CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP033440	Leptospira borgpetersenii serovar Hardjo-bovis strain L49 chromosome 1, complete sequence	1 crisprs	WYL,cas3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,RT,csa3,DinG,Cas9_archaeal	0	1	8	0
CP033441	Leptospira borgpetersenii serovar Hardjo-bovis strain L49 chromosome 2, complete sequence	0 crisprs	csa3	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033440_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033440_1

2033956-2034030

Orphan

Consensus_repeat	Method
GCGGAGCGTTTAAAATTTGTCTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033440_1

>merge|CP033440|1|2033956-2034030|CRISPRCasFinder
GCGGAGCGTTTAAAATTTGTCTTTCAACACGTTAGTTGAAAAATAGAGCGAAGCGGAGCGTTTAAAATTTGATCT

>CP033440|1|1|2033956-2034030|CRISPRCasFinder
GCGGAGCGTTTAAAATTTGTCTT	TCAACACGTTAGTTGAAAAATAGAGCGAA
GCGGAGCGTTTAAAATTTGATCT

Protein	Signature genes	Signature genes Name	Protein_function
CP033440.1\|AYR08756.1\|2026771_2027119_-\|hypothetical-protein	unknown	unknown	unknown
CP033440.1\|AYR08755.1\|2025480_2026779_-\|[cytidine(C)-cytidine(C)-adenosine-(A)]-adding-enzyme	unknown	unknown	gnl\|CDD\|237339
CP033440.1\|AYR08767.1\|2041186_2043895_-\|preprotein-translocase-subunit-SecA	unknown	unknown	gnl\|CDD\|237259
CP033440.1\|AYR08766.1\|2038613_2040011_-\|TolC-family-protein	unknown	unknown	gnl\|CDD\|224455
CP033440.1\|AYR08769.1\|2045584_2046166_-\|hypothetical-protein	unknown	unknown	unknown
CP033440.1\|AYR10098.1\|2040161_2040539_-\|hypothetical-protein	unknown	unknown	unknown
CP033440.1\|AYR08757.1\|2027138_2027528_-\|reverse-transcriptase-like-protein	unknown	unknown	gnl\|CDD\|260011
CP033440.1\|AYR08763.1\|2032785_2033919_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133022
CP033440.1\|AYR08760.1\|2029022_2029763_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180838
CP033440.1\|AYR08771.1\|2046699_2047713_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223506
CP033440.1\|AYR08770.1\|2046140_2046698_-\|DUF4416-family-protein	unknown	unknown	gnl\|CDD\|379590
CP033440.1\|AYR08768.1\|2044025_2044778_-\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153212
CP033440.1\|AYR08761.1\|2029792_2031289_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
CP033440.1\|AYR08764.1\|2035070_2035379_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP033440.1\|AYR08758.1\|2027524_2027842_-\|hypothetical-protein	unknown	unknown	unknown
CP033440.1\|AYR08759.1\|2027964_2028732_+\|arginyltransferase	unknown	unknown	gnl\|CDD\|234939
CP033440.1\|AYR08754.1\|2020679_2022311_+\|hypothetical-protein	unknown	unknown	unknown
CP033440.1\|AYR10099.1\|2044774_2045413_-\|TlpA-family-protein-disulfide-reductase	unknown	unknown	gnl\|CDD\|239264
CP033440.1\|AYR08762.1\|2031297_2032767_+\|dolichyl-phosphate-mannose--protein-mannosyltransferase	unknown	unknown	gnl\|CDD\|227621
CP033440.1\|AYR08765.1\|2037610_2038603_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776

Protein	Function_ID	Function_description	E-value
CP033440.1\|AYR08755.1\|2025480_2026779_-\|[cytidine(C)-cytidine(C)-adenosine-(A)]-adding-enzyme	gnl\|CDD\|237339	PRK13299, PRK13299, tRNA CCA-pyrophosphorylase; Provisional.	6.74956e-86
CP033440.1\|AYR08767.1\|2041186_2043895_-\|preprotein-translocase-subunit-SecA	gnl\|CDD\|237259	PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed.	0
CP033440.1\|AYR08766.1\|2038613_2040011_-\|TolC-family-protein	gnl\|CDD\|224455	COG1538, TolC, Outer membrane protein [Cell envelope biogenesis, outer membrane / Intracellular trafficking and secretion].	1.42612e-18
CP033440.1\|AYR08757.1\|2027138_2027528_-\|reverse-transcriptase-like-protein	gnl\|CDD\|260011	cd09279, RNase_HI_like, RNAse HI family that includes archaeal, some bacterial as well as plant RNase HI. Ribonuclease H (RNase H) is classified into two evolutionarily unrelated families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is involved in DNA replication, repair and transcription. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes and most prokaryotic and eukaryotic genomes contain multiple RNase H genes. Despite the lack of amino acid sequence homology, type 1 and type 2 RNase H share a main-chain fold and steric configurations of the four acidic active-site (DEDD) residues and have the same catalytic mechanism and functions in cells. One of the important functions of RNase H is to remove Okazaki fragments during DNA replication. Most archaeal genomes contain only type 2 RNase H (RNase HII); however, a few contain RNase HI as well. Although archaeal RNase HI sequences conserve the DEDD active-site motif, they lack other common features important for catalytic function, such as the basic protrusion region. Archaeal RNase HI homologs are more closely related to retroviral RNase HI than bacterial and eukaryotic type I RNase H in enzymatic properties.	8.6772e-54
CP033440.1\|AYR08763.1\|2032785_2033919_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133022	cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.	3.17174e-47
CP033440.1\|AYR08760.1\|2029022_2029763_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|180838	PRK07102, PRK07102, SDR family oxidoreductase.	4.3732e-64
CP033440.1\|AYR08771.1\|2046699_2047713_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|223506	COG0429, COG0429, Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only].	1.8359e-60
CP033440.1\|AYR08770.1\|2046140_2046698_-\|DUF4416-family-protein	gnl\|CDD\|379590	pfam14385, DUF4416, Domain of unknown function (DUF4416). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 176 and 187 amino acids in length. There is a conserved DPG sequence motif.	5.24303e-47
CP033440.1\|AYR08768.1\|2044025_2044778_-\|type-1-glutamine-amidotransferase	gnl\|CDD\|153212	cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. This group contains a subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain. GATase activity catalyses the transfer of ammonia from the amide side chain of glutamine to an acceptor substrate. Glutamine amidotransferases (GATase) includes the triad family of amidotransferases which have a conserved Cys-His-Glu catalytic triad in the glutaminase active site. In this subgroup this triad is conserved. GATase activity can be found in a range of biosynthetic enzymes, including: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase , anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. Glutamine amidotransferase (GATase) domains can occur either as single polypeptides, as in glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.	1.94945e-44
CP033440.1\|AYR08761.1\|2029792_2031289_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	1.138e-44
CP033440.1\|AYR08764.1\|2035070_2035379_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.45533e-09
CP033440.1\|AYR08759.1\|2027964_2028732_+\|arginyltransferase	gnl\|CDD\|234939	PRK01305, PRK01305, arginyl-tRNA-protein transferase; Provisional.	1.19805e-87
CP033440.1\|AYR10099.1\|2044774_2045413_-\|TlpA-family-protein-disulfide-reductase	gnl\|CDD\|239264	cd02966, TlpA_like_family, TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.	1.83386e-10
CP033440.1\|AYR08762.1\|2031297_2032767_+\|dolichyl-phosphate-mannose--protein-mannosyltransferase	gnl\|CDD\|227621	COG5305, COG5305, Predicted membrane protein [Function unknown].	1.23534e-12
CP033440.1\|AYR08765.1\|2037610_2038603_-\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.16633e-22

>CP033440.1|AYR08763.1|2032785_2033919_+|glycosyltransferase-family-2-protein
MKKKNVTYVIPCLNEEKTLPLVLEKLARLKKELKQYNVEILVSDNGSEDKSISIAKKYGAKVVHCEERGYGAALNFGIKNASGEIVLFADADDTYDFLESPALLAEMEKGAEFVIGSRLDGSIHKGAMPFLHRYLGTPVINWIINLLYSKKGNRVKDANSGFRCFLKKKFLEWEIESTGMEFASEMLVKALRSGVKLSHVPISLYPDVEGRVPHLRTWRDGMRHLLQILIHSQQLFYYTGLILFWIGWAFTILGYFTGIVAIGPFHIFGIHSLTVFLLVATFGQTIWAIGLFLAARKTPELSFYSRLNLLSEDLLFWYSARMILFVILLFAFILFRWWKNSFQVLDLEKEILMISFLSVQILNLIGQTITAHLLKRT
>CP033440.1|AYR08762.1|2031297_2032767_+|dolichyl-phosphate-mannose--protein-mannosyltransferase
MNRLNALLIEIKKDKVFLFLLGLGAFFRFFRLDLQSPWEDELFSIRASSETSFGNLWDWMKNDPHPPLYQTLLYFWFQLFQPTVFVGRLFSAIAGILVPFSFYLLSPHNLSGRIKTSVVVFLSLSTGLIYYSQELRSYSLLVLFSTIQLAILLKSVYENRKEKNLRIYWSLLGISLLASYTHFFGFIWSASIFLGIFITKWIFTKKFPKVEFYFGILFGILFIPVLYLLFNSDKIGIASWIPEAGFTAFLVFFDLIFHSGILKKFIPGIVASLALLAGFVSIYFPKNQMKTVALEPDHKKFVILLGIVFLIFSVVLGILSLIQPLITARNLLVTAPALYFLITTSFSLFPIYKGKRLESILILISIVSLYYFTRFYYKPFKEQWRESSQYIISTIQDRPLEFTLLCSSHTYNMEYFLKTAKIQGVVPKIYTKKEANLFVQDPTKKDLVILETSWKYLNSEDLDSLFAQKIFDRKDQLFYGMRVITIRKR
>CP033440.1|AYR08761.1|2029792_2031289_+|FAD-binding-oxidoreductase
MAKASKVSPKKKTSAKTSKTAKVKKSPIEITLPLPSKVETWGMNHYSLSPVFFPEKEEDFRDLFSYANNKGLKLTLRGGGCSYGDAATNTKGVVIDISKYNRILEFNSKTGIIKAESGVTIKQLWEFGIEKGYWPPVVSGTMFPTLGGALSMNIHGKNNFAVGSIGDHVLEFTFMTPNGKVFVCSRKKNRELFFAAISGFGMLGVFLNITIQLKAIYAGKMKVWPVVGKNLQDMFDYFEREYKSADYLVGWIDAFASGNSLGRGQIHKAVHLKKGEDPDFPENCKLERQNLPSTFLGIIPKSWMWLFMIPFANNLGMRLVNFAKFVSGYLTNNKPYFQGHAEYAFLLDYVPNWKLMYKPGSMIQYQSFIPKENAVDAFCEILKICQKRRIVTWLAVFKKHKSDPFLLTHALDGYSMAMDFPVTFGNRKRLWELAGELDEIVLKFGGKFYFAKDSTLRPETVQRAFPKKNLEKFYSLKRKLDPKGILETDLYRRITGTW
>CP033440.1|AYR08760.1|2029022_2029763_+|SDR-family-NAD(P)-dependent-oxidoreductase
MAKKIVVVGASSGIGKELAILLLEQGHTVTLVARRDKELKAIAAPFNSPGKTNAFVIKQDVTNFDQVDSAFQKAVKSMKGVDEIYYASGIMYDVKPDEFDVTKDIAMLNTNLLGCVAWLNLAAVLFQKQKSGKIIGISSIAGDRGRRGNPVYNTSKAGMNTYLEALRNRLSTLGVQVLTVKPGFIDTAMTRGMKGLFWLISAKEAATIIVKAADSGKECVYVPARWGLVGLIIRLIPSFLFKRLSI
>CP033440.1|AYR08759.1|2027964_2028732_+|arginyltransferase
MIRHKLQNFVNSLPISPERSCSYYPDRLSQIQYLPLQGKIEKDNLQFFFDSGFRRTGNILYRTSCNACRECLSYRVPLNQFVPSRNRKRLLKKNSDLVVRFGSPHLTVEKEILYLRYQRSRYQSFVIGESDQELLEGMRWNLFGYPENSLEMTLSLDEKILGFMILDSASDSLSAVYSVYDPDYPDRSLGSFAILYSILYAKELGMKYYHLGYFLPGHPDMDYKKHWVPSEIRELDTNDWIPFEEFQKKYADFSW
>CP033440.1|AYR08758.1|2027524_2027842_-|hypothetical-protein
MHNLFTNFEVKKRGLRVALFFTIVSLICFLIENTILQFIFLGLGFVSFAFTLVQPEIFYSFTNRSLEFVLVFLSGIVKVGLLLIYLIVFKPIRFVIGLFLREKKS
>CP033440.1|AYR08757.1|2027138_2027528_-|reverse-transcriptase-like-protein
MISIFCDGASKGNPGPSSIGVVAYKGDKEEFRISERIGETTNNVAEWASLKKGLEECIRRKFDTIHAYMDSELVVKQVSGKYKVKHPNLLEYKKEVDKLLSSLQNFQITHVPREKNSVADKLANEAFQK
>CP033440.1|AYR08756.1|2026771_2027119_-|hypothetical-protein
MWRISFYVFLFYTASNCGRSLEDKLVVLQKEEKFEEMLLLCLSEKETQDTKELCRLAMEKTEAGIDRILSEKTELPYSQITVDPEWKKKIDIILENNRTLKNRYGNLWKKMIQND
>CP033440.1|AYR08755.1|2025480_2026779_-|[cytidine(C)-cytidine(C)-adenosine-(A)]-adding-enzyme
MTNVDPDELIKKIPENFREDIIRITQNIRKEGGECYLIGGSVRDLLLSKIPDEFDLTTSLLPDKILTLFKRTVPTGIKHGTVTVLIQDRSYEITTFRKDVDYIDGRRPEAVEFGVSLSEDLKRRDFTMNALALDLEAKRLIDEHSGLEDIQNKIIRTIGDPIERFTEDGLRPIRAIRFVSSLGFALESETAKAIIQCRNITAKISKERVHDELNKTLKSKNPAPSLKLFKEFRILELFTSLKLYPTENTNVEKKIREVPVVPLSLRLSFLHAWLFGSFQDRNSAKQFMKDLRYSNQNTKDSLFFSDMLFMMLNRKDDASLTDAEIRKAVLHPICVYAGRENLRILTEYILNLAYTYEPILKDIFDFRRILDLTERSQALVVTELALRGEDILRACPNLPPKQIGSVLEKLLFHVLENPDENRKDFLFPLLFK
>CP033440.1|AYR08754.1|2020679_2022311_+|hypothetical-protein
MFNRLIFSPYFRYFIYLFAVLFLIFNRFKLDDKVPFVSSDSEIKYYQTIMFFEKGFKAVAESECLYPGKIYDPEFRYFPFDYPWAFLKENENRKCIFQYPPLFALLNGIPAYFFGAKIITLLPLLYLFGCLLIFDKILSLFIDKTWVILIGTLVPFTLSFPALSSVEFSEVPLNNFLLLSFGYFLIRSLFADKITVQNKNLNSNFRIFSFISGFLAVTAFFLRTESAFPIFLFGFLAFFSQKTRNNLKEYLIFSVPGGVLSFGFIGVLNFFYSGHPMGIRFLVSSQDAMSQFSIGKQIVILEGYLLGDATKSGFLKASPYAILIFGIFSDLIRKKELSGGSILGLVGIGTLFSISFFSPYTAGVHHFGLRYLESGFVFLSAGILIFLYQRNIEFPNIGRVLILLTFLSLYYNYKFTREGFKILFGSIAPYLQIQNEFQSKRIIVHKGQFTNYLIGYSYLNSLHFTVYTEKDAIQLEQTFKKNRVDSYSILEYEPEPPKDPNLPEKQFKEKIAVRFPDPNRYYRVKDQKKILNFSLRTYQLYKN
>CP033440.1|AYR08764.1|2035070_2035379_+|XRE-family-transcriptional-regulator
MFKSLHSREAKIFCKNLIAARKSADLTQLEIAKRLGEPQSYISKIESGERRLDVIEFWRIYKILGKSFEFYFQFDEKPEGSEKRSKTLKAASGKRKKKRSKF
>CP033440.1|AYR08765.1|2037610_2038603_-|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MKIHFTRRTLLIAGAAAVIAIVSIAILALSKKNKQSILPPSKAIVHDKGEWIEFKENSPGLEIIKTSQIGKEGEFVEVEAPARLIASTSPSMSGGEKIILFESADLNDLYVGYIHSKNSLNRSRKNLERIKDMFKHRVATEKDLIEAETNAAELAEFEGKLRAVGLNPNELRGAGAQSAWIICDVPESQLQSLKKGKKVNLKFSSFPEANWVGVAEALGDNVDPMTRTVKVRILIRNENYVLKPGMFATVRFPEDRKGDTVIVPFTSIITVEGKNYVFVEEAPREFYKREVVLGTSGEDRVTIVEGLTKGDKVVVERNHLTQRTQLRFLT
>CP033440.1|AYR08766.1|2038613_2040011_-|TolC-family-protein
MRKIFTFLLLLWMVPILSEGGKTGADPGLGIPESPNQSENPIQREVVATPDKERTLDLKTAEEKLWKNNLLLLASRFNIDARKAGIEQAGLYANPNIFIDQSIYAEPTQRYFDFTRSGQTVVQIQQLFLLGGKIGKRVRVAELNARMGEQEFYDLARELVTKLRKLFYAIYYYRQAISFYDQSLEALGRTVTSAEMGYKRRAILQAEVLRLKALYFFLKKEREELNIRILEREADLRVLLNDDSFRSSDVKIVPMIVENQLDNLEPGKLKRDELLELARNKRPDLKKAIQALRYEEANLELQHANAIPDLAFGPMYNRGGTAFQNYWGITAQLNIPIFDRNQGNIKASEKAILSRKQELKNTLLEVENEVAVSIETARLKDELYKKFRNTYTKEYTDLSKDMILSYEKRYITISEFTDFFETYCSSVVEMLKLQTDRMDAIEGVNFSVGQGVLIPKFSDPVTEEK
>CP033440.1|AYR10098.1|2040161_2040539_-|hypothetical-protein
MKVRWIHRFLILVLTTVIVLPCEEDGTFDLAFLDVRGGEIHFALAKKIQNQSHRKTRSEIQSGIEARDLVVCLRGRYDFLDLVFSGFFELSKTEVHFFSGKFSAPKTHFSYLLSSLLLNLPPPTA
>CP033440.1|AYR08767.1|2041186_2043895_-|preprotein-translocase-subunit-SecA
MIQNILRVILGSKFERDLKKLIPIVGQINSLEKEMKETSDSLLSSQTQKFRERIARGESLDSILPEAFATVREVSLRTMGMRHFDVQMMGGIALHRGNIAEMKTGEGKTLTSTLAVYLNSLAGKGVHVVTVNDYLAKRDANWMKPIYDFLGISVGVIQHDMDHEQRKIAYSADITYGTNNEFGFDYLRDNMVSHKDHKVQRSHFFAIVDEVDSILIDEARTPLIISGSSDETTDKYVRINKIIPKLVAIEDFEVDEKARNVLLSEKGVSHVEEILGIENLYAPENVDLVHHVHQALKAHKIFQKDVDYVVQNGEVIIVDEFTGRLMAGRRYSDGLHQALEAKESVTIAKESQTLASITFQNYFRMYDKLAGMTGTADTEAEEFRKIYDLDVIVIPPNVSVRRKDSPDRVYRTEKEKFDAILAEIRELQSKKQPVLVGTISIEKSEILSKMLSSAGIQHNVLNAKFHEREAEIVANAGKPGAVTIATNMAGRGTDIVLGGAQLYKENLETWKDDDDLVRRFKESILKQELDNAELLIREMDSSVKQKRASEILESVKIWKKNHEDVLVAGGLHILGTERHEARRIDNQLRGRSGRQGDPGSSRFYLSLQDDLMRIFGSDRISGLMKWANMPEGQEIESKMVSNAIARAQKRVEGHNFDIRKHLLEYDDVMNRQRIVIYKMRNEVLENEDISSLILSFIEEAVENQIVAHCEGNNPSSWNLDSLKEWLEGLELNLEINEEDFKKTKNPQLALFEKVNAAAKQKYEDRAESIGKDIWKLLERNIFLDILDHRWKEHLYSMDHLREGIWTVGYSERNPLVEYKLQGFRMFDVAIENLKNEVVNFLFRVEVSENSKLPEERREYKKVGQEVTGGFQELSSGTPSPTVTVTTSSGGGTERKTSRRRKR
>CP033440.1|AYR08768.1|2044025_2044778_-|type-1-glutamine-amidotransferase
MRSLIVRFKDCEGPGILLDSLKERNYKITYHNAYDSRVRPFPDAHLVFDLVVLLGGPQSVTDPTLVPFFEPWLNLVRYTASMPNRKVIGICLGAQIISKALGGEVRRGEKGPEVGFYDVQVQEPTHLVFDGITSFPAFHLHEDIFSIPQRAKHLLKSEMYSNQMFSFQDRIFGIQCHMEVTASMLKVWRVVHSDFIRSWVPGPDTEILRSQMENVGRRVFAAILDLTPDSTVDRSAFIPQSPDFVAAENG
>CP033440.1|AYR10099.1|2044774_2045413_-|TlpA-family-protein-disulfide-reductase
MNSEPHFRIISSFFLGSYIYLMNRILLCFVFCILTVHCTLSEQPNLGIYEFQGITLDGTLVRLSEVEAPRLVLNVYGPNCVPCIKEIPALNYLYQDMQKDPKIQFYMAVDPTLFFDEAETMSEEELLTKGIFLVKEEIRKYGIQVPTLLMKKPFRVSRTGSIVTGTPETLLFKTKPFVLYYNFIGPISEEENPQRLSVDQKVLFFKRMAGSS
>CP033440.1|AYR08769.1|2045584_2046166_-|hypothetical-protein
MFRISVKHNIVPFAFLFHLLSFSGACVPVQLEITSVTLCDHFNRSGECLEPVEKDHHYKVEIPHIKKPDTWEKFANYLYFHARETPGFLIRFNRKLTPSESRAIQDSYYATMSFSGTVERMEGFEIGEDWIGSFQYLGSIIKNKLKKENRLGSYPYTNMIFPAEVEFKFDSSLFEGGEKTKINLSYIVLPPEK
>CP033440.1|AYR08770.1|2046140_2046698_-|DUF4416-family-protein
MDSSKKNTPIKGKLAKPPGASFFIVVVYENAEIFYSIKTKTEKKFSATLYESNSMPAWKDPEEELWNQSPGRHTKILSFKRRIHREELPSIQKECLSIQNAAIERDRGVRIFPGYLCNHSVVISSIQDDFHRIYLFNGVYAETVYNYQKQKMVYRETAPSFFKTTEAVYFFTSLRESYVQNISKA
>CP033440.1|AYR08771.1|2046699_2047713_-|alpha/beta-fold-hydrolase
MSFQSFKPKRFFKSGHLQTVYSTFFPPENHLRSKFYFEDILLQLSDNSGDALWLEHNPPIARYSSSGPVWNGIYLVMIHGMEGTSDSAYLVSLAQSALLRGYGCVRMNLRNCGRGQGFSKGTYNIGQTRDVQDVIDFVWKKLSHRIFLSGFSLSASLVLKYLGEKRNHKVEAFSSTNPPLDLFKGCKFIDSRKARFYRNRFVSGFRKKIKNKVIQLPPELEKNAFRVKTFFEFDDQVTAPFFGYKGAVEYYQDCSSIRYIPNIRHPGIVIHSEDDPVVPPFDWETICWDKLPQIQTILSPKGGHVGFLTDPTPEIPDGRWLNKIILDYFDSKTNSGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033440_1	1.1\|2033979\|29\|CP033440\|CRISPRCasFinder	2033979-2034007	29	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	43605-43633	8	0.724
CP033440_1	1.1\|2033979\|29\|CP033440\|CRISPRCasFinder	2033979-2034007	29	NC_018487	Bacillus thuringiensis HD-771 plasmid p03, complete sequence	38173-38201	8	0.724

1. spacer 1.1|2033979|29|CP033440|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 8, identity: 0.724

tcaacacgttagttgaaaaatagagcgaa	CRISPR spacer
acaacacgttagttgaagaatacggttct	Protospacer
 ****************.**** .*.

2. spacer 1.1|2033979|29|CP033440|CRISPRCasFinder matches to NC_018487 (Bacillus thuringiensis HD-771 plasmid p03, complete sequence) position: , mismatch: 8, identity: 0.724

tcaacacgttagttgaaaaatagagcgaa	CRISPR spacer
acaacacgttagttgaagaatacggttct	Protospacer
 ****************.**** .*.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

19143 : 85742

Lake_Baikal_phage(16.67%)

protease,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR07209.1\|19143_20100_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AYR07210.1\|20982_21546_-	lipoprotein LipL21	NA	NA	NA	NA
AYR07211.1\|21685_23242_+	VWA domain-containing protein	NA	NA	NA	NA
AYR07212.1\|23264_24158_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AYR07213.1\|24099_25188_-	DNA polymerase III subunit delta	NA	NA	NA	NA
AYR07214.1\|25274_25490_+	hypothetical protein	NA	NA	NA	NA
AYR07215.1\|25925_27020_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07216.1\|27338_29573_-	adenylate/guanylate cyclase domain-containing protein	A0A2H4N7Z5	Lake_Baikal_phage	3.0e-10	25.2
AYR07217.1\|29638_30652_-	flagellar motor switch protein FliG	NA	NA	NA	NA
AYR07218.1\|31413_31770_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	9.5e-20	52.6
AYR07219.1\|33586_34681_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07220.1\|35679_36948_+	hypothetical protein	NA	NA	NA	NA
AYR09952.1\|37011_37698_+	hypothetical protein	NA	NA	NA	NA
AYR07221.1\|37812_39297_+	HEAT repeat domain-containing protein	NA	NA	NA	NA
AYR07222.1\|39306_40350_+	hypothetical protein	NA	NA	NA	NA
AYR07223.1\|40346_41225_+	N-acyl homoserine lactonase family protein	NA	NA	NA	NA
AYR07224.1\|41497_43315_-	DUF885 domain-containing protein	NA	NA	NA	NA
AYR09953.1\|44068_44596_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
AYR07225.1\|44610_45831_-	protein-disulfide isomerase	NA	NA	NA	NA
AYR07226.1\|45920_46646_-	1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase	NA	NA	NA	NA
AYR07227.1\|46642_47275_-	imidazole glycerol phosphate synthase subunit HisH	NA	NA	NA	NA
AYR07228.1\|47271_47892_-	imidazoleglycerol-phosphate dehydratase	NA	NA	NA	NA
AYR07229.1\|49520_50186_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
AYR09954.1\|50629_51064_+	NUDIX hydrolase	NA	NA	NA	NA
AYR07230.1\|51069_52119_+	hypothetical protein	NA	NA	NA	NA
AYR07231.1\|52751_53912_-	hypothetical protein	NA	NA	NA	NA
AYR07232.1\|54156_54762_-	hypothetical protein	NA	NA	NA	NA
AYR07233.1\|54802_55867_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	9.5e-07	45.2
AYR07234.1\|55931_57425_+	PLP-dependent transferase	NA	NA	NA	NA
AYR07235.1\|57723_57903_+	hypothetical protein	NA	NA	NA	NA
AYR07236.1\|60246_62022_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	3.0e-37	29.1
AYR07237.1\|62673_63333_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AYR07238.1\|63853_65905_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	2.2e-12	22.0
AYR07239.1\|66043_66283_+	hypothetical protein	NA	NA	NA	NA
AYR07240.1\|66532_67627_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07241.1\|67514_67736_-	hypothetical protein	NA	NA	NA	NA
AYR07242.1\|69755_71009_-	class I SAM-dependent RNA methyltransferase	NA	NA	NA	NA
AYR07243.1\|71327_71774_+	hypothetical protein	NA	NA	NA	NA
AYR07244.1\|71727_72138_+	hypothetical protein	NA	NA	NA	NA
AYR07245.1\|72309_72510_+	hypothetical protein	NA	NA	NA	NA
AYR07246.1\|72719_73862_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07247.1\|74013_74211_-	hypothetical protein	NA	NA	NA	NA
AYR07248.1\|75546_76479_+	ferredoxin-NADP reductase	NA	NA	NA	NA
AYR07249.1\|76821_77040_+	transcriptional regulator	NA	NA	NA	NA
AYR07250.1\|77333_77801_+	nucleoside deaminase	NA	NA	NA	NA
AYR09955.1\|77930_79394_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	3.9e-43	36.6
AYR07251.1\|79398_79746_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AYR07252.1\|79738_80332_+	recombination protein RecR	NA	NA	NA	NA
AYR07253.1\|80334_81909_-	hypothetical protein	NA	NA	NA	NA
AYR07254.1\|81912_82755_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AYR07255.1\|82817_84455_-	OmpA family protein	NA	NA	NA	NA
AYR07256.1\|84647_85742_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

396639 : 455003

Prochlorococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR07502.1\|396639_397740_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07503.1\|397736_397931_-	hypothetical protein	NA	NA	NA	NA
AYR07504.1\|398559_399663_-	sensor histidine kinase	NA	NA	NA	NA
AYR07505.1\|400647_401325_+	response regulator	NA	NA	NA	NA
AYR07506.1\|401529_401844_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
AYR09979.1\|401991_402192_+	hypothetical protein	NA	NA	NA	NA
AYR07507.1\|402306_405201_-	glycine dehydrogenase (aminomethyl-transferring)	M4QFZ1	Prochlorococcus_phage	1.5e-277	53.0
AYR07508.1\|405237_405630_-	glycine cleavage system protein H	NA	NA	NA	NA
AYR07509.1\|405647_406763_-	aminomethyltransferase	NA	NA	NA	NA
AYR07510.1\|407502_408597_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07511.1\|408875_409358_-	ATPase	NA	NA	NA	NA
AYR07512.1\|409344_409674_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AYR09980.1\|411273_412245_+	glycerophosphodiester phosphodiesterase	A0A075KJS1	Lactobacillus_phage	4.0e-12	25.5
AYR09981.1\|412866_413889_-	WGR domain-containing protein	NA	NA	NA	NA
AYR07513.1\|414138_415653_-	hypothetical protein	NA	NA	NA	NA
AYR09982.1\|415674_416196_-	hypothetical protein	NA	NA	NA	NA
AYR07514.1\|416541_416961_-	hypothetical protein	NA	NA	NA	NA
AYR07515.1\|419083_419425_-	hypothetical protein	NA	NA	NA	NA
AYR07516.1\|419480_420131_-	hypothetical protein	NA	NA	NA	NA
AYR07517.1\|420553_421333_-	tetratricopeptide repeat protein	NA	NA	NA	NA
AYR07518.1\|421403_421751_-	hypothetical protein	NA	NA	NA	NA
AYR07519.1\|421847_423248_-	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
AYR07520.1\|423252_423537_-	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
AYR07521.1\|423614_424343_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	2.8e-34	39.4
AYR07522.1\|424360_424747_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AYR07523.1\|424827_425019_-	hypothetical protein	NA	NA	NA	NA
AYR07524.1\|425034_425217_-	hypothetical protein	NA	NA	NA	NA
AYR09983.1\|425273_426581_+	hypothetical protein	NA	NA	NA	NA
AYR07525.1\|426818_427052_-	hypothetical protein	NA	NA	NA	NA
AYR07526.1\|427415_429932_+	penicillin acylase family protein	NA	NA	NA	NA
AYR09984.1\|430089_430698_+	uracil-DNA glycosylase	A0A127AW33	Bacillus_phage	7.5e-17	30.4
AYR07527.1\|430666_431623_-	alpha/beta hydrolase	NA	NA	NA	NA
AYR07528.1\|431643_432717_-	alpha/beta fold hydrolase	NA	NA	NA	NA
AYR07529.1\|432773_433304_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AYR07530.1\|433395_434676_-	porin	NA	NA	NA	NA
AYR07531.1\|434752_434950_-	hypothetical protein	NA	NA	NA	NA
AYR07532.1\|435047_436760_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AYR07533.1\|436991_437579_-	hypothetical protein	NA	NA	NA	NA
AYR07534.1\|444132_445227_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07535.1\|445896_446574_-	flagellar assembly protein FlaA	NA	NA	NA	NA
AYR07536.1\|446661_447756_+	hypothetical protein	NA	NA	NA	NA
AYR09985.1\|447900_448884_-\|transposase	transposase	NA	NA	NA	NA
AYR07537.1\|449437_449653_-	hypothetical protein	NA	NA	NA	NA
AYR07538.1\|451475_452507_-\|transposase	transposase	NA	NA	NA	NA
AYR07539.1\|453908_455003_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

512686 : 563492

Heterosigma_akashiwo_virus(25.0%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR07602.1\|512686_513781_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07603.1\|514493_514676_-	hypothetical protein	NA	NA	NA	NA
AYR07604.1\|514982_516077_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07605.1\|516488_517001_-	polyketide cyclase	NA	NA	NA	NA
AYR07606.1\|517133_518093_-	polyprenyl synthetase family protein	NA	NA	NA	NA
AYR07607.1\|518161_519097_-	transglutaminase	NA	NA	NA	NA
AYR07608.1\|519475_520300_-	transketolase	NA	NA	NA	NA
AYR07609.1\|520352_520739_-	DUF420 domain-containing protein	NA	NA	NA	NA
AYR07610.1\|521273_522851_-	hypothetical protein	NA	NA	NA	NA
AYR07611.1\|522840_525579_-	carboxypeptidase	NA	NA	NA	NA
AYR07612.1\|525624_526557_-	hypothetical protein	NA	NA	NA	NA
AYR07613.1\|526567_527116_-	glutathione peroxidase	NA	NA	NA	NA
AYR07614.1\|527419_528514_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07615.1\|529051_529324_-	antitoxin	NA	NA	NA	NA
AYR07616.1\|529320_529599_-	toxin	NA	NA	NA	NA
AYR07617.1\|529926_530496_-	hypothetical protein	NA	NA	NA	NA
AYR07618.1\|530788_532036_-	crotonyl-CoA carboxylase/reductase	NA	NA	NA	NA
AYR07619.1\|532346_532583_+	hypothetical protein	NA	NA	NA	NA
AYR07620.1\|532786_533545_+	hypothetical protein	NA	NA	NA	NA
AYR07621.1\|534249_535125_-	J domain-containing protein	NA	NA	NA	NA
AYR07622.1\|535269_537195_+	carbon starvation protein A	NA	NA	NA	NA
AYR07623.1\|537191_537740_+	NUDIX domain-containing protein	NA	NA	NA	NA
AYR07624.1\|537805_539575_+	hypothetical protein	NA	NA	NA	NA
AYR07625.1\|539581_540334_+	NRDE domain protein	NA	NA	NA	NA
AYR07626.1\|540337_540718_+	PilZ domain-containing protein	NA	NA	NA	NA
AYR09989.1\|541530_542340_+	hypothetical protein	NA	NA	NA	NA
AYR07627.1\|542701_544732_+	DUF4178 domain-containing protein	NA	NA	NA	NA
AYR07628.1\|544706_544922_+	hypothetical protein	NA	NA	NA	NA
AYR07629.1\|545150_545345_+	hypothetical protein	NA	NA	NA	NA
AYR07630.1\|545352_546849_+	polyamine aminopropyltransferase	A0A1C9C533	Heterosigma_akashiwo_virus	1.5e-10	29.1
AYR09990.1\|548395_548770_+	hypothetical protein	NA	NA	NA	NA
AYR07631.1\|549094_550189_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07632.1\|550657_551128_-	EVE domain-containing protein	NA	NA	NA	NA
AYR07633.1\|551124_553083_-\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	4.2e-109	44.6
AYR07634.1\|553238_553802_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AYR07635.1\|553849_554488_-	50S ribosomal protein L25	NA	NA	NA	NA
AYR07636.1\|554503_555442_-	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	1.2e-48	34.3
AYR07637.1\|555438_556197_-	UDP-N-acetylglucosamine diphosphorylase	A0A1S5V090	Saudi_moumouvirus	2.4e-28	32.8
AYR07638.1\|556301_557195_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
AYR07639.1\|557549_558494_-	WYL domain-containing protein	NA	NA	NA	NA
AYR09991.1\|558741_560139_+	hypothetical protein	NA	NA	NA	NA
AYR09992.1\|560205_560628_+	hypothetical protein	NA	NA	NA	NA
AYR07640.1\|560639_560831_-	hypothetical protein	NA	NA	NA	NA
AYR07641.1\|562397_563492_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

964074 : 1020879

Bacillus_phage(25.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR07933.1\|964074_965217_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07934.1\|965256_966123_-	bile acid:sodium symporter family protein	NA	NA	NA	NA
AYR07935.1\|966196_966385_-	hypothetical protein	NA	NA	NA	NA
AYR07936.1\|966365_966788_+	hypothetical protein	NA	NA	NA	NA
AYR10022.1\|966850_967567_+	DUF374 domain-containing protein	NA	NA	NA	NA
AYR07937.1\|967877_969194_-	alpha/beta hydrolase	NA	NA	NA	NA
AYR07938.1\|969874_970327_-	response regulator	NA	NA	NA	NA
AYR10023.1\|970319_971717_-	histidine kinase	W8CYF6	Bacillus_phage	9.8e-12	25.7
AYR07939.1\|971748_971946_+	hypothetical protein	NA	NA	NA	NA
AYR07940.1\|972009_972873_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYR07941.1\|972959_973994_+	CapA family protein	NA	NA	NA	NA
AYR07942.1\|974399_975632_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AYR07943.1\|976570_976960_+	hypothetical protein	NA	NA	NA	NA
AYR07944.1\|977752_978280_+	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
AYR10024.1\|978936_981069_+	TonB-dependent receptor	NA	NA	NA	NA
AYR07945.1\|981070_982234_+	hypothetical protein	NA	NA	NA	NA
AYR07946.1\|982600_983260_+	hypothetical protein	NA	NA	NA	NA
AYR07947.1\|983432_983666_-	hypothetical protein	NA	NA	NA	NA
AYR07948.1\|983749_984844_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR07949.1\|986178_986925_-	sphingomyelinase C	NA	NA	NA	NA
AYR07950.1\|987886_989113_+	MFS transporter	A0A2H4UVM2	Bodo_saltans_virus	5.8e-08	21.1
AYR07951.1\|990621_990960_-	hypothetical protein	NA	NA	NA	NA
AYR07952.1\|991103_991316_+	hypothetical protein	NA	NA	NA	NA
AYR07953.1\|991312_992170_+	pirin family protein	NA	NA	NA	NA
AYR07954.1\|992271_993153_-	hypothetical protein	NA	NA	NA	NA
AYR07955.1\|993459_994731_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AYR07956.1\|995058_996879_+	translational GTPase TypA	NA	NA	NA	NA
AYR07957.1\|999495_1000431_-	hypothetical protein	NA	NA	NA	NA
AYR07958.1\|1002185_1002467_+	hypothetical protein	NA	NA	NA	NA
AYR07959.1\|1002583_1003228_-	hypothetical protein	NA	NA	NA	NA
AYR07960.1\|1003224_1003818_-	molecular chaperone DnaJ	NA	NA	NA	NA
AYR07961.1\|1003900_1005250_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AYR07962.1\|1005246_1007067_+	YjgP/YjgQ family permease	NA	NA	NA	NA
AYR07963.1\|1007096_1007936_+	hypothetical protein	NA	NA	NA	NA
AYR07964.1\|1008027_1008831_-	hypothetical protein	NA	NA	NA	NA
AYR07965.1\|1008972_1009416_+	methylglyoxal synthase	NA	NA	NA	NA
AYR07966.1\|1010426_1010963_+	hypothetical protein	NA	NA	NA	NA
AYR07967.1\|1012352_1012730_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
AYR07968.1\|1012719_1013022_-	hypothetical protein	NA	NA	NA	NA
AYR07969.1\|1013426_1013852_+	hypothetical protein	NA	NA	NA	NA
AYR07970.1\|1014897_1015440_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	S5VSW1	Leptospira_phage	6.2e-39	50.5
AYR07971.1\|1015386_1015578_-	hypothetical protein	NA	NA	NA	NA
AYR10025.1\|1016768_1017017_+	hypothetical protein	NA	NA	NA	NA
AYR07972.1\|1017023_1017197_+	universal stress protein	NA	NA	NA	NA
AYR07973.1\|1017199_1017763_-	AhpC/TSA family protein	NA	NA	NA	NA
AYR07974.1\|1017839_1018553_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.4e-41	43.2
AYR07975.1\|1019736_1020879_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1645504 : 1729000

Faustovirus(11.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR08484.1\|1645504_1646059_+\|transposase	IS630 family transposase	NA	NA	NA	NA
AYR08485.1\|1646251_1646593_+\|transposase	transposase	NA	NA	NA	NA
AYR08486.1\|1647178_1648489_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AYR08487.1\|1648597_1649908_+	O-antigen ligase domain-containing protein	NA	NA	NA	NA
AYR08488.1\|1650362_1651424_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
AYR08489.1\|1651420_1652023_-	DUF4254 domain-containing protein	NA	NA	NA	NA
AYR08490.1\|1652140_1653913_+	alpha/beta hydrolase	A0A141ZNL4	Faustovirus	1.6e-06	24.7
AYR08491.1\|1653895_1654534_-	phosphorylase	NA	NA	NA	NA
AYR08492.1\|1655202_1656303_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR08493.1\|1656299_1656554_-	hypothetical protein	NA	NA	NA	NA
AYR08494.1\|1657083_1657650_-	lipoprotein	NA	NA	NA	NA
AYR08495.1\|1658521_1660924_-	TonB-dependent receptor	NA	NA	NA	NA
AYR08496.1\|1661416_1661596_-	hypothetical protein	NA	NA	NA	NA
AYR08497.1\|1661804_1663883_+	DUF1563 domain-containing protein	NA	NA	NA	NA
AYR08498.1\|1664318_1665460_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	9.7e-42	36.4
AYR08499.1\|1666458_1666995_+	DUF1564 domain-containing protein	NA	NA	NA	NA
AYR08500.1\|1667647_1668643_+	hypothetical protein	NA	NA	NA	NA
AYR08501.1\|1668861_1669050_+	hypothetical protein	NA	NA	NA	NA
AYR08502.1\|1669161_1669407_+	hypothetical protein	NA	NA	NA	NA
AYR10067.1\|1669512_1669704_+	hypothetical protein	NA	NA	NA	NA
AYR08503.1\|1669961_1670732_+	DUF1176 domain-containing protein	NA	NA	NA	NA
AYR08504.1\|1675049_1675331_+	hypothetical protein	NA	NA	NA	NA
AYR08505.1\|1681220_1681757_-	peptide deformylase	A0A2I7S809	Vibrio_phage	1.6e-15	33.1
AYR08506.1\|1682616_1685427_+	GAF domain-containing protein	NA	NA	NA	NA
AYR08507.1\|1685410_1685740_+	anti-sigma factor antagonist	NA	NA	NA	NA
AYR08508.1\|1685831_1687484_+	acetyl-CoA carboxylase carboxyltransferase subunit	NA	NA	NA	NA
AYR08509.1\|1687489_1690237_+	biotin carboxylase	NA	NA	NA	NA
AYR08510.1\|1690375_1691422_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AYR08511.1\|1691916_1692429_-	purine-binding chemotaxis protein CheW	A0A248SKJ8	Salicola_phage	9.2e-08	29.7
AYR08512.1\|1692497_1695374_-	PAS domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.2e-09	67.9
AYR08513.1\|1697565_1697940_-	anti-sigma factor antagonist	NA	NA	NA	NA
AYR08514.1\|1697947_1698310_-	response regulator	W8CYM9	Bacillus_phage	5.5e-15	39.3
AYR08515.1\|1698325_1698577_-	ATP-binding protein	NA	NA	NA	NA
AYR08516.1\|1698634_1700980_-	response regulator	A0A1V0SGX0	Hokovirus	1.2e-25	23.5
AYR08517.1\|1701049_1701772_-	PAS domain S-box protein	NA	NA	NA	NA
AYR10068.1\|1702420_1703359_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
AYR08518.1\|1703534_1704806_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AYR08519.1\|1705199_1706048_+	flagellin	NA	NA	NA	NA
AYR08520.1\|1706222_1706528_+	hypothetical protein	NA	NA	NA	NA
AYR10069.1\|1708037_1709120_+	hypothetical protein	NA	NA	NA	NA
AYR10070.1\|1712574_1713426_-	flagellin	NA	NA	NA	NA
AYR08521.1\|1713754_1714306_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
AYR08522.1\|1714281_1715586_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.6e-64	31.8
AYR08523.1\|1715634_1716906_+	NlpC/P60 family protein	NA	NA	NA	NA
AYR08524.1\|1722513_1722711_+	hypothetical protein	NA	NA	NA	NA
AYR08525.1\|1723295_1726886_-	vitamin B12-dependent ribonucleotide reductase	A0A1X9SGV9	Bradyrhizobium_phage	0.0e+00	54.2
AYR08526.1\|1727290_1727473_-	hypothetical protein	NA	NA	NA	NA
AYR08527.1\|1727905_1729000_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

2230440 : 2292314

Wolbachia_phage(40.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR08906.1\|2230440_2231238_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AYR08907.1\|2231240_2232062_+	hypothetical protein	NA	NA	NA	NA
AYR10112.1\|2232106_2233351_+	hypothetical protein	NA	NA	NA	NA
AYR08908.1\|2233471_2233897_-	hypothetical protein	NA	NA	NA	NA
AYR08909.1\|2233960_2234284_+	hypothetical protein	NA	NA	NA	NA
AYR08910.1\|2234443_2235325_-	nitronate monooxygenase	NA	NA	NA	NA
AYR10113.1\|2235566_2236637_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR08911.1\|2236913_2237333_+	transcriptional regulator	NA	NA	NA	NA
AYR08912.1\|2237413_2237815_-	DUF1801 domain-containing protein	NA	NA	NA	NA
AYR08913.1\|2238128_2239400_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AYR08914.1\|2239699_2240230_-	mepB protein	A0A2H4UW84	Bodo_saltans_virus	1.5e-21	42.7
AYR08915.1\|2240329_2241478_-	DUF445 family protein	NA	NA	NA	NA
AYR08916.1\|2241477_2243823_-	hypothetical protein	NA	NA	NA	NA
AYR08917.1\|2244113_2244389_+	hypothetical protein	NA	NA	NA	NA
AYR10114.1\|2244286_2244547_-	hypothetical protein	NA	NA	NA	NA
AYR08918.1\|2245424_2247257_+	hypothetical protein	NA	NA	NA	NA
AYR08919.1\|2247284_2248289_+	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
AYR08920.1\|2249336_2250437_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR10115.1\|2250905_2251286_+	hypothetical protein	NA	NA	NA	NA
AYR08921.1\|2252018_2252429_-	6-carboxytetrahydropterin synthase	NA	NA	NA	NA
AYR08922.1\|2252583_2252811_+	DUF1858 domain-containing protein	NA	NA	NA	NA
AYR08923.1\|2252791_2252971_+	hypothetical protein	NA	NA	NA	NA
AYR08924.1\|2252976_2253735_+	hypothetical protein	NA	NA	NA	NA
AYR10116.1\|2253792_2254602_-	hypothetical protein	NA	NA	NA	NA
AYR08925.1\|2254862_2256368_-	rod shape-determining protein RodA	NA	NA	NA	NA
AYR08926.1\|2256354_2258301_-	penicillin-binding protein 2	NA	NA	NA	NA
AYR08927.1\|2258302_2258815_-	rod shape-determining protein MreD	NA	NA	NA	NA
AYR08928.1\|2258811_2259921_-	rod shape-determining protein MreC	NA	NA	NA	NA
AYR08929.1\|2259992_2261015_-	rod shape-determining protein	NA	NA	NA	NA
AYR08930.1\|2261205_2262774_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
AYR08931.1\|2264719_2264914_-	hypothetical protein	NA	NA	NA	NA
AYR08932.1\|2264932_2265640_+	DNA alkylation repair protein	NA	NA	NA	NA
AYR08933.1\|2266468_2267635_-	hypothetical protein	NA	NA	NA	NA
AYR08934.1\|2267953_2269375_-	MBOAT family protein	A0A125RNP0	Pseudomonas_phage	2.7e-49	35.7
AYR08935.1\|2269384_2271616_-	GAF domain-containing protein	NA	NA	NA	NA
AYR10117.1\|2271619_2274493_-	hypothetical protein	NA	NA	NA	NA
AYR08936.1\|2274526_2274808_-	hypothetical protein	NA	NA	NA	NA
AYR08937.1\|2274890_2275274_-	ATP synthase F1 subunit epsilon	NA	NA	NA	NA
AYR08938.1\|2275278_2276682_-	ATP synthase subunit beta	NA	NA	NA	NA
AYR08939.1\|2276707_2277568_-	ATP synthase F1 subunit gamma	NA	NA	NA	NA
AYR08940.1\|2277582_2279094_-	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AYR08941.1\|2279083_2279644_-	ATP synthase subunit delta	NA	NA	NA	NA
AYR08942.1\|2279648_2280170_-	ATP synthase subunit B	NA	NA	NA	NA
AYR08943.1\|2280173_2280476_-	F0F1 ATP synthase subunit C	NA	NA	NA	NA
AYR08944.1\|2280517_2281627_-	ATP synthase F0 subunit A	NA	NA	NA	NA
AYR08945.1\|2281731_2282061_-	hypothetical protein	NA	NA	NA	NA
AYR10118.1\|2283363_2283681_-	hypothetical protein	NA	NA	NA	NA
AYR08946.1\|2283877_2284084_-	hypothetical protein	NA	NA	NA	NA
AYR08947.1\|2284114_2284423_-	AtpZ/AtpI family protein	NA	NA	NA	NA
AYR08948.1\|2284451_2285453_-	signal peptidase I	NA	NA	NA	NA
AYR10119.1\|2285540_2286344_+	aldolase	NA	NA	NA	NA
AYR08949.1\|2286346_2286898_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYR08950.1\|2288747_2289842_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR08951.1\|2290195_2290531_-	hypothetical protein	A0A0M5M147	Mycobacterium_phage	3.2e-09	39.8
AYR08952.1\|2290707_2290926_-\|transposase	transposase	NA	NA	NA	NA
AYR08953.1\|2290918_2291608_+	hypothetical protein	Q9JMP3	Wolbachia_phage	1.4e-19	36.1
AYR08954.1\|2291633_2292314_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.7e-31	36.4

DBSCAN-SWA_7

2548770 : 2623178

uncultured_Mediterranean_phage(18.18%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR09145.1\|2548770_2549865_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09146.1\|2550208_2550499_+	hypothetical protein	NA	NA	NA	NA
AYR09147.1\|2550555_2550879_+	alpha/beta hydrolase	NA	NA	NA	NA
AYR09148.1\|2551231_2552596_-	DUF4263 domain-containing protein	NA	NA	NA	NA
AYR09149.1\|2552864_2553080_-	hypothetical protein	NA	NA	NA	NA
AYR09150.1\|2553104_2553716_-	hypothetical protein	NA	NA	NA	NA
AYR09151.1\|2554223_2554619_-	PIN domain-containing protein	NA	NA	NA	NA
AYR09152.1\|2554615_2554831_-	DUF2191 domain-containing protein	NA	NA	NA	NA
AYR09153.1\|2556805_2557396_-	hypothetical protein	NA	NA	NA	NA
AYR09154.1\|2559370_2560318_-	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	2.0e-24	32.1
AYR09155.1\|2561966_2562662_+	acireductone synthase	NA	NA	NA	NA
AYR09156.1\|2563079_2563271_-	hypothetical protein	NA	NA	NA	NA
AYR09157.1\|2563397_2564609_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AYR09158.1\|2564709_2565996_-	DUF1577 domain-containing protein	NA	NA	NA	NA
AYR09159.1\|2566521_2567049_+	hypothetical protein	NA	NA	NA	NA
AYR09160.1\|2567048_2567849_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AYR10136.1\|2567843_2569013_-	glycosyl hydrolase	NA	NA	NA	NA
AYR09161.1\|2569430_2570384_+	histone deacetylase	A0A2K9L0I3	Tupanvirus	9.3e-46	39.8
AYR09162.1\|2571018_2571468_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AYR09163.1\|2571642_2571930_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
AYR09164.1\|2571985_2572927_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AYR09165.1\|2573478_2574573_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09166.1\|2575701_2576805_+	histidinol-phosphate transaminase	A0A0H3TLT9	Faustovirus	5.9e-20	28.3
AYR09167.1\|2576820_2577084_+	hypothetical protein	NA	NA	NA	NA
AYR09168.1\|2577333_2578428_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09169.1\|2579122_2580394_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	2.1e-69	39.2
AYR09170.1\|2580390_2580627_-	hypothetical protein	NA	NA	NA	NA
AYR09171.1\|2580969_2581569_+	leucine-rich repeat domain-containing protein	NA	NA	NA	NA
AYR09172.1\|2581632_2582253_-	DedA family protein	NA	NA	NA	NA
AYR09173.1\|2582221_2584012_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	2.9e-72	32.1
AYR09174.1\|2584010_2584214_+	hypothetical protein	NA	NA	NA	NA
AYR09175.1\|2584440_2585148_+	DUF1554 domain-containing protein	NA	NA	NA	NA
AYR09176.1\|2586089_2589023_+	transporter	NA	NA	NA	NA
AYR09177.1\|2590523_2591510_-	adenosine kinase	NA	NA	NA	NA
AYR09178.1\|2591514_2592417_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AYR09179.1\|2592425_2593184_-\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
AYR09180.1\|2593180_2594863_-	energy transducer TonB	NA	NA	NA	NA
AYR09181.1\|2594976_2596371_+\|tRNA	glycine--tRNA ligase	A0A2I2L3K8	Orpheovirus	1.1e-50	30.8
AYR09182.1\|2596662_2597100_+	dUTP diphosphatase	K4JSC8	Caulobacter_phage	5.4e-25	44.4
AYR09183.1\|2599457_2600552_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09184.1\|2602469_2602964_-	ATPase	NA	NA	NA	NA
AYR09185.1\|2603015_2603354_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AYR09186.1\|2603451_2604258_-	fatty acid hydroxylase family protein	NA	NA	NA	NA
AYR09187.1\|2604554_2605334_-	hypothetical protein	NA	NA	NA	NA
AYR09188.1\|2605334_2606636_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	2.9e-18	31.5
AYR09189.1\|2606574_2606754_-	hypothetical protein	NA	NA	NA	NA
AYR09190.1\|2607380_2608448_-	hypothetical protein	NA	NA	NA	NA
AYR09191.1\|2608458_2610261_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AYR09192.1\|2610274_2612299_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A1B1IUF0	uncultured_Mediterranean_phage	1.7e-09	35.0
AYR09193.1\|2612304_2613219_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
AYR09194.1\|2613425_2613617_-	hypothetical protein	NA	NA	NA	NA
AYR09195.1\|2613546_2613777_-	hypothetical protein	NA	NA	NA	NA
AYR10137.1\|2614163_2615816_-	lipoprotein LipL71	NA	NA	NA	NA
AYR09196.1\|2615863_2616199_-	anti-sigma factor antagonist	NA	NA	NA	NA
AYR09197.1\|2616268_2617393_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.3e-78	42.5
AYR09198.1\|2617389_2617872_-	transcriptional repressor	NA	NA	NA	NA
AYR09199.1\|2617902_2618463_-	hypothetical protein	NA	NA	NA	NA
AYR09200.1\|2618480_2620319_+	M23 family metallopeptidase	NA	NA	NA	NA
AYR09201.1\|2620571_2621315_-	hypothetical protein	NA	NA	NA	NA
AYR09202.1\|2622029_2623178_+\|transposase	transposase	S5VTD8	Leptospira_phage	6.8e-51	40.9

DBSCAN-SWA_8

3129834 : 3172333

Shigella_phage(33.33%)

transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR09583.1\|3129834_3130929_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09584.1\|3132735_3133437_-	methyltransferase domain-containing protein	NA	NA	NA	NA
AYR09585.1\|3133463_3134453_-	hypothetical protein	NA	NA	NA	NA
AYR09586.1\|3135155_3136250_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09587.1\|3137143_3138160_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
AYR09588.1\|3138695_3139604_+	DMT family transporter	NA	NA	NA	NA
AYR09589.1\|3140556_3141393_+	DUF4303 domain-containing protein	NA	NA	NA	NA
AYR09590.1\|3141791_3142013_-	hypothetical protein	NA	NA	NA	NA
AYR09591.1\|3142097_3142289_-	hypothetical protein	NA	NA	NA	NA
AYR10177.1\|3142848_3143460_+	hypothetical protein	NA	NA	NA	NA
AYR09592.1\|3147907_3148195_-	hypothetical protein	NA	NA	NA	NA
AYR09593.1\|3148261_3148810_-	YqgE/AlgH family protein	NA	NA	NA	NA
AYR09594.1\|3148833_3149802_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AYR09595.1\|3150101_3151217_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	3.3e-26	35.7
AYR09596.1\|3151664_3153602_-	molecular chaperone DnaK	A0A2P1ELQ7	Moumouvirus	9.7e-143	47.2
AYR09597.1\|3153636_3154290_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AYR09598.1\|3154303_3155332_-	HrcA family transcriptional regulator	NA	NA	NA	NA
AYR09599.1\|3155930_3156140_+	hypothetical protein	NA	NA	NA	NA
AYR09600.1\|3156494_3158303_+	PASTA domain-containing protein	NA	NA	NA	NA
AYR09601.1\|3160540_3161632_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR09602.1\|3162167_3162485_+	hypothetical protein	NA	NA	NA	NA
AYR09603.1\|3162536_3163677_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.3e-41	36.0
AYR09604.1\|3164342_3165484_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.7e-41	36.0
AYR09605.1\|3166120_3166504_+	chemotaxis protein	NA	NA	NA	NA
AYR10178.1\|3166656_3167445_+	glycerophosphodiester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	7.5e-17	25.9
AYR09606.1\|3167626_3168058_-	SET domain-containing protein	A0A2H4UVV9	Bodo_saltans_virus	2.6e-08	30.6
AYR09607.1\|3168687_3169176_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
AYR09608.1\|3169423_3169711_+	acylphosphatase	NA	NA	NA	NA
AYR09609.1\|3169800_3170520_-	TrkA family potassium uptake protein	NA	NA	NA	NA
AYR09610.1\|3170533_3172333_-\|portal	portal protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033441

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

59304 : 142882

uncultured_Caudovirales_phage(14.29%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYR10247.1\|59304_59580_+\|transposase	transposase	NA	NA	NA	NA
AYR10248.1\|59576_59912_+	hypothetical protein	NA	NA	NA	NA
AYR10249.1\|63813_64818_+	patatin-like phospholipase family protein	NA	NA	NA	NA
AYR10250.1\|65224_66781_+	FAD-binding protein	NA	NA	NA	NA
AYR10251.1\|66924_67164_-	hypothetical protein	NA	NA	NA	NA
AYR10252.1\|72274_73021_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYR10253.1\|73065_74550_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
AYR10254.1\|74623_75187_-	tetratricopeptide repeat protein	NA	NA	NA	NA
AYR10255.1\|75209_75725_-	hypothetical protein	NA	NA	NA	NA
AYR10256.1\|76630_77437_+	TIGR01458 family HAD-type hydrolase	NA	NA	NA	NA
AYR10257.1\|77703_77883_+	hypothetical protein	NA	NA	NA	NA
AYR10258.1\|77919_78363_+	DUF1564 family protein	NA	NA	NA	NA
AYR10259.1\|78424_79402_+	methyltransferase domain-containing protein	A0A2H4J145	uncultured_Caudovirales_phage	6.7e-07	46.0
AYR10260.1\|79404_80715_+	adenosylhomocysteinase	S4W1G4	Pandoravirus	4.1e-52	32.1
AYR10261.1\|80790_81090_+	ferredoxin	NA	NA	NA	NA
AYR10262.1\|81136_84880_+	methionine synthase	A0A140XBC7	Dickeya_phage	2.7e-16	65.6
AYR10263.1\|84929_85259_+	hypothetical protein	NA	NA	NA	NA
AYR10264.1\|85588_86509_-	hypothetical protein	NA	NA	NA	NA
AYR10265.1\|86621_87956_+	ATP-dependent 6-phosphofructokinase	NA	NA	NA	NA
AYR10266.1\|88070_89819_-	GAF domain-containing protein	NA	NA	NA	NA
AYR10267.1\|89982_90858_-	acetylglutamate kinase	NA	NA	NA	NA
AYR10268.1\|90937_91693_+	SDR family oxidoreductase	NA	NA	NA	NA
AYR10269.1\|91822_93544_-	M61 family peptidase	NA	NA	NA	NA
AYR10270.1\|93544_94024_-	peroxiredoxin	NA	NA	NA	NA
AYR10271.1\|94946_95315_+	hypothetical protein	NA	NA	NA	NA
AYR10272.1\|95381_96482_+	hypothetical protein	NA	NA	NA	NA
AYR10273.1\|98028_99123_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR10274.1\|100259_101156_-	recombinase XerD	A0A1C8E994	Bacillus_phage	6.7e-06	26.6
AYR10275.1\|101271_101811_-	shikimate kinase	NA	NA	NA	NA
AYR10276.1\|101807_102659_-	HDOD domain-containing protein	NA	NA	NA	NA
AYR10277.1\|102665_103172_-	chemotaxis protein CheD	NA	NA	NA	NA
AYR10445.1\|103346_104573_+	TraB/GumN family protein	NA	NA	NA	NA
AYR10278.1\|104569_106696_+	PAS domain-containing protein	NA	NA	NA	NA
AYR10279.1\|106696_107266_+	penicillin-binding protein activator LpoB	NA	NA	NA	NA
AYR10280.1\|107353_108331_-	alpha/beta hydrolase	NA	NA	NA	NA
AYR10281.1\|108382_108790_+	hypothetical protein	NA	NA	NA	NA
AYR10282.1\|108777_110196_+	UTP--glucose-1-phosphate uridylyltransferase	A0A1V0SLA1	Klosneuvirus	2.2e-59	41.7
AYR10283.1\|110284_111640_+	EAL domain-containing protein	NA	NA	NA	NA
AYR10284.1\|112129_114532_-\|protease	cysteine protease	NA	NA	NA	NA
AYR10285.1\|115175_115814_-	energy transducer TonB	NA	NA	NA	NA
AYR10286.1\|115832_116237_-	biopolymer transporter ExbD	NA	NA	NA	NA
AYR10287.1\|116259_116874_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AYR10288.1\|116970_117462_-	hypothetical protein	NA	NA	NA	NA
AYR10289.1\|117461_120065_-	TonB-dependent receptor	NA	NA	NA	NA
AYR10290.1\|120075_120483_-	hypothetical protein	NA	NA	NA	NA
AYR10291.1\|120484_121018_-	hypothetical protein	NA	NA	NA	NA
AYR10292.1\|120989_121367_-	hypothetical protein	NA	NA	NA	NA
AYR10293.1\|121922_122975_-	methylmalonyl Co-A mutase-associated GTPase MeaB	NA	NA	NA	NA
AYR10294.1\|122982_125181_-	methylmalonyl-CoA mutase	NA	NA	NA	NA
AYR10295.1\|125177_127058_-	methylmalonyl-CoA mutase	NA	NA	NA	NA
AYR10296.1\|127148_128138_-	TerC family protein	K7QKE8	Escherichia_phage	1.1e-36	35.5
AYR10297.1\|128226_128856_+	lysoplasmalogenase	NA	NA	NA	NA
AYR10298.1\|128914_129814_+	rubrerythrin	NA	NA	NA	NA
AYR10299.1\|129813_130971_+	aminotransferase class V-fold PLP-dependent enzyme	A0A2K9L2Y3	Tupanvirus	1.1e-24	26.1
AYR10300.1\|133787_134888_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AYR10301.1\|136397_137789_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
AYR10302.1\|137771_139871_-	hypothetical protein	NA	NA	NA	NA
AYR10303.1\|139978_140437_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
AYR10304.1\|140454_140619_-	50S ribosomal protein L33	NA	NA	NA	NA
AYR10305.1\|141787_142882_+\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033440

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033441

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection