CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP033429	Burkholderia gladioli strain Co14 plasmid p1, complete sequence	0 crisprs	NA	0	0
CP033430	Burkholderia gladioli strain Co14 chromosome 1, complete sequence	1 crisprs	WYL,cas3,DEDDh,csa3,DinG	0	8
CP033431	Burkholderia gladioli strain Co14 chromosome 2, complete sequence	1 crisprs	cas3,WYL,csa3,DinG	4	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033430_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033430_1

8605-8685

Orphan

Consensus_repeat	Method
CGCTGAAATACGAAACGCCGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033430_1

>merge|CP033430|1|8605-8685|CRISPRCasFinder
CGCTGAAATACGAAACGCCGGCCTCGCGCCGGCGTTGTTCATGATGCGGGGAATGTGCCGCTGAAATGCGAAACGCCGGCC

>CP033430|1|1|8605-8685|CRISPRCasFinder
CGCTGAAATACGAAACGCCGGCC	TCGCGCCGGCGTTGTTCATGATGCGGGGAATGTGC
CGCTGAAATGCGAAACGCCGGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP033430.1\|AYQ86111.1\|8751_9534_-\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|235711
CP033430.1\|AYQ86120.1\|18479_18989_-\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
CP033430.1\|AYQ86114.1\|11978_12716_-\|phosphoadenylyl-sulfate-reductase	unknown	unknown	gnl\|CDD\|234997
CP033430.1\|AYQ86107.1\|4314_5826_-\|leucyl-aminopeptidase	unknown	unknown	gnl\|CDD\|234863
CP033430.1\|AYQ86105.1\|2370_3639_-\|DUF2486-family-protein	unknown	unknown	gnl\|CDD\|378466
CP033430.1\|AYQ86113.1\|10931_11894_-\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
CP033430.1\|AYQ86110.1\|8203_8578_+\|cobalamin-biosynthesis-protein-CbiX	unknown	unknown	gnl\|CDD\|239509
CP033430.1\|AYQ86106.1\|3854_4271_-\|DNA-polymerase-III-subunit-chi	unknown	unknown	gnl\|CDD\|235581
CP033430.1\|AYQ86115.1\|12712_13249_-\|DUF934-domain-containing-protein	unknown	unknown	gnl\|CDD\|226272
CP033430.1\|AYQ86119.1\|17778_18483_-\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|214959
CP033430.1\|AYQ86118.1\|16684_17773_-\|DUF3396-domain-containing-protein	unknown	unknown	gnl\|CDD\|371775
CP033430.1\|AYQ86104.1\|1895_2222_+\|cytochrome-C	unknown	unknown	gnl\|CDD\|227001
CP033430.1\|AYQ86112.1\|9592_10909_-\|sulfate-adenylyltransferase	unknown	unknown	gnl\|CDD\|225448
CP033430.1\|AYQ86108.1\|5935_7027_+\|LPS-export-ABC-transporter-permease-LptF	unknown	unknown	gnl\|CDD\|275200
CP033430.1\|AYQ86116.1\|13267_14947_-\|nitrite/sulfite-reductase	unknown	unknown	gnl\|CDD\|223233
CP033430.1\|AYQ86109.1\|7030_8179_+\|LPS-export-ABC-transporter-permease-LptG	unknown	unknown	gnl\|CDD\|275201
CP033430.1\|AYQ86103.1\|65_1739_+\|dihydroxy-acid-dehydratase	unknown	unknown	gnl\|CDD\|234861
CP033430.1\|AYQ86117.1\|15171_16113_+\|CysB-family-HTH-type-transcriptional-regulator	unknown	unknown	gnl\|CDD\|237173

Protein	Function_ID	Function_description	E-value
CP033430.1\|AYQ86111.1\|8751_9534_-\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|235711	PRK06136, PRK06136, uroporphyrinogen-III C-methyltransferase.	3.17148e-121
CP033430.1\|AYQ86120.1\|18479_18989_-\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	6.6569e-30
CP033430.1\|AYQ86114.1\|11978_12716_-\|phosphoadenylyl-sulfate-reductase	gnl\|CDD\|234997	PRK02090, PRK02090, phosphoadenylyl-sulfate reductase.	2.2885e-114
CP033430.1\|AYQ86107.1\|4314_5826_-\|leucyl-aminopeptidase	gnl\|CDD\|234863	PRK00913, PRK00913, multifunctional aminopeptidase A; Provisional.	0
CP033430.1\|AYQ86105.1\|2370_3639_-\|DUF2486-family-protein	gnl\|CDD\|378466	pfam10667, DUF2486, Protein of unknown function (DUF2486). This family is made up of members from various Burkholderia spp. The function is unknown.	2.37308e-13
CP033430.1\|AYQ86113.1\|10931_11894_-\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP033430.1\|AYQ86110.1\|8203_8578_+\|cobalamin-biosynthesis-protein-CbiX	gnl\|CDD\|239509	cd03416, CbiX_SirB_N, Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), N-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both are found in a wide range of bacteria. This subgroup also contains single domain proteins from archaea and bacteria which may represent the ancestral form of class II chelatases before domain duplication occurred.	5.47442e-36
CP033430.1\|AYQ86106.1\|3854_4271_-\|DNA-polymerase-III-subunit-chi	gnl\|CDD\|235581	PRK05728, PRK05728, DNA polymerase III subunit chi; Validated.	1.62505e-54
CP033430.1\|AYQ86115.1\|12712_13249_-\|DUF934-domain-containing-protein	gnl\|CDD\|226272	COG3749, COG3749, Uncharacterized protein conserved in bacteria [Function unknown].	3.02504e-55
CP033430.1\|AYQ86119.1\|17778_18483_-\|VRR-NUC-domain-containing-protein	gnl\|CDD\|214959	smart00990, VRR_NUC, This model contains proteins with the VRR-NUC domain. It is associated with members of the PD-(D/E)XK nuclease superfamily, which include the type III restriction modification enzymes, for example StyLTI.	1.54234e-09
CP033430.1\|AYQ86118.1\|16684_17773_-\|DUF3396-domain-containing-protein	gnl\|CDD\|371775	pfam11876, DUF3396, Protein of unknown function (DUF3396). This family of proteins are functionally uncharacterized. This protein is found in bacteria and viruses. Proteins in this family are typically between 302 to 382 amino acids in length.	1.14179e-50
CP033430.1\|AYQ86104.1\|1895_2222_+\|cytochrome-C	gnl\|CDD\|227001	COG4654, COG4654, Cytochrome c551/c552 [Energy production and conversion].	2.26604e-19
CP033430.1\|AYQ86112.1\|9592_10909_-\|sulfate-adenylyltransferase	gnl\|CDD\|225448	COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism].	0
CP033430.1\|AYQ86108.1\|5935_7027_+\|LPS-export-ABC-transporter-permease-LptF	gnl\|CDD\|275200	TIGR04407, LptF_YjgP, LPS export ABC transporter permease LptF. Members of this family are LptF, one of homologous, two tandem-encoded permease genes of an export ATP transporter for lipopolysaccharide (LPS) assembly in most Gram-negative bacteria. The other permease subunit is LptG (TIGR04408). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	6.9312e-130
CP033430.1\|AYQ86116.1\|13267_14947_-\|nitrite/sulfite-reductase	gnl\|CDD\|223233	COG0155, CysI, Sulfite reductase, beta subunit (hemoprotein) [Inorganic ion transport and metabolism].	0
CP033430.1\|AYQ86109.1\|7030_8179_+\|LPS-export-ABC-transporter-permease-LptG	gnl\|CDD\|275201	TIGR04408, LptG_lptG, LPS export ABC transporter permease LptG. Members of this family are LptG, one of homologous, two tandem-encoded permease genes of an export ATP transporter for lipopolysaccharide (LPS) assembly in most Gram-negative bacteria. The other permease subunit is LptF (TIGR04407). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Transport and binding proteins, Other].	3.26879e-111
CP033430.1\|AYQ86103.1\|65_1739_+\|dihydroxy-acid-dehydratase	gnl\|CDD\|234861	PRK00911, PRK00911, dihydroxy-acid dehydratase; Provisional.	0
CP033430.1\|AYQ86117.1\|15171_16113_+\|CysB-family-HTH-type-transcriptional-regulator	gnl\|CDD\|237173	PRK12684, PRK12684, CysB family HTH-type transcriptional regulator.	0

>CP033430.1|AYQ86110.1|8203_8578_+|cobalamin-biosynthesis-protein-CbiX
MSRHGIILFGHGSRDPRWMEPFERLAERVRAGHTSGPVALAFLELMPPELEDAVAAHVTAGCATVTIVPVFVGQGGHVRRDLPEIVEACRAAHPGVDIRCATAIGEDDSVLDAIATYCLQQAGD
>CP033430.1|AYQ86109.1|7030_8179_+|LPS-export-ABC-transporter-permease-LptG
MRLYEKYFARQIYLTFVFVLFAFSGLFFFFDLISELNSVGHGSYNFGYAVLRVGLQTPSRFYEIIPVATLISAIYVFAQMAANSEFTIFRVSGLATNRALRSLLKIGVPLVIVTYLIGEFIGPYTDQLSERVRLEALGSSVSSNFQSGVWVKDTLTARDNGEPVTRFVNVGTLSPDSTISNVRIYEFDSKFQLQNVRIAKSGRYAPPGHWLLTDVTDTQLSPIVPAPNTPKDALNPVYRSEQVSMPQYSLRSDLTPQILSVLLVSPERMSIFNLFRYIQHLRENQQDTQRYDIALWRKLLYPFAVFVMLVLSLPFAYLHTRAGVVGVKVFGGIMLGMSFQLFNTLFSHIGTLNTWPAPLTAALPGLIYLALGLFGLKWVDRH
>CP033430.1|AYQ86108.1|5935_7027_+|LPS-export-ABC-transporter-permease-LptF
MIFERSLQRELAYTAGAVFMVLLTIMLTSMMIRIVGYAASGQVSPKDVLVLIGLTVIGYLAMILVGTLFVSILFVLTRWYKDSEMVVWLASGVSLTRLIKPIGVFATPIILLIAFFAFVGWPWSNQQSKLIKARFQQRDEVSLLAPGQFRESPSTNRVFFIEKMSADQAAVQNVFVTTTEQGKVNVVVSQTGHTETAQNGDRFIVLENGRRYDGVPGQPNFKIMQFERYGVKIQSKQVVTQPTTTSTPTLDLLRDPTDENLAEFAWRVGLPLIAINLMILAIPLAYQNPRRGRTVNLVMAVLIYLTYSNLLNVMQSQIERGKIPFGVGLVVLHLVVAGIVAFLFWMRVRNRPLISRATFRRGA
>CP033430.1|AYQ86107.1|4314_5826_-|leucyl-aminopeptidase
MDFSIKGFDWSKGASKGFLTGKSDCVVVGVFESQTLSGAALDIDEAVKGLVSRLVKAGDMDGKLGKTLFLHEVEGIGASRVLLVGLGKQDGFGQKAYQEAARAAWRALLATKVGQVAFTLAQLPVAERGAEWSVRAAILALRGETYRFTQMKSKAKPAPATLKRVVFSVDPADEKAAKQAAKQAVAIANGMDLTRDLGNLPGNVCTPTYLANTARQLAKDWGLKAEVLGLKQIQALKMGSFLSVTRGSVEPPQFIVLHYQGAAAKVAPIVLVGKGITFDTGGISLKPGEGMDEMKYDMCGAGSVLGTMRALAEMELKLNVVAIVPTCENMPSGQATKPGDIVTSMKGLTIEVLNTDAEGRLILCDALTYAERFKPAAVIDVATLTGACVIALGHHNSGLFSKDDALAGELLDASREAGDPAWRLPLDDEYQDLLKSNFADLANIGGRPGGSITAACFLARFAESYPWAHLDIAGTAWKSGAAKGATGRPVPLLSQFLIDRAGA
>CP033430.1|AYQ86106.1|3854_4271_-|DNA-polymerase-III-subunit-chi
MTRIDFHSNVGDSLAYACRLLRKAYLAGQAVVVCAEPARLRTLDERLWTFSPLDFIPHCSVDSPQASQTPIVLTTDLSRAPHDGVLLNLGAEVPAQFARFARLLEVVGNAPEELAAGRDRYRFYRDRGYALNNYKQGG
>CP033430.1|AYQ86105.1|2370_3639_-|DUF2486-family-protein
MSTAYGAPAGAGADALPASHLAAGEPAALAPRGLVSSPATAQGAEAPAEPGFVAAEPVTVPPEFAGEPQPLPEAHEASAASEPTQAEAAFVAPEPVSTPAEFAGDSQPLPEAHEASALSEPTQAEAAFVAPEPVSTPPEFAAEPQPWPASHEASTFSEPDPAEAAFVPPESSIPQEFSASPAPLVEPQAAPLASTQAEAVFLAAEPAVPQEFAAAPQPLPVEAVPAEVEARPDPRDDEHDAPDNAPLAYALDGASQEPAAASATPHGEALHRAPVPPDDLAARTESALHRVETLAPAAFAQLSPVAAETPVPARFADVEALPPAELIGAPQAEPVPPPAARIDSRHIAERLQGRVADYLSGEGRALIDARCREAVQQHAAWLVGEVSQQVVTALAPEFERWVAEAVDEALARRDAPPSRQEH
>CP033430.1|AYQ86104.1|1895_2222_+|cytochrome-C
MRITLLRATLALLLAANLPAQAQQPASGPLLAQRRNCMACHAVAAPLMGPSFHAIADRYMNRPDAADYLVQTIVKGSVGVWGPVPMPANTQVTGDEARTLAQWILTLK
>CP033430.1|AYQ86103.1|65_1739_+|dihydroxy-acid-dehydratase
MSYNRRSKNITQGVARSPNRSMYYALGYQQADFDKPMIGIANGHSTITPCNAGLQRLSDAAVEAVKAAGANPQIFGTPTISDGMSMGTEGMKYSLVSREVIADCIETCVQGQWMDGVVVVGGCDKNMPGGMIALARLNVPGIYVYGGTIRPGNWKGQDLTIVSAFEAVGEFTAGRMSQEDFDGIERNACPSTGSCGGMYTANTMSSSFEALGMALPYSSTMANPDQEKVDSAAESARVLVEAVKRDLKPRDIITRESIENAVSVIMATGGSTNAVLHFLAIAHAAEIDWSIDDFERIRRRVPVICDLKPSGRYVATDLHRAGGIPQVMKILLDAGLLHGECLTITGQTVAETLREVPSVPRADQQVIFPIDQALYREGHLAILKGNLAEDGAVAKISGLKNPVITGPARVFDDEQSALQAILDDRIRAGDVVVLRYLGPQGGPGMPEMLAPTSAIIGKGLGESVGLITDGRFSGGTWGMVVGHVAPEAFAGGTIALVQEGDSITIDAHRLLLQLNVDDAELARRRAAWQRPAPRYTRGVLAKYAALALPANRGAVTG
>CP033430.1|AYQ86111.1|8751_9534_-|uroporphyrinogen-III-C-methyltransferase
MGKVYLIGAGPGAADLITVRGARLLGQAEVVLHDALIEPAMLDYAPNARRIAVGKRCGQRSTAQQFINKQIIDAAREHAVVVRLKGGDPMLFGRADEEMRALEAAGIDYEVVPGITAALASAAALKRSLTLRGVSRSVAFATQSRAPGSDEIREQVQADSLVFYMGRDSAPGIARQLIDAGRAGDTPVAIVEACSTPRERSLALTLARMAAGEAQAWLDPSQPSLLMIGSAFAERAGAVEPVSEEAAGQPAGKGEVRNAA
>CP033430.1|AYQ86112.1|9592_10909_-|sulfate-adenylyltransferase
MSIIENHEDLGVLRFITAGSVDDGKSTLIGRLLYDSKAVLSDQLSALSRAKNKRTVGDELDLALLTDGLEAEREQGITIDVAYRYFATAKRKFIIADTPGHEQYTRNMVTGASTAHAAIILVDATRVTVEGGVTQLLPQTKRHSAIVKLLGLQHVIVAINKMDLVEYSEATFNLIRDAYVVLAQQLGLEGVRFVPVSALKGDNIVTLSDSMPWYVGEPLLDVLETLPVAIDGGEALRFPVQWVARQDGSSADDFRGYMGRVEAGEVKVGDEIAVLPSGRTATVAEIVAPVPGGTAAVESAFAGQTVTIRLAEDVDVSRGDVFVPNAQRIEPARKLEADLCWFDETPLSPQRKYLLKQTTNTVFTKIGAVKQVLDVHTLSHASDRQDLKMNDIGRVALTLQKPIVCDTYDAHPGTGAFVLIDEATHHTVAAGMIRAYSA
>CP033430.1|AYQ86113.1|10931_11894_-|sulfate-adenylyltransferase-subunit-CysD
MSTTLEQSAFASPAGTASRMGHLDWLEAESIHILRELVAECSKPALLFSGGKDSVVVLHLALKAFGLGPDRKTSLPFPLVHIDTGHNYDEVIDFRDRRAKEIGAELVVGHVEDSIQRGTVVLRRETDSRNAAQAVTLLETIEQHGYTAMIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWSLYNARLHKGEHLRVFPISNWTELDVWQYIAREQLELPSIYYAHQREIVRRNGLLVPVTPLTPMREGEVSETAQVRFRTVGDISCTCPVESDADDVEKIIAETAVTEITERGATRMDDQTSEAAMEQRKKQGYF
>CP033430.1|AYQ86114.1|11978_12716_-|phosphoadenylyl-sulfate-reductase
MSELLTPELSAKVERLDALLASIAARHERVKFASSLAAEDMLVTHAILSKGHAIGIFSLNTGRLHAETLGMIDRVRERYGYEIEQFHPQQDAIDQYVAEHGLNAFYESVELRKSCCHIRKVEPLNRALSEVDAWVTGQRREQSVTRAELHEQEQDEARGIAKYNPLADWTEAEVWAYLKAFEVPVNPLHARGYPSIGCEPCTRAIRPGEDSRAGRWWWESRDTKECGLHITVAPVSELPQRPVSA
>CP033430.1|AYQ86115.1|12712_13249_-|DUF934-domain-containing-protein
MASIIKNRAVIDDAWQVVRAAEDGALPAVDALPAGKLLVPLAYWQAEREALVAARGKDELGVWLAPDSEPAELVADFDKLTVIAVDFPRFGDGRGYSTAHLLRNRHGWTGELRAIGDVLRDQLNYMSRCGFDAFAVRADRDPHDALNAFTEFSERYQGAVDDAMPLFRRRAASAQVNA
>CP033430.1|AYQ86116.1|13267_14947_-|nitrite/sulfite-reductase
MYQYDQYDQTIVDERVAQYRDQVRRRLSGELSEEEFRPLRLQNGLYMQRHAYMHRIAIPYGNLRSDQLRMLAVIAREHDRGYGHFSTRSNIQFNWIQLEDTPEILRKLASVQMHGIQTSGNCIRNITADQFAGVAPDEVIDPRPWAEILRQWSTFHPEFAWLPRKFKIAVSGAKVDRAAVQMHDLGVYLSRNEQGEVVASVLAGGGLGRTPIVGSIIRENLPWQHLLTYCEAVLRVYNRFGRRDNLYKARIKILVKALSPEKFSQQVEQEWQHLKDGPSTLTQAELDRVSKDFAPPVYEKLADTDASYEQHLLENKAFARWVERNVAPHKVAGYAAVTLSLKPNGVAPGDATDAQMDTVADWADAYSLGELRVSHEQNLILANVKKRDLFELWEKAKAAGFATPNIGLLTDIIACPGGDFCSLANAKSIPIAQAIQERFDDLDYVYDLGEMSLNISGCMNSCGHHHVGNIGILGVDKDGAEWYQISLGGEQGTGADGLKLGRVIGPSFSAHEVPDVISTLVDTFVESRIDGERFIDTYQRIGLAPFKERVYAARQPAHA
>CP033430.1|AYQ86117.1|15171_16113_+|CysB-family-HTH-type-transcriptional-regulator
MNLHQFRFVREAVRQNFNLTEAAKALFTSQPGVSKAIIELEDELGVEIFTRHGKRVRSLTEPGRIILASVERILQEVESLKRVGKDYAAQDQGNLTIAATHTQARYSLPAAIAEFKKRFPKVHLSILQGSPTQVAEMVIHDQADLAIATEAIADYKELVSLPCFQWHHAAVVPADHPLLERRPPSLDDLAQYPLITYDDAFAGRKKINHAFALRGLSPDIVLEAIDADVIKTYVELGLGVGILADIAFNPERDRNLRSIPVGHLFGSNVTRVALKQGAYLRGYVYTLVELLSPTLNRKLIEQALKGEAESYEL
>CP033430.1|AYQ86118.1|16684_17773_-|DUF3396-domain-containing-protein
MTDKAFIEYAKAHQLEALISGGALEPTDKHDYVGAAVAVRGALFFRNAADPEVRRAISECYEQYREIAKDELKWLWRDGKEPIRIKGGNLPSGTFTSYSDKAALTAYVTSGDASVDAGFWHFQVFGQQRWREARPHAGLNALTFSASLLYVAENPAAFQTLFVDFARRLKVVSGYAGYALNLSLAKTAANVPTEYQLAKQMMALDVGEPLLQAARLRDGIKTVGWLTALDKELLDKAGGLDTLRNELPPNWYALYDLNGGVVIQAGRRPEAGSSTDGDESGPPVPPPNYVILNATLKSVRVPSVWQLQIGQPGSASPYFATTAESDDWLRRFDVSDDRLVEYKAKLLHMPTLDADCTLPDRA
>CP033430.1|AYQ86119.1|17778_18483_-|VRR-NUC-domain-containing-protein
MSRDVPGGTSTEGTTTRVYLGGDLDQQDKKILCGALCQCKKGPNISIIGARLKQACVATKLNALDARGDSIYKPEISYNMNEYPPAPIMSSRNPLEPHGFIPNWIKAHHPEGYVPGVGWIRRPDVVVVKDPGKPPTQDNLSGVVEMKFPPDRRDIEQIADYREIAGPHAKVTELDPATCGCPDDGGEESSSPTADALRDAFSSIGRQVRKLLNQTGAGPAPGGGMPPSVPVPVF
>CP033430.1|AYQ86120.1|18479_18989_-|PAAR-domain-containing-protein
MSFAFIREGDTTSHGGAVLSSGAITFIDGRPIAFVGTMVSCPKCKGVFPIVTSKNPGMNFDGRQAAFQGDMTACGATLMASQGNAVANIPVSAGGTTISARHEADGSAERYRGRFQVVAANGQPAANSPYSLRTPEGQTISGTTDADGYTQWHHADSPASLVFGREKPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

45298 : 56187

Klosneuvirus(14.29%)

protease,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ86146.1\|45298_48136_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	8.5e-79	25.9
AYQ86147.1\|48138_48639_+	lipoprotein signal peptidase	NA	NA	NA	NA
AYQ86148.1\|48743_49955_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.1e-38	31.9
AYQ86149.1\|50035_50482_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	8.7e-47	61.6
AYQ86150.1\|50595_52893_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.1e-169	42.3
AYQ86151.1\|52889_53204_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	3.4e-13	44.6
AYQ86152.1\|53735_53939_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	6.8e-23	81.8
AYQ86153.1\|54076_55669_-	multicopper oxidase family protein	NA	NA	NA	NA
AYQ86154.1\|55821_56187_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.7e-06	29.8

DBSCAN-SWA_2

944752 : 1028449

Burkholderia_phage(56.25%)

holin,lysis,tRNA,tail,integrase,plate

attL 1000071:1000090|attR 1040229:1040248

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ86844.1\|944752_946723_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AYQ86845.1\|946719_947409_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
AYQ86846.1\|947465_948236_+	ParA family protein	A0A0K2FLP4	Brevibacillus_phage	1.7e-21	31.4
AYQ86847.1\|948274_949162_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	3.8e-17	37.3
AYQ86848.1\|949169_950303_+	citrate transporter	NA	NA	NA	NA
AYQ86849.1\|950567_951098_+	ATP synthase subunit I	NA	NA	NA	NA
AYQ86850.1\|951259_952111_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
AYQ89479.1\|952187_952457_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
AYQ86851.1\|952583_953054_+	F0F1 ATP synthase subunit B	NA	NA	NA	NA
AYQ86852.1\|953056_953596_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
AYQ86853.1\|953640_955182_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AYQ86854.1\|955254_956133_+	F0F1 ATP synthase subunit gamma	NA	NA	NA	NA
AYQ86855.1\|956205_957600_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
AYQ86856.1\|957759_958185_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
AYQ89480.1\|958432_960130_+	AMP-binding protein	Q75ZG1	Hepacivirus	3.9e-39	26.8
AYQ86857.1\|960141_960363_+	hypothetical protein	NA	NA	NA	NA
AYQ89481.1\|960803_961598_-	ArtI protein	NA	NA	NA	NA
AYQ86858.1\|961814_962942_+	uroporphyrinogen decarboxylase	NA	NA	NA	NA
AYQ86859.1\|963470_965723_+	primosomal protein N'	NA	NA	NA	NA
AYQ86860.1\|966214_970138_+	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AYQ86861.1\|970224_971364_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AYQ86862.1\|971643_972798_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AYQ86863.1\|972829_973639_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AYQ86864.1\|973697_974309_-	PadR family transcriptional regulator	NA	NA	NA	NA
AYQ86865.1\|974405_974837_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AYQ86866.1\|974925_977640_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	8.0e-135	44.8
AYQ86867.1\|977675_977864_+	hypothetical protein	NA	NA	NA	NA
AYQ86868.1\|977955_978435_-	GyrI-like domain-containing protein	NA	NA	NA	NA
AYQ86869.1\|978666_980076_+	ethanolamine permease	NA	NA	NA	NA
AYQ86870.1\|980113_981511_+	ethanolamine ammonia-lyase subunit EutB	NA	NA	NA	NA
AYQ86871.1\|981507_982302_+	ethanolamine ammonia-lyase subunit EutC	NA	NA	NA	NA
AYQ86872.1\|982394_983915_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AYQ86873.1\|984253_985396_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AYQ86874.1\|985458_986544_-	ADP-heptose--LPS heptosyltransferase	NA	NA	NA	NA
AYQ86875.1\|986589_988311_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AYQ86876.1\|988516_989905_-	L-serine ammonia-lyase	NA	NA	NA	NA
AYQ86877.1\|989934_991080_-	alginate lyase	NA	NA	NA	NA
AYQ86878.1\|991223_994154_-	glycine dehydrogenase (aminomethyl-transferring)	M4QFZ1	Prochlorococcus_phage	3.4e-256	50.3
AYQ86879.1\|994217_994601_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
AYQ86880.1\|994644_995763_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
AYQ86881.1\|996648_997053_-	hypothetical protein	NA	NA	NA	NA
AYQ86882.1\|997256_998309_-	oxidoreductase	NA	NA	NA	NA
AYQ86883.1\|998790_1000875_+	ATP-dependent DNA helicase Rep	A7KV33	Bacillus_phage	4.4e-101	35.4
1000071:1000090	attL	NA	NA	NA	NA
AYQ86884.1\|1000989_1001928_-	cytochrome c5 family protein	NA	NA	NA	NA
AYQ86885.1\|1002347_1003454_-\|integrase	site-specific integrase	A0A1S5NNJ1	Burkholderia_phage	1.5e-159	78.2
AYQ86886.1\|1004264_1007057_-	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	85.6
AYQ86887.1\|1007059_1007263_-	hypothetical protein	NA	NA	NA	NA
AYQ86888.1\|1007278_1007827_+	hypothetical protein	NA	NA	NA	NA
AYQ86889.1\|1007823_1008072_-	transcriptional regulator	A4JWR6	Burkholderia_virus	3.6e-34	86.6
AYQ86890.1\|1008181_1008385_-	hypothetical protein	NA	NA	NA	NA
AYQ86891.1\|1008476_1008950_+	transcriptional regulator	E5E3U2	Burkholderia_phage	3.9e-37	56.4
AYQ86892.1\|1009146_1009434_+	hypothetical protein	NA	NA	NA	NA
AYQ86893.1\|1009630_1010728_-	phage late control D family protein	A4JWS1	Burkholderia_virus	8.6e-120	61.5
AYQ86894.1\|1010727_1011219_-\|tail	phage tail protein	A4JWS2	Burkholderia_virus	1.1e-45	71.8
AYQ86895.1\|1011233_1014179_-	hypothetical protein	A4JWS3	Burkholderia_virus	2.7e-80	29.4
AYQ86896.1\|1014175_1014295_-\|tail	GpE family phage tail protein	E5E3U7	Burkholderia_phage	1.6e-11	83.8
AYQ86897.1\|1014303_1014639_-\|tail	phage tail assembly protein	E5E3U8	Burkholderia_phage	3.2e-33	79.4
AYQ86898.1\|1014708_1015218_-\|tail	phage major tail tube protein	E5E3U9	Burkholderia_phage	3.0e-67	72.8
AYQ86899.1\|1015245_1016418_-\|tail	phage tail sheath protein	E5E3V0	Burkholderia_phage	1.4e-181	80.5
AYQ86900.1\|1016467_1017319_-\|tail	tail assembly chaperone	A4JWS8	Burkholderia_virus	9.1e-77	70.9
AYQ86901.1\|1017337_1019902_-\|tail	phage tail protein	E5E3V2	Burkholderia_phage	7.9e-233	54.4
AYQ86902.1\|1019904_1020462_-\|tail	phage tail protein I	E5E3V3	Burkholderia_phage	2.4e-78	80.0
AYQ86903.1\|1020439_1021345_-\|plate	baseplate assembly protein	E5E3V4	Burkholderia_phage	8.0e-132	79.1
AYQ86904.1\|1021341_1021704_-\|plate	baseplate assembly protein	E5E3V5	Burkholderia_phage	3.0e-45	74.2
AYQ89482.1\|1021700_1022399_-\|plate	phage baseplate assembly protein V	E5E3V6	Burkholderia_phage	1.2e-90	75.0
AYQ86905.1\|1022632_1023049_-\|tail	phage tail protein	A4JWT7	Burkholderia_virus	5.9e-29	46.0
AYQ86906.1\|1023041_1023212_-	LysC protein	E5E3W0	Burkholderia_phage	8.8e-08	79.4
AYQ86907.1\|1023189_1023639_-\|lysis	LysB family phage lysis regulatory protein	E5E3W1	Burkholderia_phage	5.2e-39	62.8
AYQ86908.1\|1023635_1024448_-	DUF3380 domain-containing protein	A4JWU0	Burkholderia_virus	1.4e-111	75.6
AYQ86909.1\|1024444_1024717_-\|holin	phage holin family protein	K4NX91	Burkholderia_phage	6.5e-29	75.6
AYQ86910.1\|1024718_1025063_-	hypothetical protein	K4NZQ3	Burkholderia_phage	6.1e-40	80.5
AYQ86911.1\|1025078_1025285_-\|tail	phage tail protein	K4PAW7	Burkholderia_phage	2.1e-19	70.6
AYQ86912.1\|1025281_1025476_-	hypothetical protein	NA	NA	NA	NA
AYQ86913.1\|1025803_1026076_-	hypothetical protein	NA	NA	NA	NA
AYQ89483.1\|1026072_1026555_-	DUF2778 domain-containing protein	NA	NA	NA	NA
AYQ86914.1\|1026644_1027736_-	DUF3396 domain-containing protein	A9YX32	Burkholderia_phage	6.4e-83	56.5
AYQ89484.1\|1027753_1028449_-	VRR-NUC domain-containing protein	A4JX24	Burkholderia_virus	1.2e-47	46.3
1040229:1040248	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1237882 : 1289431

Acanthocystis_turfacea_Chlorella_virus(12.5%)

protease,plate,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ87088.1\|1237882_1238608_+\|transposase	transposase	NA	NA	NA	NA
AYQ87089.1\|1238888_1243589_+	glutamate synthase subunit alpha	NA	NA	NA	NA
AYQ87090.1\|1243688_1245155_+	glutamate synthase subunit beta	NA	NA	NA	NA
AYQ87091.1\|1245257_1247015_-	ABC transporter ATP-binding protein/permease	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.7e-05	31.1
AYQ87092.1\|1247747_1248905_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AYQ87093.1\|1248932_1249130_+	sulfur carrier protein ThiS	NA	NA	NA	NA
AYQ87094.1\|1249171_1249987_+	thiazole synthase	NA	NA	NA	NA
AYQ87095.1\|1249983_1251105_+	thiamine phosphate synthase	NA	NA	NA	NA
AYQ87096.1\|1251424_1252246_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-20	30.2
AYQ87097.1\|1252242_1253010_+	lipid asymmetry maintenance ABC transporter permease subunit MlaE	NA	NA	NA	NA
AYQ87098.1\|1253025_1253532_+	outer membrane lipid asymmetry maintenance protein MlaD	NA	NA	NA	NA
AYQ87099.1\|1253587_1254562_+	VacJ family lipoprotein	NA	NA	NA	NA
AYQ87100.1\|1254671_1255298_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AYQ87101.1\|1255294_1255564_+	STAS domain-containing protein	NA	NA	NA	NA
AYQ87102.1\|1255771_1256698_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.4e-22	30.2
AYQ87103.1\|1256694_1257450_+	metal-dependent hydrolase	NA	NA	NA	NA
AYQ87104.1\|1257470_1257710_+	BolA family transcriptional regulator	NA	NA	NA	NA
AYQ87105.1\|1257726_1259082_+	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
AYQ87106.1\|1259078_1259735_+	ATP phosphoribosyltransferase	NA	NA	NA	NA
AYQ87107.1\|1259775_1261104_+	histidinol dehydrogenase	NA	NA	NA	NA
AYQ89500.1\|1261263_1262334_+	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	1.2e-20	23.3
AYQ87108.1\|1262416_1263004_+	imidazoleglycerol-phosphate dehydratase	NA	NA	NA	NA
AYQ87109.1\|1263079_1263700_+	NAAT family transporter	NA	NA	NA	NA
AYQ87110.1\|1263696_1264338_+	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
AYQ87111.1\|1264500_1265256_+	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
AYQ89501.1\|1265342_1266116_+	imidazole glycerol phosphate synthase subunit HisF	NA	NA	NA	NA
AYQ87112.1\|1266115_1266541_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
AYQ87113.1\|1266537_1266903_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
AYQ89502.1\|1267014_1267359_+	hypothetical protein	NA	NA	NA	NA
AYQ87114.1\|1267384_1267750_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
AYQ87115.1\|1267864_1268104_+	Sec-independent protein translocase subunit TatA	NA	NA	NA	NA
AYQ87116.1\|1268130_1268685_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
AYQ87117.1\|1268732_1269512_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	8.4e-29	31.9
AYQ87118.1\|1269671_1270880_-	Do family serine endopeptidase	W5SAB9	Pithovirus	2.0e-08	30.2
AYQ87119.1\|1270901_1271648_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AYQ87120.1\|1271868_1272489_+	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AYQ87121.1\|1272488_1273871_+	cytochrome b	NA	NA	NA	NA
AYQ89503.1\|1273893_1274652_+	cytochrome c1	NA	NA	NA	NA
AYQ87122.1\|1274747_1275359_+	glutathione S-transferase	NA	NA	NA	NA
AYQ87123.1\|1275426_1275927_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	3.5e-20	45.8
AYQ87124.1\|1276111_1276396_-	hypothetical protein	NA	NA	NA	NA
AYQ87125.1\|1276392_1276785_-	DUF2778 domain-containing protein	NA	NA	NA	NA
AYQ87126.1\|1277239_1277683_+	hypothetical protein	NA	NA	NA	NA
AYQ87127.1\|1278069_1279254_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.2e-18	32.4
AYQ87128.1\|1279350_1280136_-	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
AYQ87129.1\|1280132_1281479_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AYQ87130.1\|1281579_1282197_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AYQ87131.1\|1282570_1283242_+	hypothetical protein	NA	NA	NA	NA
AYQ87132.1\|1283278_1283797_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
AYQ87133.1\|1283812_1285303_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
AYQ87134.1\|1285379_1285883_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
AYQ87135.1\|1285971_1286454_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
AYQ87136.1\|1286531_1288370_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
AYQ87137.1\|1288333_1289431_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_4

1585696 : 1594666

Chrysochromulina_ericina_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ87375.1\|1585696_1587643_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.2e-146	49.8
AYQ87376.1\|1587858_1588995_+	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	1.0e-22	27.6
AYQ89523.1\|1589017_1590862_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	9.5e-55	38.1
AYQ87377.1\|1590959_1591775_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.3e-35	30.9
AYQ87378.1\|1591821_1592505_-	deoxynucleoside kinase	A0A249XZR7	Enterococcus_phage	3.9e-06	29.3
AYQ87379.1\|1592501_1593032_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AYQ87380.1\|1593061_1594666_-	polynucleotide adenylyltransferase PcnB	A0A1B0V011	Roseobacter_phage	2.3e-17	28.8

DBSCAN-SWA_5

1818698 : 1828079

Bacillus_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ87561.1\|1818698_1819817_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.0e-23	34.5
AYQ87562.1\|1819938_1820727_-	DNA mismatch repair protein MutS	A0A0P0IDT4	Acinetobacter_phage	3.0e-10	31.6
AYQ87563.1\|1820865_1821828_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.9e-62	44.2
AYQ89537.1\|1821990_1824435_+	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	3.6e-86	50.8
AYQ87564.1\|1824479_1825163_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
AYQ87565.1\|1825379_1826690_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.2e-80	40.2
AYQ87566.1\|1826777_1828079_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.8e-93	50.9

DBSCAN-SWA_6

1906279 : 1914601

Bacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ87631.1\|1906279_1907680_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.4e-77	37.3
AYQ87632.1\|1907648_1908626_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	4.3e-14	27.2
AYQ87633.1\|1908682_1909675_+	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	1.1e-28	32.3
AYQ87634.1\|1909750_1910086_+	competence protein ComE	NA	NA	NA	NA
AYQ87635.1\|1910321_1911224_+	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.4e-51	39.9
AYQ87636.1\|1911324_1912551_-	lytic murein transglycosylase B	NA	NA	NA	NA
AYQ87637.1\|1912731_1913655_+	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	1.1e-43	34.6
AYQ89540.1\|1913761_1914601_-	alpha/beta hydrolase	A7XCB7	Tanapox_virus	7.7e-20	26.5

DBSCAN-SWA_7

3259647 : 3296177

Burkholderia_virus(73.33%)

terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ88628.1\|3259647_3262245_-	hypothetical protein	Q6J1R0	Burkholderia_virus	0.0e+00	78.7
AYQ88629.1\|3262247_3264506_-	lytic transglycosylase domain-containing protein	Q6J1R1	Burkholderia_virus	5.3e-217	56.8
AYQ88630.1\|3264507_3266571_-	hypothetical protein	Q6J1R2	Burkholderia_virus	2.9e-222	61.1
AYQ88631.1\|3266573_3267158_-	hypothetical protein	Q6J1R3	Burkholderia_virus	2.0e-30	71.8
AYQ88632.1\|3267169_3267598_-	GNAT family acetyltransferase	Q6J1R4	Burkholderia_virus	3.0e-52	69.5
AYQ88633.1\|3267587_3269897_-	hypothetical protein	Q6J1R5	Burkholderia_virus	0.0e+00	76.7
AYQ88634.1\|3269905_3270529_-	hypothetical protein	Q6J1R6	Burkholderia_virus	1.7e-85	73.9
AYQ88635.1\|3270543_3270804_-	hypothetical protein	Q6J1R7	Burkholderia_virus	9.0e-28	75.6
AYQ88636.1\|3270842_3271265_-	hypothetical protein	Q6J1R8	Burkholderia_virus	1.0e-60	86.2
AYQ88637.1\|3271329_3272322_-	hypothetical protein	Q6J1R9	Burkholderia_virus	3.4e-176	90.6
AYQ88638.1\|3272331_3273060_-	hypothetical protein	Q6J1S0	Burkholderia_virus	3.0e-73	76.2
AYQ88639.1\|3273072_3273414_-	hypothetical protein	Q6J1S1	Burkholderia_virus	5.1e-31	67.6
AYQ88640.1\|3273410_3273707_-	hypothetical protein	A0A221SAL5	Ralstonia_phage	8.4e-06	43.7
AYQ88641.1\|3273706_3275356_-	hypothetical protein	Q6J1S2	Burkholderia_virus	2.2e-252	78.5
AYQ89643.1\|3275352_3275586_-	hypothetical protein	NA	NA	NA	NA
AYQ88642.1\|3275648_3277070_-	TerL	Q6J1S4	Burkholderia_virus	7.9e-243	81.4
AYQ88643.1\|3277452_3277635_-	hypothetical protein	NA	NA	NA	NA
AYQ88644.1\|3277631_3278168_-\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	5.4e-51	64.7
AYQ88645.1\|3278164_3278434_-	hypothetical protein	Q6J1S6	Burkholderia_virus	1.3e-26	67.4
AYQ88646.1\|3278778_3281100_-	hypothetical protein	I6NPA6	Burkholderia_phage	6.4e-48	30.5
AYQ88647.1\|3281129_3281627_-	hypothetical protein	A0A2I4R669	Erysipelothrix_phage	1.0e-19	58.2
AYQ88648.1\|3281718_3281913_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AYQ88649.1\|3281986_3282688_+	helix-turn-helix transcriptional regulator	A0A0R6PHL1	Moraxella_phage	6.6e-33	36.7
AYQ88650.1\|3283367_3283550_+	hypothetical protein	Q6J1N4	Burkholderia_virus	4.1e-19	72.4
AYQ88651.1\|3283551_3283734_+	hypothetical protein	NA	NA	NA	NA
AYQ88652.1\|3284013_3284196_+	hypothetical protein	NA	NA	NA	NA
AYQ88653.1\|3284282_3284981_+	hypothetical protein	NA	NA	NA	NA
AYQ88654.1\|3286003_3287386_+	DUF2800 domain-containing protein	Q6J1N8	Burkholderia_virus	3.3e-201	78.6
AYQ88655.1\|3287420_3288026_+	DUF2815 family protein	Q6J1N9	Burkholderia_virus	1.4e-87	78.4
AYQ88656.1\|3288184_3288682_+	hypothetical protein	A0A1X9IAN3	Xanthomonas_phage	1.4e-45	56.9
AYQ88657.1\|3288685_3289021_+	hypothetical protein	A6N3E7	Burkholderia_virus	1.3e-10	41.1
AYQ88658.1\|3289010_3289382_+	HNH endonuclease	Q6J1P3	Burkholderia_virus	1.6e-46	71.9
AYQ88659.1\|3289378_3290131_+	hypothetical protein	Q6IWS1	Burkholderia_phage	1.7e-87	63.7
AYQ89644.1\|3290390_3292436_+	DNA polymerase I	Q6J1P5	Burkholderia_virus	0.0e+00	82.7
AYQ88660.1\|3292485_3292668_+	hypothetical protein	NA	NA	NA	NA
AYQ88661.1\|3293828_3294083_+	hypothetical protein	A9YWU5	Burkholderia_phage	6.7e-28	70.4
AYQ88662.1\|3294079_3294568_+	hypothetical protein	NA	NA	NA	NA
AYQ88663.1\|3294716_3296177_+	DEAD/DEAH box helicase	Q6J1P9	Burkholderia_virus	2.9e-248	88.7

DBSCAN-SWA_8

3643144 : 3714374

uncultured_Caudovirales_phage(24.32%)

portal,terminase,protease,tRNA,tail,capsid,head,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ88939.1\|3643144_3644431_-	DNA cytosine methyltransferase	K4HZD0	Acidithiobacillus_phage	2.4e-65	40.6
AYQ88940.1\|3644507_3644810_-	DNA-binding transcriptional regulator	NA	NA	NA	NA
AYQ89674.1\|3644793_3645177_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AYQ89675.1\|3645547_3645742_+	hypothetical protein	NA	NA	NA	NA
AYQ88941.1\|3645781_3646567_-	DNA adenine methylase	Q8W6S4	Burkholderia_virus	3.8e-130	83.2
AYQ88942.1\|3646727_3647357_-	hypothetical protein	NA	NA	NA	NA
AYQ88943.1\|3647353_3647920_-	hypothetical protein	A0A0E3JI96	Rhodoferax_phage	5.3e-49	53.7
AYQ88944.1\|3647916_3648366_-	hypothetical protein	NA	NA	NA	NA
AYQ88945.1\|3648438_3649488_-	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	1.2e-83	47.5
AYQ88946.1\|3649497_3649704_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	8.4e-13	55.2
AYQ88947.1\|3649678_3650557_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	4.4e-34	36.8
AYQ88948.1\|3650566_3653005_-\|tail	phage tail protein	A0A2H4JG00	uncultured_Caudovirales_phage	3.7e-54	35.6
AYQ88949.1\|3653086_3653389_-\|tail	phage tail assembly protein	A0A1B2LRV6	Wolbachia_phage	6.0e-07	40.3
AYQ88950.1\|3653466_3653970_-\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	5.6e-42	51.2
AYQ88951.1\|3653980_3655150_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	4.8e-161	73.4
AYQ88952.1\|3655221_3655947_-\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	1.5e-59	58.6
AYQ88953.1\|3655960_3657925_-\|tail	tail fiber protein	E5E3V2	Burkholderia_phage	5.3e-128	59.0
AYQ88954.1\|3657912_3658491_-\|tail	phage tail protein I	Q6QI98	Burkholderia_phage	6.4e-34	47.4
AYQ88955.1\|3658480_3659377_-\|plate	baseplate J protein	A0A1J0I2M3	Salmonella_phage	6.7e-46	39.4
AYQ88956.1\|3659373_3659706_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	9.4e-22	50.0
AYQ88957.1\|3659708_3659906_-	hypothetical protein	NA	NA	NA	NA
AYQ88958.1\|3659956_3660637_-\|plate	phage baseplate assembly protein V	E5FFH5	Burkholderia_phage	5.3e-19	32.1
AYQ88959.1\|3660633_3661164_-	hypothetical protein	A0A1B2LRU9	Wolbachia_phage	2.9e-25	43.5
AYQ88960.1\|3661153_3661684_-\|tail	phage tail protein	K7R9K2	Vibrio_phage	3.7e-20	34.9
AYQ88961.1\|3661688_3661979_-	hypothetical protein	NA	NA	NA	NA
AYQ88962.1\|3661980_3662976_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.3e-119	63.3
AYQ88963.1\|3663051_3663396_-\|head	head decoration protein	NA	NA	NA	NA
AYQ88964.1\|3663425_3664514_-\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	8.4e-51	37.3
AYQ88965.1\|3664510_3666001_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	2.8e-137	51.6
AYQ88966.1\|3665997_3666204_-	hypothetical protein	A0A219Y8X9	Aeromonas_phage	3.8e-05	52.1
AYQ88967.1\|3666214_3668359_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	1.5e-181	52.9
AYQ88968.1\|3668877_3669072_-	hypothetical protein	NA	NA	NA	NA
AYQ88969.1\|3669292_3669880_-	hypothetical protein	NA	NA	NA	NA
AYQ88970.1\|3670096_3672598_-	virulence protein E	A0A2D1GN57	Marinobacter_phage	1.9e-98	40.7
AYQ88971.1\|3672756_3673140_-	hypothetical protein	NA	NA	NA	NA
AYQ88972.1\|3673126_3673699_-	hypothetical protein	C7BGG0	Burkholderia_phage	2.1e-29	46.8
AYQ88973.1\|3673778_3673988_-	hypothetical protein	NA	NA	NA	NA
AYQ88974.1\|3674058_3674487_+	transcriptional regulator	A0A0P0J076	Acinetobacter_phage	4.5e-16	63.5
AYQ88975.1\|3674941_3675184_+	hypothetical protein	NA	NA	NA	NA
AYQ88976.1\|3675218_3675596_+	beta-hexosaminidase	NA	NA	NA	NA
AYQ88977.1\|3675595_3676972_+	pyridoxal phosphate biosynthetic protein PdxJ	A0A2I7QW51	Vibrio_phage	1.4e-05	26.3
AYQ88978.1\|3677073_3677466_+	hypothetical protein	NA	NA	NA	NA
AYQ89676.1\|3677474_3677711_+	AlpA family phage regulatory protein	NA	NA	NA	NA
AYQ88979.1\|3677667_3678969_-	DUF4102 domain-containing protein	C7BGE7	Burkholderia_phage	5.7e-139	57.2
AYQ89677.1\|3679127_3681836_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	7.5e-24	23.9
AYQ88980.1\|3681819_3683115_+	hypothetical protein	NA	NA	NA	NA
AYQ88981.1\|3683198_3683747_-	peptidylprolyl isomerase	NA	NA	NA	NA
AYQ88982.1\|3683734_3685006_+	cupin domain-containing protein	NA	NA	NA	NA
AYQ88983.1\|3685245_3685506_+	hypothetical protein	NA	NA	NA	NA
AYQ88984.1\|3685640_3686417_-	MBL fold metallo-hydrolase	A0A2I7SDH3	Paenibacillus_phage	6.4e-29	35.8
AYQ88985.1\|3686421_3687567_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
AYQ88986.1\|3687676_3688579_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AYQ88987.1\|3688623_3689214_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYQ88988.1\|3689263_3690466_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AYQ88989.1\|3690475_3691135_-\|protease	site-2 protease family protein	NA	NA	NA	NA
AYQ88990.1\|3691217_3691853_-	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
AYQ89678.1\|3691932_3692763_-	PHP domain-containing protein	NA	NA	NA	NA
AYQ88991.1\|3692851_3693760_-	alpha/beta hydrolase	NA	NA	NA	NA
AYQ88992.1\|3693894_3694779_-	DUF455 family protein	NA	NA	NA	NA
AYQ88993.1\|3694973_3695498_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
AYQ88994.1\|3695536_3696487_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
AYQ88995.1\|3696538_3696898_+	hypothetical protein	NA	NA	NA	NA
AYQ88996.1\|3697013_3697433_-	cell division protein FtsB	NA	NA	NA	NA
AYQ88997.1\|3697515_3698799_-	enolase	W6LP63	Streptococcus_phage	1.7e-151	62.6
AYQ88998.1\|3698896_3699751_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.0e-48	41.7
AYQ88999.1\|3699747_3701409_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.6e-152	52.4
AYQ89000.1\|3701680_3702490_-	alpha/beta hydrolase	NA	NA	NA	NA
AYQ89679.1\|3702763_3705256_-	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
AYQ89001.1\|3705408_3706194_-	TatD family deoxyribonuclease	NA	NA	NA	NA
AYQ89002.1\|3706198_3706894_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	4.1e-35	39.6
AYQ89003.1\|3706943_3708197_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
AYQ89004.1\|3708517_3709624_+	regulator	NA	NA	NA	NA
AYQ89005.1\|3709633_3711328_+	single-stranded-DNA-specific exonuclease RecJ	A0A0K2FM92	Brevibacillus_phage	5.9e-27	26.1
AYQ89006.1\|3711637_3712666_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	3.5e-06	35.5
AYQ89007.1\|3712844_3714374_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	1.2e-82	37.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033431

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033431_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033431_1

3365719-3365986

Orphan

I-F

Consensus_repeat	Method
TTTCTAAGCTGCCTACGCGGCAGCG	CRISPRCasFinder
TTTCTAAGCTGCCTACGCGGCAGCGAAC	CRT
TTTCTAAGCTGCCTACGCGGCAGCGAACC	PILER-CR

4 spacers

The CRISPR arrays of CP033431_1

>merge|CP033431|1|3365719-3365986|CRISPRCasFinder,CRT,PILER-CR
TTCATAAGCTGCCTGCTCGGCAGCGAACGCACCTCTCACCTCCCCGCGAGCAGCAGTGCCTTTCTAAGCTGCCTACGCGGCAGCGAACCCGGTCGTCTTAGCCATCCCTGCCGGCATCCTTTTCTAACCTGCCTACGCGGCAGCGAACTTGTGAATCTGCTGCGACTGCATGTACATCGTTTTCTAAGCTGCCTACGCGGCAGCGAACCAACGAGCACCACAACTGAATCGCCCGCTACATTTCTAAGCTGCCTACGCGGCAGCGTAT

>CP033431|1|1|3365719-3365983|CRISPRCasFinder
TTCATAAGCTGCCTGCTCGGCAGCG	AACGCACCTCTCACCTCCCCGCGAGCAGCAGTGCC
TTTCTAAGCTGCCTACGCGGCAGCG	AACCCGGTCGTCTTAGCCATCCCTGCCGGCATCCT
TTTCTAACCTGCCTACGCGGCAGCG	AACTTGTGAATCTGCTGCGACTGCATGTACATCGT
TTTCTAAGCTGCCTACGCGGCAGCG	AACCAACGAGCACCACAACTGAATCGCCCGCTACA
TTTCTAAGCTGCCTACGCGGCAGCG

>CP033431|1|1|3365719-3365986|CRT
TTCATAAGCTGCCTGCTCGGCAGCGAAC	GCACCTCTCACCTCCCCGCGAGCAGCAGTGCC
TTTCTAAGCTGCCTACGCGGCAGCGAAC	CCGGTCGTCTTAGCCATCCCTGCCGGCATCCT
TTTCTAACCTGCCTACGCGGCAGCGAAC	TTGTGAATCTGCTGCGACTGCATGTACATCGT
TTTCTAAGCTGCCTACGCGGCAGCGAAC	CAACGAGCACCACAACTGAATCGCCCGCTACA
TTTCTAAGCTGCCTACGCGGCAGCGTAT

>CP033431|1|1|3365779-3365927|PILER-CR
TTTCTAAGCTGCCTACGCGGCAGCGAACC	CGGTCGTCTTAGCCATCCCTGCCGGCATCCT
TTTCTAACCTGCCTACGCGGCAGCGAACT	TGTGAATCTGCTGCGACTGCATGTACATCGT
TTTCTAAGCTGCCTACGCGGCAGCGAACC

Protein	Signature genes	Signature genes Name	Protein_function
CP033431.1\|AYQ92242.1\|3368682_3369621_-\|polyphosphate-kinase-2	unknown	unknown	gnl\|CDD\|213852
CP033431.1\|AYQ92237.1\|3362805_3363204_-\|DUF4440-domain-containing-protein	unknown	unknown	gnl\|CDD\|379209
CP033431.1\|AYQ92245.1\|3372960_3373962_-\|Zn-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176251
CP033431.1\|AYQ92238.1\|3363487_3364276_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616
CP033431.1\|AYQ92235.1\|3359758_3360895_-\|porin	unknown	unknown	gnl\|CDD\|238208
CP033431.1\|AYQ92248.1\|3376209_3376545_+\|hypothetical-protein	unknown	unknown	unknown
CP033431.1\|AYQ92246.1\|3374101_3375004_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP033431.1\|AYQ92230.1\|3353994_3354300_-\|rubredoxin	unknown	unknown	gnl\|CDD\|224462
CP033431.1\|AYQ92243.1\|3369934_3371371_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340821
CP033431.1\|AYQ92241.1\|3366860_3368444_-\|threonine-ammonia-lyase,-biosynthetic	unknown	unknown	gnl\|CDD\|236417
CP033431.1\|AYQ92240.1\|3366209_3366800_+\|YigZ-family-protein	unknown	unknown	gnl\|CDD\|224653
CP033431.1\|AYQ92239.1\|3364379_3365501_-\|hypothetical-protein	unknown	unknown	unknown
CP033431.1\|AYQ92913.1\|3371469_3372282_-\|hypothetical-protein	unknown	unknown	unknown
CP033431.1\|AYQ92247.1\|3375195_3376089_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP033431.1\|AYQ92233.1\|3356951_3358574_-\|ATP-dependent-acyl-CoA-ligase	unknown	unknown	gnl\|CDD\|235719
CP033431.1\|AYQ92231.1\|3354296_3355463_-\|thiolase-family-protein	unknown	unknown	gnl\|CDD\|238425
CP033431.1\|AYQ92234.1\|3358660_3359569_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176148
CP033431.1\|AYQ92244.1\|3372386_3372881_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380353
CP033431.1\|AYQ92236.1\|3361222_3362689_-\|allantoin-permease	unknown	unknown	gnl\|CDD\|224374
CP033431.1\|AYQ92232.1\|3355487_3356831_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927

Protein	Function_ID	Function_description	E-value
CP033431.1\|AYQ92242.1\|3368682_3369621_-\|polyphosphate-kinase-2	gnl\|CDD\|213852	TIGR03707, PPK2_P_aer, polyphosphate kinase 2, PA0141 family. Members of this protein family are designated polyphosphate kinase 2 (PPK2) after the characterized protein in Pseudomonas aeruginosa. This family comprises one of three well-separated clades in the larger family described by pfam03976. PA0141 from this family has been shown capable of operating in reverse, with GDP preferred (over ADP) as a substrate, producing GTP (or ATP) by transfer of a phosphate residue from polyphosphate. Most species with a member of this family also encode a polyphosphate kinase 1 (PPK1). [Central intermediary metabolism, Phosphorus compounds].	6.21526e-151
CP033431.1\|AYQ92234.1\|3358660_3359569_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176148	cd08459, PBP2_DntR_NahR_LinR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation. Salicylic acid is an intermediate of the oxidative degradation of the aromatic ring in soil bacteria. LinR positively regulates expression of the genes (linD and linE) encoding enzymes for gamma-hexachlorocyclohexane (a haloorganic insecticide) degradation. Expression of linD and linE are induced by their substrates, 2,5-dichlorohydroquinone (2,5-DCHQ) and chlorohydroquinone (CHQ). The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.86023e-80
CP033431.1\|AYQ92245.1\|3372960_3373962_-\|Zn-dependent-oxidoreductase	gnl\|CDD\|176251	cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain.	4.16872e-42
CP033431.1\|AYQ92238.1\|3363487_3364276_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.63624e-20
CP033431.1\|AYQ92235.1\|3359758_3360895_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	4.82079e-88
CP033431.1\|AYQ92230.1\|3353994_3354300_-\|rubredoxin	gnl\|CDD\|224462	COG1545, COG1545, Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only].	7.03575e-09
CP033431.1\|AYQ92243.1\|3369934_3371371_+\|hypothetical-protein	gnl\|CDD\|340821	cd03789, GT9_LPS_heptosyltransferase, lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	0.00270394
CP033431.1\|AYQ92246.1\|3374101_3375004_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.02467e-75
CP033431.1\|AYQ92240.1\|3366209_3366800_+\|YigZ-family-protein	gnl\|CDD\|224653	COG1739, COG1739, Uncharacterized conserved protein [Function unknown].	1.44203e-59
CP033431.1\|AYQ92241.1\|3366860_3368444_-\|threonine-ammonia-lyase,-biosynthetic	gnl\|CDD\|236417	PRK09224, PRK09224, threonine ammonia-lyase IlvA.	0
CP033431.1\|AYQ92247.1\|3375195_3376089_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.28178e-54
CP033431.1\|AYQ92233.1\|3356951_3358574_-\|ATP-dependent-acyl-CoA-ligase	gnl\|CDD\|235719	PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional.	0
CP033431.1\|AYQ92231.1\|3354296_3355463_-\|thiolase-family-protein	gnl\|CDD\|238425	cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism. The N-terminal presequence in the SCP-x isoform represents a peroxisomal 3-ketacyl-Coa thiolase specific for branched-chain acyl CoAs, which is proteolytically cleaved from the sterol carrier protein.	1.22081e-80
CP033431.1\|AYQ92237.1\|3362805_3363204_-\|DUF4440-domain-containing-protein	gnl\|CDD\|379209	pfam13474, SnoaL_3, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.88619e-08
CP033431.1\|AYQ92244.1\|3372386_3372881_-\|cupin-domain-containing-protein	gnl\|CDD\|380353	cd02224, cupin_SPO2919-like, Silicibacter pomeroyi SPO2919 and related proteins, uncharacterized sugar phosphate isomerase with a cupin domain. This family includes proteins similar to sugar phosphate isomerase SPO2919 from Silicibacter pomeroyi and Afe_0303 from Acidithiobacillus ferrooxidans, but are as yet uncharacterized. Structures of these proteins show a cupin fold with a conserved "jelly roll-like" beta-barrel fold that form a homodimer.	6.37102e-42
CP033431.1\|AYQ92236.1\|3361222_3362689_-\|allantoin-permease	gnl\|CDD\|224374	COG1457, CodB, Purine-cytosine permease and related proteins [Nucleotide transport and metabolism].	1.95521e-59
CP033431.1\|AYQ92232.1\|3355487_3356831_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.39946e-173

>CP033431.1|AYQ92239.1|3364379_3365501_-|hypothetical-protein
MTFNRKMAQWTAAALAITCLQVTNANAQTLNIPLGTPDGFSASSIKNVGQDRYCISGRVYDDAGPSNTAMAVLVDARHRTVSWKTSIPHPRDYAGNAAVACAASGDAYYVVTQEDTQASESQKQTRIVVSRISSAGRIEKQQTIEAGFDEWFYGLDVSAAGVAVAGGTSATAQRNGPFGTFVARFDANLGTQKLTRLDSGAFWTGSSARIDAQHLLVSGQFMPNPGAGRDAIAASRIDLGSGKYQWSAYPLPDNTRSARSWLSSDGGVAVVGLTPGELAVATIDRNGKPGLSFSGKKALCTIDAVSMTGSTLEAIGRACDGAERTSRVSIDLNARTVGTPQALGGKLDAAGFDGGGWVGVTKDHGAALRRGEE
>CP033431.1|AYQ92238.1|3363487_3364276_+|class-I-SAM-dependent-methyltransferase
MPLQRLRVAEPDTTCKCCGGLSRLCGVVDFSVGGADRIAGRKLDPYAGVPIYYHGCERCRFTFTRAFDDWSPADFAEHVYNDDYPRQDPDYRGDRARANAELIASRFPEMAGQASLDFGSGLGQLERELAAHGFGQVASYDPYAGGTQAAPAPASFRNVLAFEVFEHHPEPHALIETLLSYLDGDGAILLSTLLVPEGPIDGGIGMWWYCMPRNGHISLYSGTALGTLAALHGLKAVSFDEGLHLLYRGAPPIWAARFFGAE
>CP033431.1|AYQ92237.1|3362805_3363204_-|DUF4440-domain-containing-protein
MNPTEQQVLAAADVLIDAFARHDREAYFAAFAPEASFVFHHVDTPLRSREAYERRWREWERDDGFTVLGCESRERAVQLVGEGTAIFTHAVRTRLRTRAGEDQLDERETIVFARAGRHWLAIHEHLSPAPAA
>CP033431.1|AYQ92236.1|3361222_3362689_-|allantoin-permease
MEHPGTTAADLGGAAAQAQPRFSAIETRSIDYVPDSERHGKVIDQGPFWFLGNFQFFTIAIGFVGPGMGLSLGYTILSGTLGILFGTLFMAFHASQGAHLGLPQMIQSRAQFGYRGVVVVLLATAFTFIAFNVVDVVLMASGLHAIFGWSPTAITLVTALFALFLAVYGHDWLHRAFKWMLYASLPLYLVLSAAILLGGVPPKAAAHAGGFSLVAFASQFAASASYNITYAPYVSDYSRYLPRHTRPRAIIAAVFAGAASSAIWLIALGAWLASRLGASDGLIALNEAGNAIFHGFGALIAIMSIGAMVATMGLNNYSAMLTLITGADSFRAVKPTRTIRVVTLLLLSAVWVAISMMLSGNSIDILFAALTMMLYLLAPWTAVNLVDYFFVRRGHYAITHLFTAEGIYGAWGLRGLLSYTIGLLASVPFFVLPGVYTGPLAARLGGVDIAWAIGLAVATLAYLLPWRRIDTRAEAEAIRDSDAALGLH
>CP033431.1|AYQ92235.1|3359758_3360895_-|porin
MQKRALAAFACLVASCGAHAQSSVTLFGVLDEGINYTGNAGGHSAWQQTSVDLVTSRWGIKGNEDLGGGLHAIFDLESGFQVDSGRIYYGDRVFGYQSYVGLQSERFGTITFGRQFDTVADTIAPLTANGNWAGYLFSHPFDNDNTDASFHANNSVKFTSASYHGLTATALYGFGNQAGNFAKNRAIGAGLTYAWNTLTVGAVYEDLGSPGTTTGGSVAPDDMDFIANNQKIYGIGANYGIGPATLGLVYTHVVVQQPTASLYAGAFASPVSRLRFDNIEANAKVYVRPDLFVGAMYTYSRAQLGTGSGENSLHWNQVGLMAQYSLSKRTGIYSQVAYQKSSGGNTGTPLEDAFVLGSAGQSSNSHQVVARVGITHSF
>CP033431.1|AYQ92234.1|3358660_3359569_+|LysR-family-transcriptional-regulator
MINFHSVDLNLLRVFQVILEERSLTRAAQRLQLSQPTISYSLGRLRSLFDDPLFVRSPDGMLPTATAERLAVPLSNAIASIREALQQSEGFDPATSTREFRLAMSDIGEHVFLPRICEKLQRVAPEVRLSAEQVPLREVEEKLRLGQIDFAIGNLPSLMPVTNHALLFRDEFVCMTRKRSGLPVRKLSRQKFLEFSHVSVTTSDSSHLAIDEILRTQGLHRRIALRVPHFTVVPQILERTDWMVTLHKGAALMFNETGRFSIYPMPAEIPDIESTVHWHRNFDNDEGIRWLRQLVIETLHHD
>CP033431.1|AYQ92233.1|3356951_3358574_-|ATP-dependent-acyl-CoA-ligase
MELTDTIVEQPVEESAVNSSRTLPALLAARVARNGAGPLFSDGTTVWTATDAMEVASRRAGTLAAHGVKRGDHVALLCGNRAEFMEVVLGCGWLGAVVVPINTASRGLQLEHILRNSGARLLIAEAHLVDVVHALAERDLPLERIWLIGDPEADSLAPRYSTSPFPPAAEPIPAAKVENGDALAVLYTSGTSGLSKGVICPHAQFYWWGHNTAHDLGVVAGDVLYTCLPLFHTNALNSFFQALMKDAQLIVGRRFSASGFFDALVATQATVTFVLGAMVPILLGRPAATNERSHRVRVALAPGVPGHFQEEFTARCGITLIDGYGSTETNAVIGGIASVRRPGYMGKLARGFEARVVDEHDQAVPDGEPGELILRADEPFSFASGYLGMAAETVKAWRNLWFHTGDRVIREADGYFRFVDRQKDAIRRRGENISSYEVEQVLLSHPAVETAAVFAVNSALAEDEVMAVIGLRDGEVLEPLDLIRYCEPRLPYFAVPRYLDFEQELPKTENGKIQKFKLRQTGLTATTWDLETSGYRLKRR
>CP033431.1|AYQ92232.1|3355487_3356831_-|MFS-transporter
MTSTRTLCAASTPPQAVPEPLAGSVDDRSLRRIVFASVAGNALEWYDFFLYSTAAALVFGELFFPKGTDPLVGTLVAFAGFSVGFAARPLGGALFGHIGDRYGRKSALVWTLSIMGAATFLIGFLPTYSQVGLWAPALLTVLRILQGIAAGGEWGGAVLMISESAPPEKRGFYASMSQIGVGGGFVLSASVFFLVQMLPKDEFMTWGWRIPFLLSIAIFGVGVYIRSRLPESAEFAKAEAEGRRARMPVLDVIRKYPKEVLMAMGLRVAENGASYIVIAFALVYGKFIGVPNQIMLAGVIVSMAVELVTLMLWGRLSDRLGRKPVYMIGALGVVIIAFPFFWLLDTKVPALIWLAFLLGNAVCHGAMLGTQPALMGELFTTEVRYSGMALGHEVSSVFAGGLSPLLATALLAHYHAAWPVALLMAGLGMITVISLFFTHETVARRER
>CP033431.1|AYQ92231.1|3354296_3355463_-|thiolase-family-protein
MTLDKCHEALLTAGVEIPYRRQATSDSTGDLLAQAFAAALDESGFTAKDIDGFGVASFTLSPDHAIDLAWRLGLSPRWCMDDCHGGASAINMLQHAVRAIQHGDATAIALVSGDRFEPADFKQLVDHYNLTTRNWLRPLELGGPNGLFAMLTQRHAKRHNLTRRDYGALCVAQRAWAALNPHAVYRTPLTIEDYLEAPIIADPLGRFDCVPVVSGANAVIIARADLVRRARNVRVRSLQCRYNGDDQAGDGTETSLATIAGDLWRQAGVTPDDIDMVSVYDDYPVMAIAQLADLGFAPDGDLRAMIARIESRDLPVNTSGGQLSAGQAGAAGGMHGLVEALAQLQGRAGERQVPNARLALVSGYGMVEYRYGMCANAAVLEAVERGVQ
>CP033431.1|AYQ92230.1|3353994_3354300_-|rubredoxin
MTLKVFQCKQCGSTVFPARYFCFDCGGAEWRERVVERGTVDECTTVRRRVGSQDGNDVLIASVTTDAGPIVIARLERNVRVGDDVGLAIDEQNRVLARPIA
>CP033431.1|AYQ92240.1|3366209_3366800_+|YigZ-family-protein
MTYSLATTYSCELEIRKSRFIAHAIPVADRDAAMAELQRLRAEHATATHVCWALLAGGQSGMSDDGEPSGTAGRPILEVLRHHDLDGVLGAVIRYYGGVKLGAGGLVRAYTDAIAGALLDAQRVERIAMTRFAIEMSYPDEARVRRWIEQGGHELVDSAYGMTVKLVIKLPVTEVEAARSTLIDATQGRAGFPAFE
>CP033431.1|AYQ92241.1|3366860_3368444_-|threonine-ammonia-lyase,-biosynthetic
MLSPSRRGQETATTPSAEIASSVDAYLKKILTSRVYDVAVQTALEPARNLSARVRNRVHLKREDHQPVFSFKLRGAYNRMAHLSADALARGVITASAGNHAQGVAFSAARLGVKAVIVVPVTTPQVKVDAVRAHGGPTVEVIQAGESYSDAYAHALKVQEQRELTFVHPFDDPDVIAGQGTVAMEVLRQHQGPIHAIFVPIGGGGLAAGVAAYVKAVRPEIRVIGVQAADSCAMARSIEAGERVTLGEVGLFADGTAVKLVGEETFRLCRELLDEVITVDTDALCAAIKDVFQDTRSVLEPSGALSVAGVKRYAEREGLEGETLVAITSGANMNFDRMRFVAERAEVGEAREAVFAVTIPEERGSFRRFCELVGDRNVTEFNYRIADARSAHIFVGVQIRRRAEPAEIAANFEAHGFRTADLTDDELSKDHIRYMVGGRSPLSREERMFRFEFPERPGALMKFLSSMAPNWNISLFHYRNQGADTSSILVGLQVPEADHAAFDTFLATLGYRFQEETSNPAYRLFLG
>CP033431.1|AYQ92242.1|3368682_3369621_-|polyphosphate-kinase-2
MSENRPEDRDAAELEAVERQRRLEEDLVDAYDEELEMELDDRRFDEPDTIFTAERREQRKQYFRELFRLQGELVKLQDWVVSTGHRMVVIFEGRDAAGKGGAIKRITQRLNPRVCRVAALPAPSNRERTQWYFQRYVAHLPAGGEMVLFDRSWYNRAGVERVMNFCTDAEYEEFFRSVPEFEKMLVRSGIQIVKYWFSITDEEQETRFEARIQDPLKQWKLSPMDLESRRRWEAYTVAKEEMLARTHIPEAPWWVVQAVDKKRARLNCIDHLLSLVPYHEVEREPVTLPERVHHEDYLRRPTPREMLVPERY
>CP033431.1|AYQ92243.1|3369934_3371371_+|hypothetical-protein
MRTVPSKSSAEPFRVPLAKPAAPAIPPFLRQICERLVAQQREDELLPWADRALLIDPLALDFVEMRALALSLGGLHREAAETLRRHQDGLRSRRRDFESWLGYELSMAGDPEAGAARLDEARRQAVAAGDTAIASLAAHRLGDAQLRQGKPQGFANWLHRNEDPNSSGSYRPASLPTWNGGDPSGRRVLVTHQLGFGDQLLMLAAARDWLHAGARLMISCDKPLLPLLRASLPECRVIDAPRPLTQAEPWPEDEALRREFEVFAPELHATLLHLPLLDAARAQPRGRFEPYLRVPPERARDAALWARRMRAAAPGRKLVGLCYDCAHRHRPELGSAIRCWAGLRSLPRVEIERLVAHPALAEHIQFVSLHHPSGEALAGGLPRGMRHYAPDIEDFADTAACIQELDAVIAVDSAVANLAALLGARTCVPLNQAGDWRWGNRGRDTPWLSGVTVLRQRETGNWAPVFEEIVNWLRDEVI
>CP033431.1|AYQ92913.1|3371469_3372282_-|hypothetical-protein
MPSFLPRLLAVCACACVCLPALAHAAAQDSAASSEPAASPASPAARPAAAQPFVGDDALAVRDALAKAKLDTGKPSLKEHAREWLHAVARQPTDEPALKPLGLDRTLRFVIPVSYGILYRAKRHQLSVDLDLSSEATPDTILLRKAITGPRGRRLVVAAEAKAKGYIQHIDIIEMDPGKARQTAVRAQVSVAPSDFAAAGDDGGFAIVLLAELAPPYLSERSEHSEPSNEEPTDITTRTSTLHAQVQAVWLVNTKTGAVLTRKLRLSSSK
>CP033431.1|AYQ92244.1|3372386_3372881_-|cupin-domain-containing-protein
MSRPEFIKHWTELEGADDQHYPGDSELMGIGAPLARKLGLERIGIHHVRLLPGRRTSYPHAESTEEEFVYVLEGTPDAWIDGHLHRLEPGDAVAFPAGTGICHSFLNNTAEEVRLMVIGEPAKDDNRIRYPLNEAHQARRPDGWADWPTRELGPHDGKARVEPE
>CP033431.1|AYQ92245.1|3372960_3373962_-|Zn-dependent-oxidoreductase
MKAICVTPERTLEVRDIPSPAEAAPGHLLVDMEASAINHGDKTFLRLPNAAGAGLPAVGQGVWGASGAGTVRAIGAGVPADYLGRQVAIYRSLTRSAETIGLWSEQAQVPWTSCLILPETVRARDYCGSLVNVMTAHAFLEEIVAAGHRGVIVTAGNSATGRALGALARARKLPAILLVRHAEAAEALRREGEPHVIAAGEGLVDRLAPLAETLGATAVFDGVGGALASALVPALPMHSTLYAYGFLDRAAPFSIPTSLLMMKDLTVRRFSNFESATVREPQRLAAALRALEAVIGDPVFRTRLGEAFAYEHVEQAMALEAPEGRKAILLARA
>CP033431.1|AYQ92246.1|3374101_3375004_+|LysR-family-transcriptional-regulator
MDRLDAIRLFVRLVERGSFSAVGREQGIGQPAVSKQIAALERHLGAQLLLRTSRRIAVTDAGQAFYESARQLVEDFDAVESSVGERQQSPRGLVRLNTAPGHGRLWITPRLPEFFARHPEVSVELSVSERNVDLVGQGIDLAIRHGKLVDSSLIARRLGETALVLAASRDYLAAHGTPARLDDLDAHRCIVFSRDREPYPWALRVGREALSYRPRGSLLTGDAEHVRAAVVNGLGISQAPLWLLEDEICAGRVQVLLPRLQPEPLPIHLVHAAGRRVPMRVRVLIDFLVEIFASDERARR
>CP033431.1|AYQ92247.1|3375195_3376089_+|LysR-family-transcriptional-regulator
MELKHLGAFVALADELHFGRAAERLCIVQPALSMQIKTLETGLGVRLFDRDRHKVALTEAGRLFLPEARATLEQAARAAQVARLSAQGEIGTLRLGFVSSVLPQLLPTLIRTTHARYPRIALELKDMPTPDQIAALHGGTLDFGLARLPIAASGLSSRVVMEESFVVAVPASHPFARRRRIEPAALRGQPAFVLARRYAPGFFDALLVALGTQQVTLDIARELGEYTTMLALVAAGLGIGLIPAEAAAAVPHNVVALPLALPGYRAPLGLIWLDDGSILKRVFVEVVEQCVANGWQA
>CP033431.1|AYQ92248.1|3376209_3376545_+|hypothetical-protein
MRHIQAVSPSLQRSPSPSIRVPRPAQAVVRIALTRHDRDAQLATLLRSPLASHLVEARPARRAIHLSLVTAPDDMRALLDLLMATLDEATIGTITRSLLVAPAASAIRQEH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033431_1	1.8\|3365927\|32\|CP033431\|CRT	3365927-3365958	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1028939-1028970	7	0.781
CP033431_1	1.5\|3365747\|32\|CP033431\|CRT	3365747-3365778	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3239700-3239731	8	0.75
CP033431_1	1.9\|3365808\|31\|CP033431\|PILER-CR	3365808-3365838	31	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	108485-108515	9	0.71
CP033431_1	1.6\|3365807\|32\|CP033431\|CRT	3365807-3365838	32	NZ_CP054615	Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence	108485-108516	10	0.688

1. spacer 1.8|3365927|32|CP033431|CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

caacgagcaccacaactgaatcgcccgctaca	CRISPR spacer
cagcgccttccacaactacatcgcccgctaca	Protospacer
**.**  . ********. *************

2. spacer 1.5|3365747|32|CP033431|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gcacctctcacctccccgcgagcagcagtgcc	CRISPR spacer
cggccagccacagccccgcgagcagcagtgcc	Protospacer
  .**  .***  *******************

3. spacer 1.9|3365808|31|CP033431|PILER-CR matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.71

cggtcgtcttagccatccctgccggcatcct	CRISPR spacer
catagagcttcgccatcccggccggcatccg	Protospacer
*.   . *** ******** **********

4. spacer 1.6|3365807|32|CP033431|CRT matches to NZ_CP054615 (Azospirillum oryzae strain KACC 14407 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ccggtcgtcttagccatccctgccggcatcct	CRISPR spacer
acatagagcttcgccatcccggccggcatccg	Protospacer
 *.   . *** ******** **********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2466517 : 2475043

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYQ91576.1\|2466517_2466808_+	co-chaperone GroES	A0A221S4A8	uncultured_virus	6.1e-17	42.6
AYQ91577.1\|2466825_2468460_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.3e-169	60.1
AYQ91578.1\|2468574_2469774_-	alginate O-acetyltransferase	A0A125RNN9	Pseudomonas_phage	2.4e-19	27.7
AYQ91579.1\|2469778_2471200_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	8.6e-80	37.7
AYQ91580.1\|2471583_2472135_-	thioredoxin family protein	NA	NA	NA	NA
AYQ92857.1\|2472439_2472811_+	GFA family protein	NA	NA	NA	NA
AYQ91581.1\|2472971_2473718_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	4.4e-27	34.4
AYQ91582.1\|2473714_2475043_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.5e-14	27.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033430

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033431

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection