\|548174_549221_-\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	1.3e-72	44.3
AYK81370.1\|549213_549639_-	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	3.0e-12	38.0
AYK81371.1\|549696_549963_-	phage-like element PBSX protein XkdR	S6C459	Thermus_phage	1.7e-05	36.4
AYK81372.1\|549962_550940_-	phage-like element PBSX protein XkdQ	H7BV96	unidentified_phage	1.0e-39	32.6
AYK81373.1\|550955_551615_-	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	1.1e-24	33.2
AYK81374.1\|551607_556611_-\|portal	phage portal protein	A0A2H4JA91	uncultured_Caudovirales_phage	6.4e-37	44.8
AYK81375.1\|556611_556752_-	hypothetical protein	NA	NA	NA	NA
AYK81376.1\|556793_557240_-\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	1.0e-10	36.8
AYK81377.1\|557331_557775_-	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.9e-25	44.5
AYK81378.1\|557776_559177_-\|tail	phage tail sheath protein	A0A0A7S087	Clostridium_phage	3.0e-77	39.3
AYK81379.1\|559173_559392_-	hypothetical protein	NA	NA	NA	NA
AYK81380.1\|559395_559836_-\|portal	phage portal protein	NA	NA	NA	NA
AYK81381.1\|559848_560334_-	phage-like element PBSX protein XkdI	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
AYK81382.1\|560330_560687_-	phage-like element PBSX protein XkdH	NA	NA	NA	NA
AYK81383.1\|560683_561067_-	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	1.4e-13	40.5
AYK81384.1\|561088_562024_-	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
AYK81385.1\|562049_562877_-\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	1.6e-54	59.2
AYK81386.1\|562896_564384_-	phage-like element PBSX protein XkdE	A0A1B1P7C8	Bacillus_phage	1.7e-139	55.7
AYK81387.1\|564387_565689_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	9.1e-153	60.0
AYK81388.1\|565685_566483_-\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	8.0e-59	50.2
AYK81389.1\|566598_567108_-	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
AYK81390.1\|567223_567430_-	phage-like element PBSX protein XtrA	A0A2H4J4M6	uncultured_Caudovirales_phage	2.1e-11	50.0
AYK81391.1\|567426_567777_-\|portal	phage portal protein	NA	NA	NA	NA
AYK81392.1\|567861_568029_-	hypothetical protein	NA	NA	NA	NA
AYK81393.1\|568028_568829_-	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
AYK81394.1\|568728_569565_-\|portal	phage portal protein	S6BFM4	Thermus_phage	6.7e-24	27.8
AYK81395.1\|569551_569731_-	hypothetical protein	NA	NA	NA	NA
AYK81396.1\|569909_570251_+	transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
AYK81397.1\|570413_571010_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
AYK81398.1\|571965_572568_-	hypothetical protein	F8WQ53	Bacillus_phage	1.4e-44	48.7
AYK81399.1\|572672_573050_+	PH domain-containing protein	A5GYQ0	Lactococcus_phage	7.9e-17	42.3
AYK81400.1\|573089_574043_-	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	1.6e-66	73.8
AYK81401.1\|574440_574575_-	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
AYK81402.1\|574564_575701_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
AYK81403.1\|576113_577263_+\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2

DBSCAN-SWA_3

611973 : 661517

Bacillus_phage(55.56%)

transposase,tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK81434.1\|611973_612207_+\|coat	spore coat protein	NA	NA	NA	NA
AYK81435.1\|612339_613320_+	protoheme IX farnesyltransferase	NA	NA	NA	NA
AYK81436.1\|613338_613560_-	hypothetical protein	NA	NA	NA	NA
AYK81437.1\|613868_614198_+	DUF4306 domain-containing protein	NA	NA	NA	NA
AYK81438.1\|614329_614524_+	DUF4177 domain-containing protein	NA	NA	NA	NA
AYK81439.1\|614563_615043_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AYK81440.1\|615271_615667_+	hypothetical protein	NA	NA	NA	NA
AYK81441.1\|615885_616392_+	N-acetyltransferase	NA	NA	NA	NA
AYK81442.1\|616522_617734_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	2.2e-23	26.8
AYK81443.1\|617806_618298_-	DUF2992 family protein	NA	NA	NA	NA
AYK81444.1\|618467_619415_-	mannose-6-phosphate isomerase ManA	NA	NA	NA	NA
AYK81445.1\|619429_621382_-	PTS mannose transporter subunit IIABC	NA	NA	NA	NA
AYK81446.1\|621530_623477_-	PRD domain-containing protein	NA	NA	NA	NA
AYK81447.1\|623784_624102_-	hypothetical protein	NA	NA	NA	NA
AYK81448.1\|624216_624534_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AYK81449.1\|624966_625158_+	hypothetical protein	NA	NA	NA	NA
AYK81450.1\|625660_625861_+	hypothetical protein	NA	NA	NA	NA
AYK81451.1\|625989_626505_+	hypothetical protein	NA	NA	NA	NA
AYK81452.1\|627179_627773_-	hypothetical protein	NA	NA	NA	NA
AYK81453.1\|628628_629021_-	hypothetical protein	NA	NA	NA	NA
AYK81454.1\|629035_629347_-	hypothetical protein	NA	NA	NA	NA
AYK81455.1\|629484_629724_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK81456.1\|630098_630386_+	hypothetical protein	NA	NA	NA	NA
AYK81457.1\|630543_630849_+	hypothetical protein	NA	NA	NA	NA
AYK81458.1\|630892_632140_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AYK81459.1\|632272_632731_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AYK81460.1\|632733_634509_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	5.8e-126	57.3
AYK81461.1\|634856_635972_+	tetratricopeptide repeat protein	D6R410	Bacillus_phage	2.4e-146	71.9
AYK81462.1\|636329_636557_+	hypothetical protein	NA	NA	NA	NA
AYK81463.1\|636645_636912_-	YgiT-type zinc finger protein	NA	NA	NA	NA
AYK81464.1\|636952_637540_-	hypothetical protein	NA	NA	NA	NA
AYK81465.1\|639906_640122_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK81466.1\|640187_641705_+	glycosyltransferase	NA	NA	NA	NA
AYK81467.1\|643401_644571_-	hypothetical protein	M4ZSB3	Bacillus_phage	2.0e-87	41.8
AYK84757.1\|645510_645786_-	XRE family transcriptional regulator	NA	NA	NA	NA
AYK81468.1\|645951_646323_+	helix-turn-helix domain-containing protein	A0A2H4J6F9	uncultured_Caudovirales_phage	5.1e-16	46.8
AYK81469.1\|646685_647207_+	hypothetical protein	NA	NA	NA	NA
AYK81470.1\|647219_647567_+	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	8.6e-18	67.6
AYK81471.1\|649430_649610_-	hypothetical protein	NA	NA	NA	NA
AYK81472.1\|649604_650795_+	DUF819 domain-containing protein	NA	NA	NA	NA
AYK81473.1\|650864_651410_+	N-acetyltransferase	NA	NA	NA	NA
AYK81474.1\|651442_652615_-	cystathionine beta-lyase MetC	NA	NA	NA	NA
AYK84758.1\|652607_653729_-	cystathionine gamma-synthase/O-acetylhomoserine thiolyase	A0A0B5JD48	Pandoravirus	3.7e-17	26.3
AYK81475.1\|654084_654807_+	esterase family protein	NA	NA	NA	NA
AYK81476.1\|654843_655359_+	hypothetical protein	NA	NA	NA	NA
AYK81477.1\|655362_655785_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK81478.1\|655857_656112_-	hypothetical protein	NA	NA	NA	NA
AYK81479.1\|656228_658508_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	3.5e-91	34.9
AYK81480.1\|658581_658836_-	sporulation-specific transcription factor SpoVIF	NA	NA	NA	NA
AYK81481.1\|658968_659118_-	sporulation protein YjcZ	NA	NA	NA	NA
AYK81482.1\|659199_659406_-	hypothetical protein	NA	NA	NA	NA
AYK81483.1\|659687_660044_-	DUF1360 domain-containing protein	NA	NA	NA	NA
AYK81484.1\|660203_660590_+\|coat	spore coat protein	NA	NA	NA	NA
AYK81485.1\|660629_660950_+\|coat	spore coat protein	NA	NA	NA	NA
AYK81486.1\|661034_661517_+\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_4

1204132 : 1212498

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK81981.1\|1204132_1204720_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.4e-28	41.0
AYK81982.1\|1204716_1205757_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.7e-64	42.0
AYK81983.1\|1205858_1207289_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
AYK81984.1\|1207264_1209493_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.8e-159	40.1
AYK81985.1\|1209476_1210160_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AYK81986.1\|1210156_1210411_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AYK81987.1\|1210403_1211129_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	1.2e-45	44.1
AYK81988.1\|1211202_1212498_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7

DBSCAN-SWA_5

1962476 : 2042439

Bacillus_phage(23.81%)

transposase,holin,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK82655.1\|1962476_1963679_+\|protease	serine protease	W5SAB9	Pithovirus	5.9e-13	40.4
AYK82656.1\|1963993_1965379_-	arginine utilization regulatory protein RocR	NA	NA	NA	NA
AYK84804.1\|1965605_1965890_+	ArsR family transcriptional regulator	A0A218MNF3	uncultured_virus	2.8e-06	41.3
AYK84805.1\|1965889_1966525_+	SdpI family protein	NA	NA	NA	NA
AYK82657.1\|1966708_1967263_+	SdpA family antimicrobial peptide system protein	NA	NA	NA	NA
AYK82658.1\|1967247_1968201_+	hypothetical protein	NA	NA	NA	NA
AYK82659.1\|1968262_1968865_+	sporulation delaying protein family toxin	NA	NA	NA	NA
AYK82660.1\|1969196_1970402_+	ornithine aminotransferase	A0A1V0SKB7	Klosneuvirus	2.0e-29	28.5
AYK82661.1\|1970624_1972028_+	amino-acid permease RocE	NA	NA	NA	NA
AYK82662.1\|1972100_1972991_+	arginase	A0A1V0SJM8	Klosneuvirus	2.0e-26	29.1
AYK82663.1\|1973227_1973344_-	phosphatase RapG inhibitor	NA	NA	NA	NA
AYK82664.1\|1973344_1974442_-	transcriptional regulator	D6R410	Bacillus_phage	6.0e-73	39.3
AYK82665.1\|1974552_1975023_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK82666.1\|1975164_1975902_+	hypothetical protein	NA	NA	NA	NA
AYK82667.1\|1975912_1977070_+	hypothetical protein	NA	NA	NA	NA
AYK82668.1\|1977085_1977334_+	DUF2651 domain-containing protein	NA	NA	NA	NA
AYK82669.1\|1977438_1977609_+	hypothetical protein	NA	NA	NA	NA
AYK82670.1\|1977671_1978898_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.1e-11	29.3
AYK82671.1\|1978931_1979345_-	hypothetical protein	NA	NA	NA	NA
AYK82672.1\|1979529_1979700_+	CxxH/CxxC protein	NA	NA	NA	NA
AYK82673.1\|1979780_1980260_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AYK82674.1\|1980547_1981456_+	hypothetical protein	NA	NA	NA	NA
AYK82675.1\|1981412_1984535_+	DEAD/DEAH box helicase	A7WKM3	Acidianus_filamentous_virus	6.6e-08	26.4
AYK82676.1\|1984799_1985117_+\|transposase	transposase	NA	NA	NA	NA
AYK82677.1\|1985305_1985455_+\|transposase	transposase	NA	NA	NA	NA
AYK82678.1\|1985526_1985844_+\|transposase	transposase	NA	NA	NA	NA
AYK82679.1\|1985840_1986755_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
AYK82680.1\|1986885_1987242_+\|transposase	transposase	NA	NA	NA	NA
AYK82681.1\|1987217_1987424_+	hypothetical protein	NA	NA	NA	NA
AYK84806.1\|1987807_1988071_+	hypothetical protein	NA	NA	NA	NA
AYK82682.1\|1988769_1989048_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	7.3e-44	100.0
AYK82683.1\|1989032_1989479_+	hypothetical protein	A0A1P8CWQ3	Bacillus_phage	3.2e-57	97.5
AYK82684.1\|1989559_1990474_-\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	4.0e-06	22.9
AYK82685.1\|1990470_1990788_-\|transposase	transposase	NA	NA	NA	NA
AYK82686.1\|1991845_1993879_+	DUF2813 domain-containing protein	NA	NA	NA	NA
AYK82687.1\|1993859_1995743_+	ATP-dependent helicase	S5MMD7	Bacillus_phage	6.6e-19	21.8
AYK82688.1\|1995977_1997441_-	hypothetical protein	A0A0S2MYH0	Enterococcus_phage	1.0e-11	36.0
AYK82689.1\|1997852_1998239_+	hypothetical protein	NA	NA	NA	NA
AYK84807.1\|1998368_1999916_+\|transposase	IS21 family transposase	NA	NA	NA	NA
AYK82690.1\|1999912_2000671_+	ATP-binding protein	U5N3V8	Enterobacteria_phage	5.8e-43	38.6
AYK82691.1\|2000910_2001090_-	hypothetical protein	NA	NA	NA	NA
AYK82692.1\|2001090_2001531_-	Hsp20/alpha crystallin family protein	A0A1B2LRT2	Wolbachia_phage	3.4e-11	34.4
AYK82693.1\|2002011_2002362_+	hypothetical protein	NA	NA	NA	NA
AYK82694.1\|2002812_2004738_-	fructose-bisphosphatase class III	NA	NA	NA	NA
AYK82695.1\|2005218_2005848_+	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
AYK82696.1\|2005868_2006591_+	peptide ABC transporter permease	NA	NA	NA	NA
AYK82697.1\|2006681_2007392_-	GntR family transcriptional regulator	NA	NA	NA	NA
AYK82698.1\|2007958_2009398_+	6-phospho-beta-glucosidase	NA	NA	NA	NA
AYK82699.1\|2009508_2011038_-	alkyl hydroperoxide reductase subunit F	A0A1V0SIN1	Klosneuvirus	1.0e-33	29.3
AYK82700.1\|2011051_2011615_-	peroxiredoxin	NA	NA	NA	NA
AYK82701.1\|2012080_2013487_-	phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	E3SJC4	Synechococcus_phage	1.7e-32	30.6
AYK82702.1\|2013509_2014856_-	gluconate permease	NA	NA	NA	NA
AYK82703.1\|2014884_2016426_-	gluconokinase	NA	NA	NA	NA
AYK82704.1\|2016418_2017150_-	gluconate operon transcriptional regulator	NA	NA	NA	NA
AYK82705.1\|2017345_2018494_+	glycerate kinase	W6LM47	Streptococcus_phage	1.4e-48	42.3
AYK82706.1\|2018586_2019618_+	general stress protein 30	NA	NA	NA	NA
AYK82707.1\|2019657_2020350_-	LrgB family protein	NA	NA	NA	NA
AYK82708.1\|2020319_2020724_-\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA
AYK82709.1\|2020950_2021382_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK82710.1\|2021440_2022511_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYK82711.1\|2022641_2023217_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYK82712.1\|2023310_2024345_+	cupin domain-containing protein	NA	NA	NA	NA
AYK82713.1\|2024463_2024652_-	hypothetical protein	NA	NA	NA	NA
AYK82714.1\|2024753_2026223_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AYK82715.1\|2026223_2028407_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.7e-50	30.8
AYK82716.1\|2028570_2028825_-	hypothetical protein	NA	NA	NA	NA
AYK82717.1\|2029102_2030227_-\|transposase	IS4 family transposase IS4Bsu1	NA	NA	NA	NA
AYK82718.1\|2030548_2030770_+	hypothetical protein	NA	NA	NA	NA
AYK82719.1\|2030814_2031033_+\|bacteriocin	bacteriocin leader domain-containing protein	NA	NA	NA	NA
AYK82720.1\|2031236_2031638_-	hypothetical protein	NA	NA	NA	NA
AYK82721.1\|2031655_2031856_-	transcriptional regulator	NA	NA	NA	NA
AYK82722.1\|2033047_2033299_+	hypothetical protein	NA	NA	NA	NA
AYK82723.1\|2033466_2035347_+	molecular chaperone HtpG	A0A1V0SAD6	Catovirus	1.1e-93	33.4
AYK82724.1\|2036892_2037405_-	HPP family protein	NA	NA	NA	NA
AYK82725.1\|2038161_2038632_+	hypothetical protein	NA	NA	NA	NA
AYK82726.1\|2038735_2039050_-	DUF2628 domain-containing protein	L7TIP7	Escherichia_phage	1.6e-10	47.0
AYK82727.1\|2039279_2040212_-	aldo/keto reductase	NA	NA	NA	NA
AYK82728.1\|2040265_2041021_-	DeoR family transcriptional regulator	NA	NA	NA	NA
AYK82729.1\|2041314_2042439_+\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2189338 : 2303897

114

Bacillus_phage(23.53%)

holin,tRNA,coat,lysis,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK82861.1\|2189338_2190580_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
AYK82862.1\|2190830_2191346_-	MarR family transcriptional regulator	NA	NA	NA	NA
AYK82863.1\|2191496_2192210_+	TIGR02206 family membrane protein	NA	NA	NA	NA
AYK82864.1\|2192320_2193181_+	glycosyltransferase family 8 protein	A0A2P0VP84	Tetraselmis_virus	1.9e-05	26.4
AYK82865.1\|2193233_2194076_-	levansucrase and sucrase synthesis operon antiterminator	NA	NA	NA	NA
AYK82866.1\|2194129_2195509_-	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
AYK82867.1\|2198099_2199422_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AYK82868.1\|2199513_2200191_+	DUF2711 family protein	NA	NA	NA	NA
AYK82869.1\|2200229_2200610_-	VOC family protein	NA	NA	NA	NA
AYK82870.1\|2200730_2201918_+	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.2e-74	42.0
AYK82871.1\|2201952_2202150_-	YwbE family protein	NA	NA	NA	NA
AYK82872.1\|2202183_2203386_-	MFS transporter	NA	NA	NA	NA
AYK82873.1\|2203490_2204168_-\|lysis	CidB/LrgB family autolysis modulator	NA	NA	NA	NA
AYK82874.1\|2204149_2204536_-\|holin	holin-like protein CidA	NA	NA	NA	NA
AYK82875.1\|2204641_2205547_+	LysR family transcriptional regulator	NA	NA	NA	NA
AYK82876.1\|2205554_2206373_+	hydroxyethylthiazole kinase	NA	NA	NA	NA
AYK82877.1\|2206369_2207038_+	thiamine phosphate synthase	NA	NA	NA	NA
AYK82878.1\|2207194_2208637_+	iron transporter	NA	NA	NA	NA
AYK82879.1\|2208633_2209791_+	Efem/EfeO family lipoprotein	NA	NA	NA	NA
AYK82880.1\|2209809_2211060_+	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
AYK82881.1\|2211342_2211945_+	DsbA family protein	NA	NA	NA	NA
AYK82882.1\|2211974_2213516_-	cation acetate symporter	NA	NA	NA	NA
AYK82883.1\|2213512_2213821_-	DUF485 domain-containing protein	NA	NA	NA	NA
AYK82884.1\|2214263_2214422_-	DNA-binding anti-repressor SinI	NA	NA	NA	NA
AYK82885.1\|2214776_2215448_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYK82886.1\|2215465_2215849_+	GtrA family protein	NA	NA	NA	NA
AYK82887.1\|2215926_2217099_+	galactokinase	NA	NA	NA	NA
AYK82888.1\|2217102_2218644_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AYK84811.1\|2218714_2218960_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AYK84812.1\|2219475_2220441_+	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
AYK82889.1\|2220468_2222418_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AYK82890.1\|2222431_2223046_+	Quinol oxidase subunit 3	NA	NA	NA	NA
AYK82891.1\|2223047_2223422_+	quinol oxidase subunit 4	NA	NA	NA	NA
AYK82892.1\|2223463_2223727_-	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
AYK82893.1\|2223955_2225101_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK82894.1\|2225309_2226491_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AYK82895.1\|2226596_2227346_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
AYK82896.1\|2227519_2228521_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
AYK82897.1\|2228558_2230979_-	peptidase S8	A0A217EQY2	Bacillus_phage	5.3e-21	38.2
AYK84813.1\|2231508_2231811_+	hypothetical protein	NA	NA	NA	NA
AYK82898.1\|2232720_2233491_-	transporter	NA	NA	NA	NA
AYK82899.1\|2233792_2235178_+	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
AYK82900.1\|2235174_2236614_+	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.7e-22	26.8
AYK82901.1\|2236707_2236956_+	hypothetical protein	NA	NA	NA	NA
AYK82902.1\|2237046_2237862_-	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AYK82903.1\|2238053_2238860_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AYK82904.1\|2238873_2239551_+	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
AYK82905.1\|2239575_2240946_-	aldehyde dehydrogenase	NA	NA	NA	NA
AYK82906.1\|2241113_2241431_+	hypothetical protein	NA	NA	NA	NA
AYK82907.1\|2241450_2242773_+	purine permease	NA	NA	NA	NA
AYK82908.1\|2242834_2243206_+	DUF423 domain-containing protein	NA	NA	NA	NA
AYK82909.1\|2243249_2243795_-\|coat	spore coat protein GerQ	NA	NA	NA	NA
AYK82910.1\|2243942_2244122_+	hypothetical protein	NA	NA	NA	NA
AYK82911.1\|2244114_2244885_+	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	4.4e-06	28.6
AYK82912.1\|2244889_2246314_+	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
AYK82913.1\|2246334_2247504_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	1.2e-15	28.1
AYK82914.1\|2247504_2248374_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK82915.1\|2248373_2249495_+\|coat	spore coat biosynthesis protein SpsE	NA	NA	NA	NA
AYK82916.1\|2249487_2250210_+\|coat	spore coat protein	NA	NA	NA	NA
AYK82917.1\|2250212_2251232_+\|coat	spore coat protein	NA	NA	NA	NA
AYK82918.1\|2251256_2251997_+	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.5e-48	41.9
AYK82919.1\|2251996_2252944_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	4.4e-72	43.8
AYK82920.1\|2252957_2253809_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.3e-38	38.9
AYK82921.1\|2253801_2254257_+\|coat	spore coat protein	NA	NA	NA	NA
AYK82922.1\|2254580_2255045_+	hypothetical protein	NA	NA	NA	NA
AYK82923.1\|2255222_2256497_+	catabolic NAD-specific glutamate dehydrogenase RocG	NA	NA	NA	NA
AYK82924.1\|2256723_2258271_+	L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AYK82925.1\|2258344_2260045_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
AYK82926.1\|2260044_2261457_+	amino acid permease	NA	NA	NA	NA
AYK82927.1\|2261666_2262905_+	MFS transporter	NA	NA	NA	NA
AYK82928.1\|2263056_2263671_+	bacilysin biosynthesis protein BacA	NA	NA	NA	NA
AYK82929.1\|2263660_2264368_+	bacilysin biosynthesis protein BacB	NA	NA	NA	NA
AYK84814.1\|2264370_2265132_+	dihydroanticapsin 7-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-21	30.9
AYK82930.1\|2265150_2266569_+	alanine-anticapsin ligase BacD	NA	NA	NA	NA
AYK82931.1\|2266565_2267750_+	MFS transporter	NA	NA	NA	NA
AYK82932.1\|2267750_2268965_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AYK82933.1\|2268980_2269760_-	SDR family oxidoreductase	NA	NA	NA	NA
AYK82934.1\|2269892_2270657_-	heme-binding protein	NA	NA	NA	NA
AYK82935.1\|2270926_2271898_+	phosphate acetyltransferase	NA	NA	NA	NA
AYK82936.1\|2272043_2272943_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	3.6e-07	42.5
AYK82937.1\|2272991_2273837_+	lipoate--protein ligase family protein	NA	NA	NA	NA
AYK82938.1\|2274005_2274896_+	DMT family transporter	NA	NA	NA	NA
AYK82939.1\|2275039_2275816_-	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	7.6e-06	50.0
AYK82940.1\|2276030_2276255_+	DUF1450 domain-containing protein	NA	NA	NA	NA
AYK82941.1\|2276416_2277718_+	HD domain-containing protein	E3T4P8	Cafeteria_roenbergensis_virus	4.2e-25	28.9
AYK82942.1\|2277753_2278254_+	YwgA family protein	NA	NA	NA	NA
AYK82943.1\|2278365_2278836_+	transcriptional regulator	NA	NA	NA	NA
AYK82944.1\|2278835_2280236_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
AYK82945.1\|2280315_2280471_+	hypothetical protein	NA	NA	NA	NA
AYK82946.1\|2281080_2282997_+\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	1.9e-143	43.4
AYK82947.1\|2283116_2283536_+	MarR family transcriptional regulator	NA	NA	NA	NA
AYK82948.1\|2283578_2283767_-	2-hydroxymuconate tautomerase	NA	NA	NA	NA
AYK82949.1\|2283875_2284535_+\|protease	site-2 protease family protein	NA	NA	NA	NA
AYK82950.1\|2284548_2285067_+	hypothetical protein	NA	NA	NA	NA
AYK82951.1\|2285205_2285640_+	hypothetical protein	NA	NA	NA	NA
AYK82952.1\|2285667_2287743_-	penicillin-binding protein	NA	NA	NA	NA
AYK82953.1\|2287944_2288775_+	spermidine synthase	NA	NA	NA	NA
AYK82954.1\|2288835_2289708_+	agmatinase	NA	NA	NA	NA
AYK82955.1\|2289642_2290200_-	YbaK/EbsC family protein	NA	NA	NA	NA
AYK82956.1\|2290297_2290417_-	phosphatase RapF inhibitor	NA	NA	NA	NA
AYK82957.1\|2290400_2291546_-	transcriptional regulator	A0A1P8CWN8	Bacillus_phage	1.7e-78	43.5
AYK82958.1\|2291775_2293131_+	YncE family protein	NA	NA	NA	NA
AYK82959.1\|2293169_2294546_+	YncE family protein	NA	NA	NA	NA
AYK82960.1\|2294551_2295253_-\|bacteriocin	bacteriocin biosynthesis protein AlbG	NA	NA	NA	NA
AYK82961.1\|2295249_2296530_-	insulinase family protein	NA	NA	NA	NA
AYK84815.1\|2296534_2297695_-	insulinase family protein	NA	NA	NA	NA
AYK82962.1\|2297684_2298995_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
AYK82963.1\|2298987_2299707_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	27.2
AYK82964.1\|2299703_2299865_-\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
AYK82965.1\|2299877_2301224_-	subtilosin maturase AlbA	NA	NA	NA	NA
AYK82966.1\|2301248_2301401_-\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
AYK82967.1\|2301357_2301489_-\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
AYK82968.1\|2301801_2302230_+	DUF1934 domain-containing protein	NA	NA	NA	NA
AYK82969.1\|2302226_2303897_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_7

2598612 : 2636195

Bacillus_phage(33.33%)

tail,capsid,portal,holin,integrase,protease,plate

attL 2599505:2599558|attR 2636334:2636387

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK83250.1\|2598612_2599206_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.6e-54	55.8
2599505:2599558	attL	NA	NA	NA	NA
AYK83251.1\|2599751_2600741_+	DNA integration/recombination/inversion protein	A0A0U4IBS1	Pseudomonas_phage	2.7e-08	28.1
AYK83252.1\|2600899_2601631_+	helix-turn-helix domain-containing protein	A0A288WFX2	Bacillus_phage	6.7e-20	32.7
AYK83253.1\|2601661_2601844_-	hypothetical protein	NA	NA	NA	NA
AYK83254.1\|2601903_2602137_-	transcriptional regulator	NA	NA	NA	NA
AYK83255.1\|2602725_2603061_+	hypothetical protein	NA	NA	NA	NA
AYK83256.1\|2603262_2603478_-	XRE family transcriptional regulator	A0A1P8CWW6	Bacillus_phage	1.7e-08	50.8
AYK83257.1\|2603598_2604774_+	hypothetical protein	NA	NA	NA	NA
AYK83258.1\|2605307_2605850_+	hypothetical protein	NA	NA	NA	NA
AYK83259.1\|2606211_2606553_+	hypothetical protein	NA	NA	NA	NA
AYK83260.1\|2606545_2606746_+	hypothetical protein	NA	NA	NA	NA
AYK83261.1\|2607377_2607626_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK83262.1\|2607622_2608006_+	hypothetical protein	NA	NA	NA	NA
AYK83263.1\|2608073_2608445_+	DUF134 domain-containing protein	NA	NA	NA	NA
AYK83264.1\|2609305_2609584_+	hypothetical protein	NA	NA	NA	NA
AYK83265.1\|2609580_2610123_+	hypothetical protein	NA	NA	NA	NA
AYK83266.1\|2611167_2611347_+	hypothetical protein	NA	NA	NA	NA
AYK83267.1\|2611599_2611911_+	hypothetical protein	NA	NA	NA	NA
AYK83268.1\|2612284_2612494_+	hypothetical protein	NA	NA	NA	NA
AYK83269.1\|2612523_2613072_-\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	7.0e-38	51.6
AYK83270.1\|2613155_2614916_+	hypothetical protein	A0A142F1L6	Bacillus_phage	8.3e-133	44.8
AYK83271.1\|2614932_2615367_+	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.5e-27	49.3
AYK83272.1\|2615371_2617042_+\|portal	phage portal protein	A0A2H4J180	uncultured_Caudovirales_phage	1.5e-155	55.3
AYK83273.1\|2617041_2617854_+\|capsid	minor capsid protein	A0A0N9SJR1	Paenibacillus_phage	8.1e-75	52.7
AYK83274.1\|2617959_2618520_+	ribonucleoside-triphosphate reductase	NA	NA	NA	NA
AYK83275.1\|2618551_2619460_+\|capsid	phage major capsid protein	A0A0N9S7T7	Paenibacillus_phage	1.4e-80	52.5
AYK83276.1\|2619516_2619708_+	hypothetical protein	NA	NA	NA	NA
AYK83277.1\|2619725_2620118_+	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	7.5e-18	39.5
AYK83278.1\|2620118_2620457_+	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	8.1e-21	47.3
AYK83279.1\|2620453_2620861_+	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	2.1e-31	55.5
AYK83280.1\|2620865_2621240_+	hypothetical protein	NA	NA	NA	NA
AYK83281.1\|2621280_2621850_+	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	1.0e-52	63.0
AYK84826.1\|2621936_2622293_+	hypothetical protein	NA	NA	NA	NA
AYK83282.1\|2622388_2622610_+	hypothetical protein	NA	NA	NA	NA
AYK83283.1\|2622614_2625437_+\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	6.7e-68	36.4
AYK83284.1\|2625440_2626859_+\|tail	phage tail protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.3e-56	42.4
AYK83285.1\|2626873_2628268_+	endopeptidase	A6M966	Geobacillus_virus	3.0e-37	30.3
AYK83286.1\|2628280_2629858_+	hypothetical protein	M4ZSB3	Bacillus_phage	3.3e-258	86.8
AYK83287.1\|2629894_2631118_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	4.1e-163	74.9
AYK83288.1\|2631133_2631427_+	hypothetical protein	M4ZR44	Bacillus_phage	1.6e-41	80.2
AYK83289.1\|2631427_2631598_+	XkdX family protein	M4ZS22	Bacillus_phage	1.1e-10	68.1
AYK83290.1\|2631622_2631826_+	hypothetical protein	A0A290GDY2	Caldibacillus_phage	1.9e-09	46.5
AYK83291.1\|2631898_2632846_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	2.5e-91	62.7
AYK83292.1\|2632865_2633123_+\|holin	holin	A0A0U4JE55	Bacillus_phage	5.6e-22	57.6
AYK83293.1\|2633244_2633547_+	hypothetical protein	NA	NA	NA	NA
AYK83294.1\|2633588_2634221_-	hypothetical protein	Q0H249	Geobacillus_phage	7.2e-63	57.1
AYK83295.1\|2634207_2635392_-	DNA translocase FtsK	Q0H250	Geobacillus_phage	1.3e-108	53.4
AYK83296.1\|2635404_2635683_-	hypothetical protein	NA	NA	NA	NA
AYK83297.1\|2635961_2636195_+	helix-turn-helix domain-containing protein	B3RH35	Bacillus_virus	4.3e-21	62.0
2636334:2636387	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2715977 : 2766346

Bacillus_phage(71.79%)

tail,capsid,portal,holin,protease,terminase,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK83367.1\|2715977_2716631_+\|holin	choline ABC transporter permease	NA	NA	NA	NA
AYK83368.1\|2716642_2717563_+	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
AYK83369.1\|2717579_2718260_+	ABC transporter permease	NA	NA	NA	NA
AYK83370.1\|2718300_2720001_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-24	29.8
AYK83371.1\|2720128_2720455_-	HxlR family transcriptional regulator	NA	NA	NA	NA
AYK83372.1\|2720546_2720966_-	XRE family transcriptional regulator	S6C481	Thermus_phage	5.4e-14	62.7
AYK83373.1\|2720995_2721403_-	transcriptional regulator	S6C481	Thermus_phage	1.9e-16	64.8
AYK83374.1\|2721554_2721788_+	transcriptional regulator	NA	NA	NA	NA
AYK83375.1\|2721821_2722595_-	alpha/beta hydrolase	NA	NA	NA	NA
AYK83376.1\|2722743_2722974_+	preprotein translocase subunit SecG	NA	NA	NA	NA
AYK83377.1\|2723105_2723846_+	carboxylesterase	NA	NA	NA	NA
AYK83378.1\|2723864_2726204_+	ribonuclease R	Q0GXV6	Lactococcus_phage	2.4e-87	42.9
AYK83379.1\|2726348_2726819_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.2e-47	63.4
AYK83380.1\|2728743_2729844_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK83381.1\|2730276_2730675_-	XRE family transcriptional regulator	S5M5X8	Brevibacillus_phage	4.3e-05	33.7
AYK83382.1\|2730909_2731113_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYK83383.1\|2731164_2731356_+	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.0e-12	59.0
AYK83384.1\|2731380_2731599_+	hypothetical protein	NA	NA	NA	NA
AYK83385.1\|2731591_2732473_+	replication protein	V9QKF6	Oenococcus_phage	6.8e-27	33.1
AYK83386.1\|2732456_2733284_+	ATP-binding protein	A0A0U3U1U1	Bacillus_phage	3.7e-35	35.9
AYK83387.1\|2733598_2734147_+	hypothetical protein	NA	NA	NA	NA
AYK83388.1\|2734254_2734395_+	BH0509 family protein	NA	NA	NA	NA
AYK83389.1\|2734641_2734839_+	hypothetical protein	NA	NA	NA	NA
AYK83390.1\|2734881_2735244_+	VWA domain-containing protein	NA	NA	NA	NA
AYK83391.1\|2735240_2735558_+	hypothetical protein	NA	NA	NA	NA
AYK83392.1\|2735554_2735962_+	hypothetical protein	W8CYU3	Bacillus_phage	1.3e-25	45.8
AYK83393.1\|2735958_2736216_+	hypothetical protein	A0A2H4JA61	uncultured_Caudovirales_phage	6.6e-07	41.7
AYK83394.1\|2736333_2736990_+	dUTPase	R9TQ23	Paenibacillus_phage	9.9e-39	46.0
AYK83395.1\|2736989_2737322_+	hypothetical protein	F8WQ59	Bacillus_phage	8.3e-18	53.3
AYK83396.1\|2737318_2737738_+	hypothetical protein	A0A2I6UHP7	Bacillus_phage	1.6e-42	61.2
AYK83397.1\|2737734_2737935_+	hypothetical protein	NA	NA	NA	NA
AYK83398.1\|2738188_2738641_+	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	3.4e-38	56.6
AYK83399.1\|2739831_2740215_+	hypothetical protein	NA	NA	NA	NA
AYK83400.1\|2740365_2741139_+	hypothetical protein	NA	NA	NA	NA
AYK83401.1\|2741529_2742276_+	hypothetical protein	NA	NA	NA	NA
AYK84830.1\|2742325_2742700_+	HNH endonuclease	Q38456	Bacillus_phage	7.5e-60	82.3
AYK83402.1\|2743079_2743613_+\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	1.0e-70	82.5
AYK83403.1\|2743612_2745322_+\|terminase	terminase large subunit	D6R3Y4	Bacillus_phage	0.0e+00	92.3
AYK83404.1\|2745334_2745550_+	hypothetical protein	Q9ZXF9	Bacillus_phage	1.3e-24	80.6
AYK83405.1\|2745555_2746803_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.3e-217	86.5
AYK83406.1\|2746792_2747419_+\|head,protease	HK97 family phage prohead protease	Q9ZXF7	Bacillus_phage	1.8e-106	92.8
AYK83407.1\|2747455_2748658_+\|capsid	phage major capsid protein	Q9ZXF6	Bacillus_phage	3.3e-157	71.5
AYK83408.1\|2748673_2748988_+	hypothetical protein	Q9ZXF5	Bacillus_phage	6.8e-30	68.8
AYK83409.1\|2749016_2749508_+	collagen-like protein	D6R3Z0	Bacillus_phage	1.3e-27	69.1
AYK83410.1\|2749523_2749871_+\|head,tail	phage gp6-like head-tail connector protein	Q9ZXF3	Bacillus_phage	2.0e-51	87.0
AYK83411.1\|2749803_2750175_+\|head,tail	head-tail adaptor protein	Q9ZXF2	Bacillus_phage	3.5e-41	68.3
AYK83412.1\|2750167_2750551_+	HK97 gp10 family phage protein	Q9ZXF1	Bacillus_phage	2.9e-59	86.6
AYK83413.1\|2750547_2750928_+	DUF3168 domain-containing protein	Q9ZXF0	Bacillus_phage	2.6e-39	66.1
AYK83414.1\|2750928_2751540_+\|tail	phage tail protein	Q9ZXE9	Bacillus_phage	7.9e-99	89.7
AYK83415.1\|2751594_2751933_+	hypothetical protein	Q9ZXE8	Bacillus_phage	3.0e-39	70.5
AYK83416.1\|2751935_2752115_+	hypothetical protein	D6R3Z7	Bacillus_phage	1.6e-12	68.5
AYK83417.1\|2752127_2756006_+\|tail	phage tail tape measure protein	D6R3Z8	Bacillus_phage	0.0e+00	81.0
AYK83418.1\|2756855_2758562_+	alkaline phosphatase	D6R400	Bacillus_phage	9.4e-267	81.8
AYK83419.1\|2758598_2760173_+	hypothetical protein	M4ZSB3	Bacillus_phage	1.1e-264	88.7
AYK83420.1\|2760209_2761433_+	DUF2479 domain-containing protein	M4ZRP1	Bacillus_phage	6.5e-177	79.9
AYK83421.1\|2761448_2761748_+	hypothetical protein	M4ZR44	Bacillus_phage	1.5e-39	79.2
AYK83422.1\|2761744_2761915_+	XkdX family protein	NA	NA	NA	NA
AYK83423.1\|2761968_2762391_+\|holin	holin family protein	D6R405	Bacillus_phage	3.0e-57	85.7
AYK83424.1\|2762432_2763374_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	3.0e-97	77.1
AYK84831.1\|2763413_2764016_-	hypothetical protein	NA	NA	NA	NA
AYK83425.1\|2764358_2764748_-	hypothetical protein	NA	NA	NA	NA
AYK83426.1\|2764762_2766346_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	4.2e-75	59.7

DBSCAN-SWA_9

3338096 : 3395204

Staphylococcus_phage(20.0%)

transposase,tRNA,coat,protease,integrase

attL 3337772:3337826|attR 3349172:3349226

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3337772:3337826	attL	NA	NA	NA	NA
AYK84860.1\|3338096_3338984_+\|integrase	site-specific integrase	NA	NA	NA	NA
AYK83951.1\|3339321_3339618_+	hypothetical protein	NA	NA	NA	NA
AYK83952.1\|3340406_3341459_+	hypothetical protein	NA	NA	NA	NA
AYK83953.1\|3341763_3344970_+	type I restriction-modification system endonuclease	Q5YA94	Bacillus_phage	1.7e-06	29.5
AYK83954.1\|3345102_3346533_+	SAM-dependent methyltransferase	A0A220A2U4	Liberibacter_phage	2.6e-28	25.9
AYK83955.1\|3346529_3347849_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.3e-16	35.9
AYK83956.1\|3349352_3350503_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
3349172:3349226	attR	NA	NA	NA	NA
AYK83957.1\|3350637_3351462_-	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
AYK83958.1\|3352263_3352599_-	hypothetical protein	NA	NA	NA	NA
AYK83959.1\|3353411_3355136_+	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.4e-60	30.2
AYK83960.1\|3355132_3355651_+	acetolactate synthase small subunit	NA	NA	NA	NA
AYK83961.1\|3355674_3356703_+	ketol-acid reductoisomerase	NA	NA	NA	NA
AYK83962.1\|3356689_3358246_+	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	6.0e-10	39.4
AYK83963.1\|3358266_3359364_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AYK83964.1\|3359413_3360832_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AYK83965.1\|3360844_3361444_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AYK83966.1\|3361563_3362568_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AYK83967.1\|3362795_3364070_+	trigger factor	NA	NA	NA	NA
AYK83968.1\|3364341_3365604_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9
AYK83969.1\|3365757_3367416_+\|protease	Lon protease 2	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
AYK83970.1\|3367596_3369921_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.6e-182	43.7
AYK83971.1\|3369917_3370505_+	GTP-binding protein	NA	NA	NA	NA
AYK83972.1\|3370526_3371024_-	hypothetical protein	NA	NA	NA	NA
AYK83973.1\|3371253_3372621_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
AYK83974.1\|3372628_3373459_+	protein HemX	NA	NA	NA	NA
AYK83975.1\|3373491_3374436_+	hydroxymethylbilane synthase	NA	NA	NA	NA
AYK83976.1\|3374425_3375214_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
AYK83977.1\|3375210_3376185_+	porphobilinogen synthase	NA	NA	NA	NA
AYK83978.1\|3376214_3377507_+	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
AYK83979.1\|3377637_3379359_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
AYK83980.1\|3379391_3380417_+\|coat	spore coat protein YsxE	NA	NA	NA	NA
AYK83981.1\|3380435_3380627_-	hypothetical protein	NA	NA	NA	NA
AYK83982.1\|3381074_3383717_+\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
AYK83983.1\|3383776_3385069_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AYK83984.1\|3385208_3385955_+	prepilin peptidase	NA	NA	NA	NA
AYK83985.1\|3386088_3387087_+	SPOR domain-containing protein	NA	NA	NA	NA
AYK83986.1\|3387239_3387809_+	septum formation protein Maf	NA	NA	NA	NA
AYK83987.1\|3387845_3388541_+	JAB domain-containing protein	NA	NA	NA	NA
AYK83988.1\|3388632_3389646_+	rod shape-determining protein	NA	NA	NA	NA
AYK83989.1\|3389676_3390549_+	cell shape-determining protein MreC	NA	NA	NA	NA
AYK83990.1\|3390545_3391064_+	rod shape-determining protein MreD	NA	NA	NA	NA
AYK83991.1\|3391116_3391797_+	septum site-determining protein MinC	NA	NA	NA	NA
AYK83992.1\|3391798_3392605_+	septum site-determining protein MinD	NA	NA	NA	NA
AYK83993.1\|3392754_3393549_+	stage IV sporulation protein FA	NA	NA	NA	NA
AYK83994.1\|3393541_3394408_+	stage IV sporulation protein FB	NA	NA	NA	NA
AYK83995.1\|3394554_3394863_+	50S ribosomal protein L21	NA	NA	NA	NA
AYK83996.1\|3394865_3395204_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA

DBSCAN-SWA_10

3789237 : 3795332

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK84397.1\|3789237_3790323_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.6e-56	36.1
AYK84398.1\|3790333_3790981_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
AYK84399.1\|3790995_3792192_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.1e-115	54.9
AYK84400.1\|3792224_3792689_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
AYK84401.1\|3792801_3793176_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYK84402.1\|3793189_3793714_-	DUF309 domain-containing protein	NA	NA	NA	NA
AYK84885.1\|3793993_3794749_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	5.5e-09	29.2
AYK84403.1\|3794738_3795332_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.6e-14	35.4

DBSCAN-SWA_11

4007771 : 4033914

Bacillus_phage(60.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYK84632.1\|4007771_4009208_-	flavin monoamine oxidase family protein	A0A2K9L022	Tupanvirus	2.6e-07	30.6
AYK84633.1\|4009335_4009893_+	SMI1/KNR4 family protein	O64022	Bacillus_phage	7.0e-102	95.7
AYK84634.1\|4009991_4011794_+	hypothetical protein	A0A1P8CWI7	Bacillus_phage	1.3e-218	87.0
AYK84635.1\|4011803_4012262_+	antitoxin YobK	NA	NA	NA	NA
AYK84636.1\|4012354_4012813_+	SMI1/KNR4 family protein	A0A1P8CWJ1	Bacillus_phage	2.8e-72	85.5
AYK84637.1\|4012868_4013423_+	SMI1/KNR4 family protein	O64025	Bacillus_phage	4.3e-96	91.3
AYK84638.1\|4013482_4014016_+	N-acetyltransferase	O64026	Bacillus_phage	2.9e-97	97.2
AYK84639.1\|4014304_4014388_-\|holin	putative holin-like toxin	NA	NA	NA	NA
AYK84640.1\|4014647_4015007_+	hypothetical protein	A0A1P8CWJ9	Bacillus_phage	2.2e-61	98.3
AYK84641.1\|4017213_4018461_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AYK84642.1\|4018544_4019777_+	MFS transporter	NA	NA	NA	NA
AYK84643.1\|4019788_4020619_+	methyltransferase domain-containing protein	NA	NA	NA	NA
AYK84644.1\|4020623_4021769_+	ThiF family adenylyltransferase	A0A1V0SCZ9	Indivirus	4.3e-05	21.1
AYK84645.1\|4022128_4023253_-\|transposase	IS4-like element IS4Bsu1 family transposase	NA	NA	NA	NA
AYK84646.1\|4023466_4024111_+	DUF3885 domain-containing protein	NA	NA	NA	NA
AYK84898.1\|4024229_4024583_+	hypothetical protein	NA	NA	NA	NA
AYK84647.1\|4024617_4024842_+	hypothetical protein	NA	NA	NA	NA
AYK84648.1\|4024886_4025279_+	UPF0715 family protein	O64087	Bacillus_phage	3.7e-49	81.4
AYK84649.1\|4025288_4025519_-	hypothetical protein	NA	NA	NA	NA
AYK84650.1\|4025652_4027080_+	serine hydrolase	NA	NA	NA	NA
AYK84651.1\|4027448_4027700_+	hypothetical protein	A0A1P8CWV6	Bacillus_phage	1.0e-36	96.4
AYK84652.1\|4027936_4028080_+	hypothetical protein	A0A1P8CWV9	Bacillus_phage	9.6e-16	92.5
AYK84653.1\|4028152_4029400_+\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6
AYK84654.1\|4029461_4029773_+	hypothetical protein	NA	NA	NA	NA
AYK84655.1\|4029859_4030093_+	3-ketosteroid-delta-1-dehydrogenase	NA	NA	NA	NA
AYK84656.1\|4030129_4030369_+	DUF4365 domain-containing protein	NA	NA	NA	NA
AYK84657.1\|4030409_4031560_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.7e-38	61.2
AYK84658.1\|4031683_4031878_+	hypothetical protein	NA	NA	NA	NA
AYK84659.1\|4031919_4032216_+	hypothetical protein	NA	NA	NA	NA
AYK84660.1\|4032368_4032665_+	hypothetical protein	NA	NA	NA	NA
AYK84661.1\|4032666_4033914_-\|transposase	IS256-like element ISBsu2 family transposase	A0A220NQR7	Corynebacterium_phage	2.6e-24	22.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP032866

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP032865

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection