CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP033607	Lactococcus lactis strain IL1403 chromosome	2 crisprs	cas3,DEDDh,csa3,DinG	0	1	14	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033607_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033607_1

1384669-1384847

Orphan

Consensus_repeat	Method
GATAAAATGCTCATGTTAATCGCATTACTGACAGAAAGTTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033607_1

>merge|CP033607|1|1384669-1384847|CRISPRCasFinder
GATAAAATGCTCATGTTAATCGCATTACTGACAGAAAGTTCAGATTGCTGAACCTTCTTTTATTCATCGATAAAATGCTCATGTTAATCGCATTGCTGACAGAAAGTTCAGCTTGCTGAACCTTCTTTTATTCATCGATAAAATGCTCATGTTAATCGCATTGCTGACAGAAAGTTCAG

>CP033607|1|1|1384669-1384847|CRISPRCasFinder
GATAAAATGCTCATGTTAATCGCATTACTGACAGAAAGTTCAG	ATTGCTGAACCTTCTTTTATTCATCGATAAAATGCTCATGTTAATCGCATTGCTGACAGAAAGTTCAGCTTGCTGAACCTTCTTTTATTCATC
GATAAAATGCTCATGTTAATCGCATTGCTGACAGAAAGTTCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP033607.1\|AYV53076.1\|1391080_1391407_-\|DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|371730
CP033607.1\|AYV53070.1\|1383819_1384608_-\|dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|99814
CP033607.1\|AYV53069.1\|1381948_1382662_-\|orotidine-5'-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|234695
CP033607.1\|AYV53066.1\|1379793_1380753_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
CP033607.1\|AYV53064.1\|1378868_1379276_+\|transporter	unknown	unknown	gnl\|CDD\|227646
CP033607.1\|AYV53072.1\|1386883_1388095_+\|virion-core-protein	unknown	unknown	gnl\|CDD\|226711
CP033607.1\|AYV53073.1\|1388254_1389394_+\|TFIIB-type-zinc-ribbon-containing-protein	unknown	unknown	gnl\|CDD\|369254
CP033607.1\|AYV54018.1\|1382811_1383747_-\|dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|235982
CP033607.1\|AYV53077.1\|1391375_1392245_-\|DUF916-and-DUF3324-domain-containing-protein	unknown	unknown	gnl\|CDD\|368712
CP033607.1\|AYV53074.1\|1389390_1390176_+\|YgcG-family-protein	unknown	unknown	gnl\|CDD\|224429
CP033607.1\|AYV53071.1\|1385142_1386507_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
CP033607.1\|AYV53062.1\|1376787_1377813_+\|glycerol-3-phosphate-dehydrogenase-(NAD(P)(+))	unknown	unknown	gnl\|CDD\|234629
CP033607.1\|AYV53068.1\|1381695_1381947_-\|hypothetical-protein	unknown	unknown	unknown
CP033607.1\|AYV53080.1\|1393500_1394505_-\|DUF916-domain-containing-protein	unknown	unknown	gnl\|CDD\|368712
CP033607.1\|AYV53067.1\|1380749_1381466_+\|ribosomal-RNA-small-subunit-methyltransferase-G	unknown	unknown	gnl\|CDD\|223434
CP033607.1\|AYV53065.1\|1379272_1379803_+\|heptaprenyl-diphosphate-synthase	unknown	unknown	gnl\|CDD\|227110
CP033607.1\|AYV53075.1\|1390205_1390763_-\|rRNA-large-subunit-pseudouridine-synthase-E	unknown	unknown	gnl\|CDD\|211334
CP033607.1\|AYV53079.1\|1393109_1393454_-\|hypothetical-protein	unknown	unknown	unknown
CP033607.1\|AYV53063.1\|1377856_1378798_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
CP033607.1\|AYV53078.1\|1392322_1393135_-\|WxL-domain-containing-protein	unknown	unknown	gnl\|CDD\|372694

Protein	Function_ID	Function_description	E-value
CP033607.1\|AYV53076.1\|1391080_1391407_-\|DUF3324-domain-containing-protein	gnl\|CDD\|371730	pfam11797, DUF3324, Protein of unknown function C-terminal (DUF3324). This family consists of several hypothetical bacterial proteins of unknown function.	6.48052e-05
CP033607.1\|AYV53070.1\|1383819_1384608_-\|dihydroorotate-dehydrogenase	gnl\|CDD\|99814	cd06218, DHOD_e_trans, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.	1.45438e-109
CP033607.1\|AYV53069.1\|1381948_1382662_-\|orotidine-5'-phosphate-decarboxylase	gnl\|CDD\|234695	PRK00230, PRK00230, orotidine-5'-phosphate decarboxylase.	3.7665e-134
CP033607.1\|AYV53066.1\|1379793_1380753_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	9.30264e-84
CP033607.1\|AYV53064.1\|1378868_1379276_+\|transporter	gnl\|CDD\|227646	COG5341, COG5341, Uncharacterized protein conserved in bacteria [Function unknown].	1.24753e-52
CP033607.1\|AYV53072.1\|1386883_1388095_+\|virion-core-protein	gnl\|CDD\|226711	COG4260, COG4260, Membrane protease subunit, stomatin/prohibitin family [Amino acid transport and metabolism].	4.46487e-169
CP033607.1\|AYV53073.1\|1388254_1389394_+\|TFIIB-type-zinc-ribbon-containing-protein	gnl\|CDD\|369254	pfam07191, zinc-ribbons_6, zinc-ribbons. This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family have 8 highly conserved cysteine residues, which form two zinc ribbon domains.	0.000852226
CP033607.1\|AYV54018.1\|1382811_1383747_-\|dihydroorotate-dehydrogenase	gnl\|CDD\|235982	PRK07259, PRK07259, dihydroorotate dehydrogenase.	0
CP033607.1\|AYV53077.1\|1391375_1392245_-\|DUF916-and-DUF3324-domain-containing-protein	gnl\|CDD\|368712	pfam06030, DUF916, Bacterial protein of unknown function (DUF916). This family consists of several hypothetical bacterial proteins of unknown function.	1.73883e-42
CP033607.1\|AYV53074.1\|1389390_1390176_+\|YgcG-family-protein	gnl\|CDD\|224429	COG1512, COG1512, Beta-propeller domains of methanol dehydrogenase type [General function prediction only].	1.58524e-71
CP033607.1\|AYV53071.1\|1385142_1386507_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	4.89894e-53
CP033607.1\|AYV53062.1\|1376787_1377813_+\|glycerol-3-phosphate-dehydrogenase-(NAD(P)(+))	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	1.94654e-180
CP033607.1\|AYV53063.1\|1377856_1378798_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	1.35337e-172
CP033607.1\|AYV53080.1\|1393500_1394505_-\|DUF916-domain-containing-protein	gnl\|CDD\|368712	pfam06030, DUF916, Bacterial protein of unknown function (DUF916). This family consists of several hypothetical bacterial proteins of unknown function.	7.0595e-28
CP033607.1\|AYV53067.1\|1380749_1381466_+\|ribosomal-RNA-small-subunit-methyltransferase-G	gnl\|CDD\|223434	COG0357, GidB, Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane].	2.20408e-85
CP033607.1\|AYV53065.1\|1379272_1379803_+\|heptaprenyl-diphosphate-synthase	gnl\|CDD\|227110	COG4769, COG4769, Predicted membrane protein [Function unknown].	1.74231e-64
CP033607.1\|AYV53075.1\|1390205_1390763_-\|rRNA-large-subunit-pseudouridine-synthase-E	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	1.86593e-99
CP033607.1\|AYV53078.1\|1392322_1393135_-\|WxL-domain-containing-protein	gnl\|CDD\|372694	pfam13731, WxL, WxL domain surface cell wall-binding. The WxL motif appears in two or three copies in these bacterial proteins and confers a cell surface localization function. It seems likely that this region is the cell wall-binding domain of gram-positive bacteria, and may interact with the peptidoglycan.	1.15853e-29

>CP033607.1|AYV53070.1|1383819_1384608_-|dihydroorotate-dehydrogenase
MPKLQEMMTIVSQREVASNIFEMVLKGELVEEMDLPGQFLHLAVPNASMLLRRPISISSWDKVAKTCTILYRIGDETSGTYEISKLQSGAKIDVMGPLGNGFPVDEVVSTDKILIVGGGIGVPPLYELAKQLEEKNCQMTILLGFASEKVKILEKEFAELKNVSLKIATDDGSYGTKGHVGMLMEEIDFEVDALYTCGAPAMLKAVAKKYEQLERLYISMESRMACGIGACYACVEHDKEDENHALKVCEDGPVFLGKQLLL
>CP033607.1|AYV54018.1|1382811_1383747_-|dihydroorotate-dehydrogenase
MTENNRLSVKLPGLDLKNPIIPASGCFGFGEEYAKYYDLNKLGSIMVKATTLHPRFGNPTPRVAETASGMLNAIGLQNPGLEVIMAEKLPWLNENFPDLPIIANVAGSEEDDYVAVCAKIGDAPNVKVIELNISCPNVKHGGQAFGTDPDVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKAVEAAGADGLTMINTLMGVRFDLKTRKPVLANITGGLSGPAIKPVALKLIHQVAQVVDIPIIGMGGVESAQDVLEMYMAGASAVAVGTANFADPFVCPKIIEKLPEVMDQYGIDSLENLIQEVKNSKK
>CP033607.1|AYV53069.1|1381948_1382662_-|orotidine-5'-phosphate-decarboxylase
MQENRPVIALDFPEFSDVKDFLEKFDPSEQLYIKLGMELFYTAGPQVVYYVKSLGHSVFLDLKLHDIPNTVESSMHVLARLGVDMVNVHAAGGVEMMVAAKRGLEAGTPVGRQRPKLIAVTQLTSTSEEIMQNDQKIMTSLEESVINYAQKTAQAGLDGVVCSAHEVEKIKAATSKEFICLTPGIRPEGASKGDQKRVMTPKEARTIGSDYIVVGRPITQAKDPVASYHAIKAEWNR
>CP033607.1|AYV53068.1|1381695_1381947_-|hypothetical-protein
MKKLLHFLVVLLGIFVAFILARLFIEIYTIVGDVYLQVDNKTITLYKVLAEIDYLSVGITFAMVFAYMAPIRLNCCRRRKIMV
>CP033607.1|AYV53067.1|1380749_1381466_+|ribosomal-RNA-small-subunit-methyltransferase-G
MTPDEFLSALTEFDIQLSDKQIKQFERYFELLVEWNEKINLTAITEKNEVYLKHFYDSIAPILYGLITDQPVSILDIGAGAGFPSLPMKIIFPELKVTIIDSLNKRINFLSLLTEELGLENVTLLHGRAEDFGQDANYRGTFDFVTARAVARLSVLTEFTIPFLKKNGILLSLKAAQFEEELNDAKKAIATLGGKFIKEVAYELPNGDERHIALIEKKKETPKKYPRKAGTPAKNPIK
>CP033607.1|AYV53066.1|1379793_1380753_+|polyprenyl-synthetase-family-protein
MDLKNNFWKDYPELEKELVQVQQLMKSHVTIKNSDVKSAIFDIFDAGGKMLRPAYLLLFSGFTDLSESERLALAASVEMMHTATLVHDDVIDHADTRRGVATLSAKYGPEIAVYAGDYLFIAVFRLMSEHSLELSNLTKNIGSIERLLGGELGQLNHHFNLQQTLDDYIENISGKTGELFALSASVAPLISKNNTLTKRAYKIGMNIGISFQIMDDYLDYASTAQTLGKPVLEDIKQGIYSAPVLFALQENNALVSELIKNEKFDEVYDFIKTSDALEKTKALAKSYTLSALNLIDKLPKGKNRELIAEITRKLLERTL
>CP033607.1|AYV53065.1|1379272_1379803_+|heptaprenyl-diphosphate-synthase
MNIKEYVYVSLLTAAAVVMGIIESSLPPFFAFAPGAKVGLANLVMIIAVFTLRWRQVWVMQILRLLITALFTGFSVFLYSFAGGILSLLAMYLMKQFGPKLVSMIGISTVGGFFHNFGQLAMASLLAKTTSVMLYLPWLAFFGILAGFAIGIAGNQLITRVKPIQELFIKESKQWT
>CP033607.1|AYV53064.1|1378868_1379276_+|transporter
MNFFKNTVNFFKSIKTKPLDFVIIFLLFIASFSTLFFFATGSKGAQAELRISGKVIKTFNLNKNQTWTYRDKDGDYNKIQVKNGEIAVVEANCKDQIDVQRGYISKTGETIVCLPHNLVIEVMSGQKDEQVDYKV
>CP033607.1|AYV53063.1|1377856_1378798_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MKQNIIPTKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIEDILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGHAVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHDDVDKYGVIDPNGEVSKGLYNVERFVEKPNVDEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEIQLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGANLKNYIIEKAKELSKDDSKNITKK
>CP033607.1|AYV53062.1|1376787_1377813_+|glycerol-3-phosphate-dehydrogenase-(NAD(P)(+))
MNPQKIAVLGPGSWGTALSQVLNDNGHEVRIWGNNPEQMAEINEKHTNTRYFKDVVLDEKIKAFDRLDLALEDVDAILFVVPTKVTRLVAKQVAEVLKHKVHILHASKGLEQGTHERISTILEEEIPAQLRGEIVVVSGPSHAEETIVRDITLISAASKDHDEAKYAQAIFSNDYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGFGDNAKAAIITRGLAEITRLGVAMGAEPLTYSGLSGVGDLIVTGTSIHSRNWRAGDALGRGEKLADIEKNMGMVIEGVSTTKAAFELAQQLGIDMPITETIYKVLYENLDAKTGILDIMRRETRAENEFINNK
>CP033607.1|AYV53071.1|1385142_1386507_-|MFS-transporter
MNKNNHFHLLGAVIATGILSFSGVLIETAMNVTFPTLINEFGLSTSKIQWVTTIYLLVIAITIPLSSYFNERFSARKLFLVANLIFLVGVLTNCFSPNFAMLLFGRLLQGVGTGIGLPLMFHLILTKAPLHKRGMMMGIGTLTTSIAPAIGPTYGGIISNSLDWRYIYIFLLPLVVISLVLGLACLPREGEKTPKKLALRPVIALSIMFFAFISALSAEHLMTFALLFIVGLVGAFLFVQFNRKESLIDLGILKNHRFVALIFSLLVYQALLLGLSFVLPSFIQVSAGFSSSVAGLFMFSGALIGAVLAPISGKVLDQIGARKPITTGLILAALGLALIFVFLPTKSLALLLGAHIVLMLGLGISYSNLMTCSLSTLATDQLSDGNALVNTLQQFIGAVATAVVATTLSIFQGLNGFKVGTSHGTSIILALFFILIIVSLIVSFPNLKKIRANH
>CP033607.1|AYV53072.1|1386883_1388095_+|virion-core-protein
MGIIKAATGSLGGALADQWLEVIEPNEMSDQTVFTKGIKVRKDAKRGSNRKGTEDVITDGSIVHVYENMMMILVDGGKIIDYTAEPGYYTVKNDTAPSLFNGDLRDSIQESFFRFKFGGTTPQKQEVYYVNLQEIKGIKFGTATPLQYFDNFYNAELFLRTHGTYSIKITDPLAFYANVIPKNADHVEIQEINDQYLAEFLTALNTSINQYSAQGERVSFLTSKSMELSKYMASVLDEDWKQLRGMEIVSVAVASISYTDDSQKLINMRNQGAMLGDPSIREGFVQGAVARGLEAAGSNTGGATNAFMGMNMGGQNLAGFSQTNQAQMQAQAENKADTWTCPECNTKNTGKFCSNCGQAKPSATPVMPELNMACNECGAVVNLANGVPKFCPECGKPFVAKAL
>CP033607.1|AYV53073.1|1388254_1389394_+|TFIIB-type-zinc-ribbon-containing-protein
MSESQVLTHKCPNCGGPLLFEPKNQKFHCEYCGSTFTEQEVSDFEAKQEAAKVTDSPISSVSNAETTDEKEKITDSDQKRADENTDEEIGLFLCPSCGAEIVTDATTASTWCYYCHNPVVLTERLSGKFLPEKILPFQIERKAAEEQFLDWVGKKKFVPKAFFDKKQIQNLSGVYFPYWAVDAELSGGISAQATNLRVWIVGDTEYTEHSQYEIQRGGETKFKDLIKNALKKNLSDKMVGAVQPFDMTAAIPFKNQYLSGFLTEKRDIEFPDMKENVEREFRQYADGLMESTIIGYTSVSNLQSNQQIKNIDEDYVLLPIWLVTYKEAGNDRLFYYAMNGQTGKVAGLLPIDKKKLWTVAIGIFILVLLLGIIVGYLLS
>CP033607.1|AYV53074.1|1389390_1390176_+|YgcG-family-protein
MRKKLVFLSLFFLSFFFLLLAPKTAAATFSSGLEDNLQLLGGNVTLLEQEAQKLANETKAGVYVVTTDSSTPASQMAKTYLADKVGAKNNGVVLVINMNLRKVYIWATGNLKYYLPSSRIEKTLDIVQPELTDNNYYQAVSGFFDQVSKYYQAGIPTSRKYSINSETGAVTFHRSFQPLSILIALIISLIAAGGFVWAIYRRYQMKDAHAVWRYDYGRNGNLELHQREDILVNTFITTRIIPRPSSDNNNFSDGSGGGRSF
>CP033607.1|AYV53075.1|1390205_1390763_-|rRNA-large-subunit-pseudouridine-synthase-E
MNFCKKIMIILFNKPYDVLTKFTDGEGRKTLKDYIKIPNVYAAGRLDKDSEGLLLLTDDGKLNHLLTDPKSKSYKTYLVQVEGEFSPEAAQKLQKGLLLKDGKTLPAKVKLIDEPDWLWERTPPIRERKAIPTSWVEISIKEGKNRQIRRMTAAVGFPTLRLIRWSIGQYSLGNLKSGEYKIIQK
>CP033607.1|AYV53076.1|1391080_1391407_-|DUF3324-domain-containing-protein
MPERIIKGKYEAQVDNKTARYKYQWTFDQEFTISDNQAQKLNDSDPTVKKEKDWTWRLFVIGILLLVLFLIILLWKRRKKSQKEEEEKQALREKIEAQEKIIDDLNKK
>CP033607.1|AYV53077.1|1391375_1392245_-|DUF916-and-DUF3324-domain-containing-protein
MKKLQLFLSAIFLTLSFGLAQTGYARTDDYTVKPIIPENQSNKDLGYFDILLGADKEQTLQVELSNNTEQEIKIDVTLSSAVTNMTGLVVYEPTEIVADSSLKYNLKDYVNTPKVVTLPPLTRQKLDLKVKMPNEAFDGQIAGGITFSKEGQNDKEEDSEGITVKNTYSYTIALLMRQNDNEVSPDLKLKTVSPSQINGRNVINVNLQNPTMTYINTMNVKATISGISNTDIKYTYSNSMMQMAPNTSFDLPIPTSNQSAATRVSEPLKPGKYRLQLVVNARTDNQRKI
>CP033607.1|AYV53078.1|1392322_1393135_-|WxL-domain-containing-protein
MKKTILSLSGVAVITATLLSTSVLEVSAASVGSTTSGANVAFQPKKTPTNPVSPGDGKTPISPTTPGVPNTSNPVASDDGLTLDYVPAINFGTHYVDASTAHTWSAWAANDGSGKAIPQFLQVTDNRGTATGPTGWSVSLTQTAQFKGTKAGDLVNAVMTFNNDKTNTVVSTSMNKASSTVNTATNALVPGTAVNIFQADAGTGTGTNLLSFGAGDGSTLVTDPETLDSATNTTGKVDPNITLNVPAGSAKVDTYTTTLNWNLYSAPGNA
>CP033607.1|AYV53079.1|1393109_1393454_-|hypothetical-protein
MKIKYILWVICALLLLNTSVILAQEIGGTNTTGKVGFLEKEPIEKPPVTSSSQATGQSQILTNQNLPIVGTNQNDSLMPFVVGLVTIGVGSLMIKKTKRIRIKENFNEKNNTQP
>CP033607.1|AYV53080.1|1393500_1394505_-|DUF916-domain-containing-protein
MKKVYKLIFLSILSILLIVQSKVAYSESPTSDFSVEAILEGHQKDKSITYWWLQVEKTQSINLKLKISNGNEENNFEITSNQAVNNNNFTLDYSLSAEEVSQYLHHKNSNFNFYQDIYFDETQEAGKLKITLAPNEVREITINLKIPKEGIKGQLIGGINVTKVPKESDRQEGILNVYSNVVALVMEDKDYSESHKQNLEFALEKSNEKEQVIKIKNSNSFLLSNMNIKAVIKDQKGEVVSEFSNPKTAVVPNASVSIKLNNQKELVKGAKYYLTVDSSNQTFKRNLIVSDSGNLKILEKKKEEIQPLNKKSVGLSLILMVVISSGGIYAYFKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033607_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033607_3

1847640-1847734

Orphan

Consensus_repeat	Method
TTTATTACTGACAGACTTGTCAGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP033607_3

>merge|CP033607|3|1847640-1847734|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGCTTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCGCTTTTTACTGACAGACTTGTCAGC

>CP033607|3|3|1847640-1847734|CRISPRCasFinder
TTTATTACTGACAGACTTGTCAGC	TTTGCTGACAAATCCTTCATCCATTGATAAAAAGCTCAATTCAATCG
CTTTTTACTGACAGACTTGTCAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP033607.1\|AYV53495.1\|1843824_1844187_+\|hypothetical-protein	unknown	unknown	unknown
CP033607.1\|AYV53496.1\|1844161_1844455_+\|hypothetical-protein	unknown	unknown	unknown
CP033607.1\|AYV53502.1\|1850127_1851384_-\|Fe-S-cluster-assembly-protein-SufD	unknown	unknown	gnl\|CDD\|223791
CP033607.1\|AYV53494.1\|1842691_1843840_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|273881
CP033607.1\|AYV53492.1\|1840746_1841316_-\|biotin-transporter-BioY	unknown	unknown	gnl\|CDD\|224187
CP033607.1\|AYV54033.1\|1848426_1848909_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223659
CP033607.1\|AYV53503.1\|1851521_1852292_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473
CP033607.1\|AYV53498.1\|1845220_1846066_+\|2-nitropropane-dioxygenase	unknown	unknown	gnl\|CDD\|132195
CP033607.1\|AYV53507.1\|1855365_1856052_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
CP033607.1\|AYV53493.1\|1841460_1842702_+\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|341288
CP033607.1\|AYV53506.1\|1854631_1855366_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
CP033607.1\|AYV53505.1\|1853800_1854502_-\|adaptor-protein-MecA	unknown	unknown	gnl\|CDD\|227199
CP033607.1\|AYV53508.1\|1856199_1857108_-\|diacylglycerol-kinase-family-lipid-kinase	unknown	unknown	gnl\|CDD\|224513
CP033607.1\|AYV53504.1\|1852466_1853798_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	unknown	unknown	gnl\|CDD\|133463
CP033607.1\|AYV53497.1\|1844451_1845198_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187594
CP033607.1\|AYV53490.1\|1839447_1839753_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226801
CP033607.1\|AYV53499.1\|1846206_1847619_-\|Fe-S-cluster-assembly-protein-SufB	unknown	unknown	gnl\|CDD\|131035
CP033607.1\|AYV53500.1\|1847852_1848311_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	unknown	unknown	gnl\|CDD\|273918
CP033607.1\|AYV53491.1\|1839769_1840741_-\|biotin--[acetyl-CoA-carboxylase]-ligase	unknown	unknown	gnl\|CDD\|237010
CP033607.1\|AYV53501.1\|1848910_1850128_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|131034

Protein	Function_ID	Function_description	E-value
CP033607.1\|AYV53499.1\|1846206_1847619_-\|Fe-S-cluster-assembly-protein-SufB	gnl\|CDD\|131035	TIGR01980, UPF0051_protein_slr0074, FeS assembly protein SufB. This protein, SufB, forms a cytosolic complex SufBCD. This complex enhances the cysteine desulfurase of SufSE. The system, together with SufA, is believed to act in iron-sulfur cluster formation during oxidative stress. Note that SufC belongs to the family of ABC transporter ATP binding proteins, so this protein, encoded by an adjacent gene, has often been annotated as a transporter component. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0
CP033607.1\|AYV53502.1\|1850127_1851384_-\|Fe-S-cluster-assembly-protein-SufD	gnl\|CDD\|223791	COG0719, SufB, Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].	9.30838e-131
CP033607.1\|AYV53494.1\|1842691_1843840_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|273881	TIGR01930, 3-ketoacyl-CoA_thiolase, acetyl-CoA acetyltransferases. This model represents a large family of enzymes which catalyze the thiolysis of a linear fatty acid CoA (or acetoacetyl-CoA) using a second CoA molecule to produce acetyl-CoA and a CoA-ester product two carbons shorter (or, alternatively, the condensation of two molecules of acetyl-CoA to produce acetoacetyl-CoA and CoA). This enzyme is also known as "thiolase", "3-ketoacyl-CoA thiolase", "beta-ketothiolase" and "Fatty oxidation complex beta subunit". When catalyzing the degradative reaction on fatty acids the corresponding EC number is 2.3.1.16. The condensation reaction corresponds to 2.3.1.9. Note that the enzymes which catalyze the condensation are generally not involved in fatty acid biosynthesis, which is carried out by a decarboxylating condensation of acetyl and malonyl esters of acyl carrier proteins. Rather, this activity may produce acetoacetyl-CoA for pathways such as IPP biosynthesis in the absence of sufficient fatty acid oxidation. [Fatty acid and phospholipid metabolism, Other].	4.30804e-158
CP033607.1\|AYV53492.1\|1840746_1841316_-\|biotin-transporter-BioY	gnl\|CDD\|224187	COG1268, BioY, Uncharacterized conserved protein [General function prediction only].	5.72661e-47
CP033607.1\|AYV54033.1\|1848426_1848909_-\|hypothetical-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	3.28577e-22
CP033607.1\|AYV53503.1\|1851521_1852292_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	2.57723e-148
CP033607.1\|AYV53498.1\|1845220_1846066_+\|2-nitropropane-dioxygenase	gnl\|CDD\|132195	TIGR03151, enACPred_II, putative enoyl-[acyl-carrier-protein] reductase II. This oxidoreductase of the 2-nitropropane dioxygenase family (pfam03060) is commonly found in apparent operons with genes involved in fatty acid biosynthesis. Furthermore, this genomic context generally includes the fabG 3-oxoacyl-[ACP] reductase and lacks the fabI enoyl-[ACP] reductase.	3.58449e-84
CP033607.1\|AYV53507.1\|1855365_1856052_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.09368e-76
CP033607.1\|AYV53493.1\|1841460_1842702_+\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|341288	cd17633, AFD_YhfT-like, fatty acid-CoA ligase VraA. This family of acyl-CoA ligases includes Bacillus subtilis YhfT, as well as long-chain fatty acid-CoA ligase VraA, all of which are as yet to be characterized. These proteins belong to the adenylate-forming enzymes which catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain	3.2301e-68
CP033607.1\|AYV53506.1\|1854631_1855366_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.02808e-157
CP033607.1\|AYV53505.1\|1853800_1854502_-\|adaptor-protein-MecA	gnl\|CDD\|227199	COG4862, MecA, Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion].	3.81196e-86
CP033607.1\|AYV53508.1\|1856199_1857108_-\|diacylglycerol-kinase-family-lipid-kinase	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	2.39571e-70
CP033607.1\|AYV53504.1\|1852466_1853798_-\|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase	gnl\|CDD\|133463	cd06853, GT_WecA_like, This subfamily contains Escherichia coli WecA, Bacillus subtilis TagO and related proteins. WecA is an UDP-N-acetylglucosamine (GlcNAc):undecaprenyl-phosphate (Und-P) GlcNAc-1-phosphate transferase that catalyzes the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate molecule and N-acetylglucosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylglucosamine precursor. WecA participates in the biosynthesis of O antigen LPS in many enteric bacteria and is also involved in the biosynthesis of enterobacterial common antigen. A conserved short sequence motif and a conserved arginine at a cytosolic loop of this integral membrane protein were shown to be critical in recognition of substrate UDP-N-acetylglucosamine.	4.68381e-85
CP033607.1\|AYV53497.1\|1844451_1845198_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187594	cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs. This subgroup includes the Escherichai coli K12 BKR, FabG. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet) NAD(P)(H) binding region and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H) binding pattern: TGxxxGxG in classical SDRs. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P) binding motif and an altered active site motif (YXXXN). Fungal type type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P) binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr-151 and Lys-155, and well as Asn-111 (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	4.80083e-73
CP033607.1\|AYV53490.1\|1839447_1839753_-\|hypothetical-protein	gnl\|CDD\|226801	COG4357, COG4357, Zinc finger domain containing protein (CHY type) [Function unknown].	1.12966e-28
CP033607.1\|AYV53491.1\|1839769_1840741_-\|biotin--[acetyl-CoA-carboxylase]-ligase	gnl\|CDD\|237010	PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA.	8.8094e-70
CP033607.1\|AYV53500.1\|1847852_1848311_-\|SUF-system-NifU-family-Fe-S-cluster-assembly-protein	gnl\|CDD\|273918	TIGR01994, Iron-sulfur_cluster_assembly_scaffold_protein_IscU, SUF system FeS assembly protein, NifU family. Three iron-sulfur cluster assembly systems are known so far. ISC is broadly distributed while NIF tends to be associated with nitrogenase in nitrogen-fixing bacteria. The most recently described is SUF, believed to be important to maintain the function during aerobic stress of enzymes with labile Fe-S clusters. It is fairly widely distributed. This family represents one of two different proteins proposed to act as a scaffold on which the Fe-S cluster is built and from which it is transferred. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	9.34852e-67
CP033607.1\|AYV53501.1\|1848910_1850128_-\|cysteine-desulfurase	gnl\|CDD\|131034	TIGR01979, Probable_cysteine_desulfurase, cysteine desulfurases, SufSfamily. This model represents a subfamily of NifS-related cysteine desulfurases involved in FeS cluster formation needed for nitrogen fixation among other vital functions. Many cysteine desulfurases are also active as selenocysteine lyase and/or cysteine sulfinate desulfinase. This subfamily is associated with the six-gene SUF system described in E. coli and Erwinia as an FeS cluster formation system during oxidative stress. The active site Cys is this subfamily resembles GHHC with one or both His conserved. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	0

>CP033607.1|AYV53499.1|1846206_1847619_-|Fe-S-cluster-assembly-protein-SufB
MTENSTQEVVKDLEEYKFGFHDNAELEFTTGLGLTEEVIREISETKNEPEWMLEFRLKSFEAFKKLDMPKWGPDLSGIDFNDIVYYQKPSAKAARSWEDVPQEIKDTFEKIGIPEAERSYLAGASAQYESEVVYHNMKDEFEKLGIIFTDTDSGLRDYPEIFKKYFSKLVPPTDNKLAALNSAVWSGGSFVYVPKGVKCEIPIQAYFRINNEKSGQFERTLIIVEEGASIQYVEGCTAPTYSASSLHAAVVEIFVEEGGYMRYSTIQNWSDNVYNLVTKRAAAEKNATVEWIDGNLGSKVSMKYPAVHLNGPGARGTMLSIAFAGANQNQDTGAKMIHNAPNTSSSIISKSIAKNGGAVNYRGQVTFGKNSKKSASHIECDTILMDDLSKSDTVPFNEIHNSQVALEHEAKVSKISEEQLYYLMSRGLTEKEATDMIVMGFIEPFTKELPMEYAVELNRLISYSMEGSIG
>CP033607.1|AYV53498.1|1845220_1846066_+|2-nitropropane-dioxygenase
MTWYHELGIKYPLFQGGMAWASNAELVAAVSNNGALGIIGSGGRTANELRRMIRKTKTLTSQPFGVNLMLLDKNIKQLLEVICEEKISVVTTGAGSPKEIIDTIIANNIKLFPVVPNKEIALKMLNLPISGIIVEGNEAGGHVGSQNLASLLKEIAPICPLPLIAAGGIYDHHTASLANILGANGVQVGTAFLLAKECQISPIYQELICKGEENGTSLISDKNGHLTRLLNISSEYPLNKSLKAAVEKGDLINGAFMAGSSSAYLEKIEPVENIIQRIMKK
>CP033607.1|AYV53497.1|1844451_1845198_+|SDR-family-NAD(P)-dependent-oxidoreductase
MNKRTILITGATRGIGWAIAQKAAQANHKVILTGRDPLSLKSRAEELKKKFPKTEIQAIPLDVSNRSSVANAAKLIKDIDILINNAGITADSTFKKMSPEIWDEVISVNLTGVFNSTHALLDKINQGGQIITLTSKSALFGNFGQANYAASKAGIIAFTKTLAKELQKSMIRVNSVSPAAVTDMTLPVLKSLKETYGQNIPDEWKMGSSSDVANFIINDLIESEMTGKIFSINGSEIGYWQEPTFHKL
>CP033607.1|AYV53496.1|1844161_1844455_+|hypothetical-protein
MKLYKKINKADLIDYLQSVKDTNSLHYGKNPIIPGNFLLFILEEMYQEFYSMPLSYLKANFCSPAYLNERFCFIFNQNAFQITDRNQTLILKGEWKQ
>CP033607.1|AYV53495.1|1843824_1844187_+|hypothetical-protein
MVSKMILIAQKSLPRHFKLEGQKNFLSLLPQLWQELEGIPYSLKNGENWLLSEEIIRYPSSNYSFDKLKLYLLSEHITRHSKKYIINLSLEITSNTKLLAQINLSLLSEDSWNEIIQKNQ
>CP033607.1|AYV53494.1|1842691_1843840_+|acetyl-CoA-C-acyltransferase
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNLLLKKADIDYIILGNVTNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASVICTGGVESTSQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKATQAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPINDGASSIILSSTNNPFDFQGYYLGQTTIALSPSDFLLGPIKATEKLLQKFNLKLNDIEAIELNEAFASQAILFQNYFKLDDIKLNAYGGSLAFGHPYGATGGILISRLLNRLNQVQKPCLGIATLCVAGGMGISVLIGNQWYQK
>CP033607.1|AYV53493.1|1841460_1842702_+|long-chain-fatty-acid--CoA-ligase
MEKNKFNFSKLAALFTDYPALKIGEISYSYQQINDLIQRKLTDYSHSSKTVITLINDSPLNFIIDFLAIIESGNYPLVVDKSFKKKSFKFGLIPEDTLFLASTSGTTGPPKIYYRNWESWKMGFEVCDDLFHLSNSQALATTSPLTTSLGLHTLMCALYLGKTFLTITNPSQFINITENYALFTVPTYLLNNLNELFALTSPEIIFLGGGTLSPEAINKVRKKLPQTQMIEFYGSSETSFISWQAVNEGKKTSSVGKLFPHVELTLGPKYRLTVKSPYLFSGYLNQPYPQSWTTDDLGTLKNNHLYLFGRRSDIIEHGANKIFPEEIERMAKDLCEDCIAFGVFDERYSQKIALLLLKPIEKEKLIKILAQRLPKYKLPQIYLETPTLNFTKNQKISRKELEKEYFRGVYHEL
>CP033607.1|AYV53492.1|1840746_1841316_-|biotin-transporter-BioY
MTKNQKVKTLTYSAFMTAFIIILGFLPGIPIGFIPVPIILQNMGIMMAGGLLGPKYGTISVGAFLTLALIGLPVLTGGNGGAASFLGPSGGYRMAWLFTPFLIGFFLKKLQITASKNWIGELIIVLVFGVIFVDLVGAIWLSIQSNIPLITSLISNLVFIPGDCIKAILTVLIVRRLRKEGGFEMYFRK
>CP033607.1|AYV53491.1|1839769_1840741_-|biotin--[acetyl-CoA-carboxylase]-ligase
MRTTKQFVLLKLLQQKGNWVSGDELAEELKLSRESIWKAINTLKRKGNQIESRKNLGYKYVGNESLDEDTINFYSGMKFEDKIFVFDEVTSTQELAKQYLSSHEVKQPFIFVANNQTEGHGRRGRNFYSPSDTGLYFSLILPNPSHDILKIGLLTTSTAVAVVKVLEQFYKDKNFQLKWVNDIYLGTYKVGGIITEAALDLESSSAGNFIMGIGLNLSTKDFPADLSEKAQGINPEFKIDRNQLLAEMAKEVINNFANYRQPDLIDEYRKRSLLFGKNVTLKLGTKAVNGKVEGISDDGSLILKAKSGELQTFKSGEVVKVDW
>CP033607.1|AYV53490.1|1839447_1839753_-|hypothetical-protein
MREKIWGKVIDEEGRCTHYHQENDIVALKCSDCEKYFSCYHCHDELENHLFRATDKEDFPVLCGHCGKKLNFNDYSRGECIKCSSAFNPNCHRHWQVYFNE
>CP033607.1|AYV53500.1|1847852_1848311_-|SUF-system-NifU-family-Fe-S-cluster-assembly-protein
MALSKLDNLYRAVILDHSSNPRHAGELQTGCMVDLNNPTCGDVIRLTVEFENDVISNIAFSGHGCTISTASASMMTVAVLGKTKEEAKELATIFSAMVTGETDERQEKLGDAQFLAGVSKFPARVKCSTLAWNALKKAIDVGEAQETVIHGE
>CP033607.1|AYV54033.1|1848426_1848909_-|hypothetical-protein
MLNWVASLPLWLATTFLFVVVFFRAQCTFWLGKLSYHGILKTKWGKKLEKNSETSAGILAIQKMGWPIIPLSFLTVGFQTAVQFGAGLTNWSWYKYTLAAIPGYLAWGFIYASGGLSLFRSLVQGSIGLLILFIIIILAVVIAANLVLRYIRKNGIKTDD
>CP033607.1|AYV53501.1|1848910_1850128_-|cysteine-desulfurase
MLEGIKKDFPVLNQIVNDEPLVYLDNAATTQKPLKVLAAIKDYYENDNANVHRGVHTLAERATEKYEAAREKVRQFINAKSTKEVLFTRGTTTSINWVAQFAGQILKTGDEIVISIMEHHSNIVPWQEVAKKTGAILKFVYLKDGQLDMDDLRKKITNQTKFVSIAHVSNVLGTINPVEEITKIAHEHGAYMAVDGAQSTPHMAIDLQKMDVDFFAFSGHKMMGPTGIGVLYGKEELLNQFEPVEFGGEMIDFVYESHSTWTELPWKFEAGTPNIAGAIALGAAIDYIQELGIDQIHQHEIELIDYLMPKLQEIEGLKIYGPKDNVKRGGLIAFNIEGLHPHDVATALDMEGVAVRAGHHCAQPLLNYLETPATARASFYLYNTKADCDKLVEALKKTKEFFNLD
>CP033607.1|AYV53502.1|1850127_1851384_-|Fe-S-cluster-assembly-protein-SufD
MNQEILNFSQMHAEPAWLSDLRQKAALEFENLELPNIERVKINRWGLDHLSISENEEIGSVPTFTEIPNHPLLVQVGSQTVMEQMTPNLAEQGVIFTDFNSALTEIPELLEENFGSVVPFNESRLTAANTVTFNSGLVLYVPDGVEVLEPIESILMQEGSSEVPFNKRILIIVGKNAKVDYLERLETSDEQSSKAKANIVVEVIAKAGAQVKFAAIDRLGENVTASVVRRGLIGDNATVDWSVGVMNDGNVVADFDSDLKGNGSHSQIKVVGISTGHQTQGIDTRVTNFGLNSVGHILQNGVILDKGTLTFNAIGHIIKGAKNADAQQSSHVLMLSDKGRGDANPILLIDENEVTAGHAASVGQVDEEDLFYLQSRGLDEETAKRLVIRGFLGSVVSEIPVKSVQAEFIETIERKLGM
>CP033607.1|AYV53503.1|1851521_1852292_-|Fe-S-cluster-assembly-ATPase-SufC
MATLEIKNLHVAIEDKEILKGVNLVINTNEIHAIMGPNGTGKSTLSAAIMGNPNYSVTQGEVLFDGQNVLEMSVDERARLGLFLAMQYPSEIPGITNAEFLRAAMNAKRAEDDKVSVMEFIKKLDKNMEVLSMKEEMAERYLNEGFSGGEKKRNEILQLLMLEPTFAILDEIDSGLDIDALKVVAKGVNSMRGEKFGALIITHYQRLLDYITPDVVHIMMDGRVVKTGGAELAKRLETEGYVNIAEELGLEYKEEV
>CP033607.1|AYV53504.1|1852466_1853798_-|undecaprenyl/decaprenyl-phosphate-alpha-N-acetylglucosaminyl-1-phosphate-transferase
MVDTLKEIPFALKFLIVIIITFGISVILTPIMTFVSKAIGAVDKPNERRVNKKPMPSAGGLVIFIAFAIATLFILPHIVHNQPPIHSQPPVHGASHQPIQLVSYFSYIWPFIVGAGIVVLTGLIDDIKEISPKMKLLGLTVAASFIWFFTNARFDNLKIPFGGPLLIFPAWLSFIFTVFWILAITNAINLIDGLDGLASGVSIISLTTMGIVSYFFLPSPNVFLPITIFIMVAAIMGFFPYNYHPAIIYLGDTGALFLGFIISVASLQGLKNATAVAVLTPLLILGVPITDTIMAMVRRKLNRQSIATADKRHLHHRLMALGFTHRGAVLVIYGIASIFAFISILLQFSSRIGGILLVIACLFGLEIFIELVGILGENRQPVLKALKFVGNSSYRDKVLHSDEDADIDENEEDIGNHSMIDEEIDEPTQEFPIQNYRRSRNKK
>CP033607.1|AYV53505.1|1853800_1854502_-|adaptor-protein-MecA
MKYEDINENTIKITLSFDDLTDYDIKLSDFFGNQEVIEQFFYELVDELGLENRFGNVGMLTFQIQPFPQGVHMIVHEEAMLGEGGEIPDDPEEFEELMTGFYNKLNEIGADMARERGITDFKPGLGLPGTKKDEAEQEPDFIYYSIRYEDIMSVLTGIKNVKFADEESEFYRYDGNFYLVVLDNQKEKGKMHVESTRSRMMEYGEATKMSREFLQEYGECLIATRALDVLRKI
>CP033607.1|AYV53506.1|1854631_1855366_-|amino-acid-ABC-transporter-ATP-binding-protein
MNEYLIEIKNLHKYFGKNEVLKGLDIQIKKGEVVVMIGPSGSGKSTFLRTMNLLEKPTDGQVYFEGVNIADKSVDVFKHREKMGMVFQQFNLFPNMTVLENLCLAPVKTGKMTKEEAKKTAEDLLQRVGLSDKAEAYPQALSGGQQQRVAIARALAMNPDVMLFDEPTSALDPEMVGEVLAVMQELAKEGMTMVVVTHEMGFAKTVADRVLFMADGTIVEQGKPAQVFDSPKEKRTQDFLAKVL
>CP033607.1|AYV53507.1|1855365_1856052_-|amino-acid-ABC-transporter-permease
MNFDFLPKYLPYFNDGMIVTILISAFVVLIGTLLGIVTALAKISKIAPLRWLANIYIEIFRGTPMLVQIMLGFGLMGSLSLPTFQVGILQQDLGRLIPGIIVISLNSGAYMAEIVRAGIEAVPLGQKEAAYSLGIRPRQAMATVILPQALRNILPAVGNEFVTIIKDSSLLYTIGVMEVFNGAQTVANLTYQTISPMLFVALYYFVVTFVVSRLLVLFEKKLGKGYAK
>CP033607.1|AYV53508.1|1856199_1857108_-|diacylglycerol-kinase-family-lipid-kinase
MTYYLLANPNSGAGKGARTLETLIPYLEKNNYEYRLFKTKAAGEEGALVRQILDLKNPDDHLVIIGGDGTISLVINELPEEEAFSYIPSGSGNDFARSLKLKLDPIESFEAARRGINHEIFIMNYQSKGLSGYALNNIGIGLDATIVKSANEGKLKQVLNKLKLGSFSYILTALHVLITKKPFPALIEVENQEISLENAFLMTFTKHPYFGGGVKISPEATNENADIHLVEYNKHHLLRTFSLIPSVLRGMHLKHPLFLHRVSPQFSVELAESQPVQIDGEIHELVAADRLSISTERRMIIY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033607_2	2.1\|1417984\|46\|CP033607\|CRISPRCasFinder	1417984-1418029	46	AF323669	Bacteriophage bIL286, complete genome	39158-39203	0	1.0
CP033607_2	2.1\|1417984\|46\|CP033607\|CRISPRCasFinder	1417984-1418029	46	NC_002667	Lactococcus prophage bIL286, complete genome	39158-39203	0	1.0
CP033607_2	2.1\|1417984\|46\|CP033607\|CRISPRCasFinder	1417984-1418029	46	MF448566	Lactococcus phage 63302, complete genome	7597-7642	2	0.957

1. spacer 2.1|1417984|46|CP033607|CRISPRCasFinder matches to AF323669 (Bacteriophage bIL286, complete genome) position: , mismatch: 0, identity: 1.0

tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	CRISPR spacer
tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	Protospacer
**********************************************

2. spacer 2.1|1417984|46|CP033607|CRISPRCasFinder matches to NC_002667 (Lactococcus prophage bIL286, complete genome) position: , mismatch: 0, identity: 1.0

tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	CRISPR spacer
tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	Protospacer
**********************************************

3. spacer 2.1|1417984|46|CP033607|CRISPRCasFinder matches to MF448566 (Lactococcus phage 63302, complete genome) position: , mismatch: 2, identity: 0.957

tgttgaaacagtcgccgattgattattaacagtatgccgtaaactt	CRISPR spacer
tgttgaaacagttgccgattgattattaacagtatgctgtaaactt	Protospacer
************.************************.********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

13280 : 55047

Lactococcus_phage(83.87%)

terminase,bacteriocin,protease,tRNA,transposase,integrase

attL 34907:34934|attR 49836:49863

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV51790.1\|13280_15272_+\|bacteriocin	bacteriocin-associated integral membrane family protein	NA	NA	NA	NA
AYV51791.1\|15273_15909_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-24	36.0
AYV51792.1\|16109_16580_+	hypothetical protein	A0A097BYE2	Leuconostoc_phage	4.0e-10	30.1
AYV51793.1\|16597_17164_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AYV51794.1\|17164_20650_+	transcription-repair coupling factor	NA	NA	NA	NA
AYV51795.1\|20809_21280_+	hypothetical protein	NA	NA	NA	NA
AYV51796.1\|21350_21668_+	RNA-binding S4 domain-containing protein	NA	NA	NA	NA
AYV51797.1\|21696_22071_+	septum formation initiator family protein	NA	NA	NA	NA
AYV51798.1\|22070_22394_+	RNA-binding protein	NA	NA	NA	NA
AYV51799.1\|22531_23881_+	serine hydrolase	NA	NA	NA	NA
AYV51800.1\|23877_25149_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
AYV51801.1\|25129_25681_+	hypoxanthine-guanine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	1.8e-09	29.7
AYV51802.1\|25886_27974_+\|protease	ATP-dependent zinc metalloprotease FtsH	G8DDJ2	Micromonas_pusilla_virus	5.4e-107	49.2
AYV51803.1\|30921_32859_+	transcription antiterminator	NA	NA	NA	NA
AYV51804.1\|32906_33338_+	PTS mannitol transporter subunit IIA	NA	NA	NA	NA
AYV51805.1\|33475_34633_+	mannitol-1-phosphate 5-dehydrogenase	NA	NA	NA	NA
34907:34934	attL	NA	NA	NA	NA
AYV51806.1\|35515_35839_-	sigma-70 family RNA polymerase sigma factor	Q9AZI1	Lactococcus_phage	3.8e-52	100.0
AYV51807.1\|35863_36274_-	DUF722 domain-containing protein	Q9AZI2	Lactococcus_phage	8.0e-71	100.0
AYV51808.1\|36270_36714_-\|terminase	terminase small subunit	Q9AZI3	Lactococcus_phage	7.3e-62	100.0
AYV51809.1\|36846_37428_-	hypothetical protein	Q9AZI4	Lactococcus_phage	2.0e-99	100.0
AYV51810.1\|37663_39292_-	DNA primase	Q9AZI5	Lactococcus_phage	0.0e+00	100.0
AYV51811.1\|39302_40097_-	hypothetical protein	Q9AZI6	Lactococcus_phage	5.4e-156	100.0
AYV51812.1\|40100_40430_-	hypothetical protein	Q9AZI7	Lactococcus_phage	5.2e-57	100.0
AYV51813.1\|40416_40611_-	hypothetical protein	Q9AZI8	Lactococcus_phage	2.3e-28	100.0
AYV51814.1\|40607_40862_-	hypothetical protein	Q9AZI9	Lactococcus_phage	1.5e-40	100.0
AYV51815.1\|40858_41098_-	hypothetical protein	Q9AZJ0	Lactococcus_phage	1.6e-39	100.0
AYV51816.1\|41140_41422_-	hypothetical protein	Q9AZJ1	Lactococcus_phage	8.5e-48	100.0
AYV51817.1\|41418_41670_-	XRE family transcriptional regulator	Q9AZJ2	Lactococcus_phage	1.7e-39	100.0
AYV51818.1\|41666_42188_-	hypothetical protein	Q9AZJ3	Lactococcus_phage	1.5e-93	100.0
AYV51819.1\|42191_42386_-	DUF1655 domain-containing protein	Q9AZJ4	Lactococcus_phage	7.9e-29	100.0
AYV51820.1\|42461_43202_-	hypothetical protein	Q9AZJ5	Lactococcus_phage	4.1e-134	100.0
AYV53968.1\|43230_43407_-	hypothetical protein	Q9AZJ6	Lactococcus_phage	2.2e-22	100.0
AYV51821.1\|43688_44075_+	XRE family transcriptional regulator	Q9AZJ7	Lactococcus_phage	7.3e-66	100.0
AYV51822.1\|44084_44639_+	hypothetical protein	Q9AZJ8	Lactococcus_phage	8.1e-111	100.0
AYV51823.1\|44749_44980_+	hypothetical protein	Q9AZK0	Lactococcus_phage	3.7e-17	100.0
AYV51824.1\|45052_45247_+	hypothetical protein	Q9AZK1	Lactococcus_phage	6.0e-29	100.0
AYV51825.1\|45398_45641_+	hypothetical protein	Q9AZK2	Lactococcus_phage	4.6e-34	100.0
AYV51826.1\|45776_46001_+	hypothetical protein	Q9AZK3	Lactococcus_phage	4.5e-36	100.0
AYV51827.1\|47369_47585_+	hypothetical protein	Q9AZK5	Lactococcus_phage	5.5e-31	100.0
AYV51828.1\|47701_47866_+\|bacteriocin	bacteriocin	Q9AZK6	Lactococcus_phage	7.9e-22	100.0
AYV51829.1\|47987_48293_+\|bacteriocin	bacteriocin immunity protein	Q9AZK7	Lactococcus_phage	8.3e-49	100.0
AYV51830.1\|48542_49727_+\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	1.9e-226	100.0
AYV51831.1\|50179_50629_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
49836:49863	attR	NA	NA	NA	NA
AYV51832.1\|50705_50948_+	TM2 domain-containing protein	NA	NA	NA	NA
AYV51833.1\|53899_55047_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-45	40.6

DBSCAN-SWA_2

67263 : 111030

Bacillus_phage(44.44%)

transposase,bacteriocin,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV51844.1\|67263_68289_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AYV51845.1\|68790_69228_+	OsmC family peroxiredoxin	NA	NA	NA	NA
AYV51846.1\|69388_70702_+	APC family permease	NA	NA	NA	NA
AYV51847.1\|70761_71112_+	hypothetical protein	NA	NA	NA	NA
AYV51848.1\|71170_72166_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
AYV51849.1\|72268_73081_-	HAD family hydrolase	NA	NA	NA	NA
AYV51850.1\|73206_74844_-	ABC-F family ATPase	A0A2K9L3Z8	Tupanvirus	5.3e-49	25.9
AYV51851.1\|75971_77252_-	O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase	A0A2I2L687	Orpheovirus	1.4e-09	26.9
AYV51852.1\|77478_78312_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYV51853.1\|78712_79180_+	universal stress protein	NA	NA	NA	NA
AYV51854.1\|79308_79506_+	DUF4649 domain-containing protein	NA	NA	NA	NA
AYV51855.1\|79536_80157_+	alpha/beta hydrolase	NA	NA	NA	NA
AYV51856.1\|80207_81377_+	ring-cleaving dioxygenase	NA	NA	NA	NA
AYV51857.1\|81387_81978_+	flavin reductase family protein	NA	NA	NA	NA
AYV51858.1\|82575_84723_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	7.2e-38	26.5
AYV51859.1\|84737_86159_+	HlyD family secretion protein	NA	NA	NA	NA
AYV51860.1\|86252_86378_+	hypothetical protein	NA	NA	NA	NA
AYV51861.1\|86619_87072_+	transporter	NA	NA	NA	NA
AYV51862.1\|87110_87767_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYV51863.1\|87869_88151_-	hypothetical protein	NA	NA	NA	NA
AYV51864.1\|88160_88313_-	hypothetical protein	NA	NA	NA	NA
AYV51865.1\|88651_88870_+	hypothetical protein	NA	NA	NA	NA
AYV51866.1\|88963_89101_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AYV51867.1\|89115_89826_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYV51868.1\|90251_90704_+	transporter	NA	NA	NA	NA
AYV51869.1\|91050_92162_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
AYV51870.1\|92198_92804_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYV51871.1\|94251_94620_+	hypothetical protein	NA	NA	NA	NA
AYV51872.1\|94839_95142_-	hypothetical protein	NA	NA	NA	NA
AYV51873.1\|95143_95311_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AYV51874.1\|95877_96027_-	50S ribosomal protein L33	NA	NA	NA	NA
AYV51875.1\|96056_96230_-	50S ribosomal protein L32	NA	NA	NA	NA
AYV51876.1\|96593_98375_+	cadmium-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.8e-61	29.1
AYV51877.1\|98427_99213_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
AYV51878.1\|99267_100527_-	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	3.5e-93	45.4
AYV51879.1\|100570_101059_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYV51880.1\|101210_101678_+	DUF3013 family protein	NA	NA	NA	NA
AYV51881.1\|101707_103261_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	3.0e-46	28.1
AYV51882.1\|103391_103676_+	hypothetical protein	NA	NA	NA	NA
AYV51883.1\|103713_104202_+	DUF1905 domain-containing protein	NA	NA	NA	NA
AYV51884.1\|104219_105173_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AYV51885.1\|105272_106025_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AYV51886.1\|106053_107010_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
AYV51887.1\|107210_109433_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	U5J9N6	Bacillus_phage	2.9e-13	28.3
AYV51888.1\|109448_110384_-	glycosyltransferase	V9QJB1	Oenococcus_phage	1.3e-76	49.7
AYV51889.1\|110574_111030_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA

DBSCAN-SWA_3

135559 : 174031

Shigella_phage(40.0%)

transposase,protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV51911.1\|135559_135787_+\|bacteriocin	bacteriocin leader domain-containing protein	NA	NA	NA	NA
AYV51912.1\|135964_136510_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYV51913.1\|136562_137243_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYV51914.1\|137411_138558_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
AYV51915.1\|138615_139987_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.6e-54	43.4
AYV51916.1\|140043_141191_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
AYV51917.1\|141495_141762_+	IreB family regulatory phosphoprotein	NA	NA	NA	NA
AYV51918.1\|141761_142193_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
AYV51919.1\|142345_142669_+	DUF1292 domain-containing protein	NA	NA	NA	NA
AYV51920.1\|142699_143251_-	DUF1211 domain-containing protein	NA	NA	NA	NA
AYV51921.1\|143345_144131_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYV51922.1\|144150_144396_-	DUF2316 family protein	NA	NA	NA	NA
AYV51923.1\|144405_145191_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYV51924.1\|145302_145848_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYV51925.1\|145929_147876_-	1,4-alpha-glucan-branching enzyme	NA	NA	NA	NA
AYV53972.1\|148002_148323_-	hypothetical protein	NA	NA	NA	NA
AYV51926.1\|148794_154746_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AYV51927.1\|155374_156523_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.2e-85	42.9
AYV51928.1\|156714_157407_+	DUF975 family protein	NA	NA	NA	NA
AYV51929.1\|157467_158649_-	MFS transporter	NA	NA	NA	NA
AYV51930.1\|158829_159267_-	CoA-binding protein	NA	NA	NA	NA
AYV51931.1\|159401_160193_+	DNAse	NA	NA	NA	NA
AYV51932.1\|160357_160567_+	hypothetical protein	NA	NA	NA	NA
AYV51933.1\|160578_160818_+	hypothetical protein	NA	NA	NA	NA
AYV51934.1\|161013_162597_+	APC family permease	NA	NA	NA	NA
AYV51935.1\|162665_163880_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AYV51936.1\|164032_164821_+	GTP-sensing pleiotropic transcriptional regulator CodY	NA	NA	NA	NA
AYV51937.1\|165329_165635_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
AYV51938.1\|165634_167095_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
AYV51939.1\|167098_167701_+	NUDIX domain-containing protein	NA	NA	NA	NA
AYV51940.1\|167740_169174_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
AYV51941.1\|169397_170897_+	amidase	NA	NA	NA	NA
AYV51942.1\|170978_172319_-	MATE family efflux transporter	NA	NA	NA	NA
AYV51943.1\|172500_172698_-	cold-shock protein	Q9AZD3	Lactococcus_phage	7.8e-24	81.5
AYV51944.1\|172815_173349_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AYV51945.1\|173338_174031_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA

DBSCAN-SWA_4

395391 : 407522

Streptococcus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV52144.1\|395391_395709_+	thioredoxin	A0A0K2FIM3	Achromobacter_phage	4.5e-05	30.4
AYV52145.1\|395794_396421_+	DUF4479 domain-containing protein	NA	NA	NA	NA
AYV52146.1\|396583_397924_+	NADH oxidase	NA	NA	NA	NA
AYV52147.1\|398013_398403_+	single-stranded DNA-binding protein	A0A0K0MWE1	Streptococcus_phage	1.4e-24	45.0
AYV52148.1\|398522_398807_+	co-chaperone GroES	A0A221S386	uncultured_virus	3.1e-13	44.1
AYV52149.1\|398894_400523_+	molecular chaperone GroEL	A0A219YK78	uncultured_virus	4.9e-156	56.8
AYV52150.1\|400568_401381_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	38.1
AYV52151.1\|401551_402994_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	1.4e-32	33.0
AYV52152.1\|402986_403688_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.2e-42	39.7
AYV52153.1\|403865_404501_+	dTMP kinase	M1PSC7	Streptococcus_phage	5.4e-74	65.0
AYV52154.1\|404633_405494_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	5.0e-67	45.2
AYV52155.1\|405545_406328_+	Signal peptidase	NA	NA	NA	NA
AYV52156.1\|406320_406647_+	DNA replication initiation control protein YabA	NA	NA	NA	NA
AYV52157.1\|406646_407522_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	8.7e-99	65.4

DBSCAN-SWA_5

444572 : 520484

108

Lactococcus_phage(90.91%)

terminase,tail,protease,tRNA,capsid,holin,head,integrase,portal

attL 502594:502622|attR 517744:517772

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53986.1\|444572_444998_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AYV52187.1\|444994_445513_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYV52188.1\|445616_447002_+	LytR family transcriptional regulator	NA	NA	NA	NA
AYV52189.1\|447233_448367_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.8e-214	100.0
AYV52190.1\|448489_449068_-	SHOCT domain-containing protein	Q9AZQ9	Lactococcus_phage	9.8e-99	100.0
AYV52191.1\|449151_449988_-	helix-turn-helix domain-containing protein	Q9AZQ8	Lactococcus_phage	6.0e-158	100.0
AYV52192.1\|450204_450387_+	hypothetical protein	A0A1B1IMU6	Lactococcus_phage	5.0e-25	96.6
AYV52193.1\|450418_450652_+	hypothetical protein	Q9AZQ6	Lactococcus_phage	5.0e-38	100.0
AYV52194.1\|450760_450910_+	hypothetical protein	Q9AZQ5	Lactococcus_phage	9.1e-17	100.0
AYV52195.1\|451004_451412_+	transcriptional regulator	Q77JL3	Lactococcus_phage	1.2e-37	100.0
AYV52196.1\|451423_452179_+	transporter	Q9AZQ4	Lactococcus_phage	1.1e-139	100.0
AYV52197.1\|452191_452521_+	DUF771 domain-containing protein	Q9AZQ3	Lactococcus_phage	8.1e-58	100.0
AYV52198.1\|452521_452692_+	hypothetical protein	A0A1P8BME6	Lactococcus_phage	8.7e-24	100.0
AYV52199.1\|452735_452909_+	hypothetical protein	Q9AZQ1	Lactococcus_phage	8.0e-25	100.0
AYV52200.1\|453007_453814_+	recombinase RecT	Q9AZQ0	Lactococcus_phage	6.2e-144	100.0
AYV52201.1\|453813_454590_+	hypothetical protein	Q9AZP9	Lactococcus_phage	2.6e-147	100.0
AYV52202.1\|454817_455594_+	replisome organizer	Q9AZP8	Lactococcus_phage	2.0e-131	100.0
AYV52203.1\|455603_456488_+	ATP-binding protein	Q9AZP7	Lactococcus_phage	1.6e-164	100.0
AYV52204.1\|456484_456649_+	hypothetical protein	Q9AZP6	Lactococcus_phage	2.5e-23	100.0
AYV52205.1\|456572_457049_+	hypothetical protein	Q9AZP5	Lactococcus_phage	7.3e-76	99.3
AYV52206.1\|457156_457321_+	hypothetical protein	Q9AZP4	Lactococcus_phage	4.9e-24	100.0
AYV52207.1\|457295_457658_+	DUF658 domain-containing protein	Q9AZP3	Lactococcus_phage	1.5e-60	100.0
AYV52208.1\|457851_458058_+	DUF1125 domain-containing protein	Q9MC26	Lactococcus_phage	2.6e-30	100.0
AYV52209.1\|458050_458323_+	hypothetical protein	Q9AYV0	Lactococcus_phage	5.3e-47	100.0
AYV52210.1\|458319_458874_+	DUF1642 domain-containing protein	Q9AYU5	Lactococcus_phage	1.6e-103	100.0
AYV52211.1\|458870_459290_+	dUTP diphosphatase	Q9AZP1	Lactococcus_phage	3.0e-73	100.0
AYV52212.1\|459289_459580_+	hypothetical protein	Q9AZP0	Lactococcus_phage	2.5e-47	100.0
AYV52213.1\|459576_459741_+	hypothetical protein	Q9AZN9	Lactococcus_phage	4.9e-24	100.0
AYV52214.1\|459789_459933_+	hypothetical protein	Q9AZN8	Lactococcus_phage	2.1e-18	100.0
AYV52215.1\|459929_460112_+	hypothetical protein	Q9AZN7	Lactococcus_phage	1.8e-30	100.0
AYV53987.1\|460178_460286_+	hypothetical protein	Q8LTM0	Lactococcus_phage	1.7e-09	94.3
AYV52216.1\|460293_460479_+	hypothetical protein	Q9AZN6	Lactococcus_phage	1.6e-26	100.0
AYV52217.1\|460531_460741_-	hypothetical protein	NA	NA	NA	NA
AYV52218.1\|460953_461247_+	DUF1359 domain-containing protein	Q9AZN4	Lactococcus_phage	9.7e-47	100.0
AYV52219.1\|461358_461604_+	XRE family transcriptional regulator	Q9AZN3	Lactococcus_phage	4.5e-37	100.0
AYV52220.1\|461648_462038_+	DUF1359 domain-containing protein	Q9AZN2	Lactococcus_phage	5.8e-63	100.0
AYV53988.1\|462039_462438_+	hypothetical protein	Q9AZN1	Lactococcus_phage	2.4e-64	100.0
AYV52221.1\|462434_462587_+	hypothetical protein	NA	NA	NA	NA
AYV52222.1\|462763_463186_+	DUF722 domain-containing protein	Q9AZM9	Lactococcus_phage	8.5e-52	100.0
AYV52223.1\|463423_463927_+	HNH endonuclease	Q9AZM8	Lactococcus_phage	3.1e-93	100.0
AYV52224.1\|464043_464496_+\|terminase	phage terminase small subunit P27 family	Q9AZM7	Lactococcus_phage	1.3e-82	100.0
AYV52225.1\|464495_466310_+\|terminase	terminase large subunit	Q9AZM6	Lactococcus_phage	0.0e+00	100.0
AYV52226.1\|466318_466483_+	hypothetical protein	Q9AZM5	Lactococcus_phage	1.9e-20	100.0
AYV52227.1\|466479_467559_+\|portal	phage portal protein	Q9AZM4	Lactococcus_phage	2.4e-199	100.0
AYV52228.1\|467558_468146_+\|head,protease	HK97 family phage prohead protease	Q9AZM3	Lactococcus_phage	4.4e-107	100.0
AYV52229.1\|468135_469449_+\|capsid	phage major capsid protein	Q9AZM2	Lactococcus_phage	2.0e-200	100.0
AYV52230.1\|469459_469765_+	hypothetical protein	Q9AZM1	Lactococcus_phage	4.4e-50	100.0
AYV52231.1\|469751_470087_+\|head,tail	head-tail adaptor protein	Q9AZM0	Lactococcus_phage	5.9e-56	100.0
AYV52232.1\|470083_470569_+	HK97 gp10 family phage protein	Q9AZL9	Lactococcus_phage	8.8e-85	100.0
AYV52233.1\|470565_470961_+	DUF806 family protein	Q9AZL8	Lactococcus_phage	1.4e-67	100.0
AYV52234.1\|470962_471568_+	hypothetical protein	Q9AZL7	Lactococcus_phage	4.9e-109	100.0
AYV52235.1\|471627_471972_+	hypothetical protein	Q9AZL6	Lactococcus_phage	1.2e-27	100.0
AYV52236.1\|472141_475981_+	hypothetical protein	Q9AZL5	Lactococcus_phage	0.0e+00	100.0
AYV52237.1\|475983_477519_+\|tail	phage tail protein	Q9AZL3	Lactococcus_phage	4.8e-294	100.0
AYV52238.1\|477518_481844_+	hypothetical protein	Q9AZL2	Lactococcus_phage	0.0e+00	100.0
AYV52239.1\|481863_482190_+	hypothetical protein	Q9AZL1	Lactococcus_phage	3.9e-52	100.0
AYV52240.1\|482176_482464_+\|holin	phage holin	Q9AZL0	Lactococcus_phage	5.6e-47	100.0
AYV52241.1\|482463_483243_+\|holin	phage holin	Q9AZK9	Lactococcus_phage	2.1e-128	100.0
AYV52242.1\|483347_483551_-	hypothetical protein	A5GYL5	Lactococcus_phage	4.5e-27	89.6
AYV52243.1\|484224_484986_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AYV52244.1\|485018_485807_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AYV52245.1\|485855_486347_+	thiamine transporter	NA	NA	NA	NA
AYV52246.1\|486327_486870_+	TIGR01440 family protein	NA	NA	NA	NA
AYV52247.1\|486870_488007_+	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
AYV52248.1\|488241_489849_+	CTP synthetase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.0e-129	44.5
AYV52249.1\|490932_491805_-	DUF1003 domain-containing protein	NA	NA	NA	NA
AYV52250.1\|492152_492353_-	DUF2929 family protein	NA	NA	NA	NA
AYV52251.1\|492450_492930_-	nucleoside 2-deoxyribosyltransferase	A0A1D3SPR3	Enterococcus_phage	6.5e-32	47.4
AYV52252.1\|492913_493336_-	LOG family protein	A0A1D3SNB7	Enterococcus_phage	2.2e-15	41.4
AYV52253.1\|493467_494121_-	deoxynucleoside kinase	C1KFI3	Lactobacillus_virus	6.6e-51	45.9
AYV52254.1\|494600_497783_+	DNA polymerase III subunit alpha	A0A2L1IZ23	Streptomyces_phage	1.1e-122	29.2
AYV52255.1\|497813_498467_-	hemolysin III family protein	NA	NA	NA	NA
AYV52256.1\|498647_499505_+	DegV family protein	NA	NA	NA	NA
AYV52257.1\|499497_500358_+	GDSL family lipase	NA	NA	NA	NA
AYV52258.1\|500354_501566_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
AYV52259.1\|501575_502232_+	DUF2140 family protein	NA	NA	NA	NA
AYV52260.1\|502336_502612_+	DNA-binding protein HU	A7KV42	Bacillus_phage	1.6e-22	67.4
502594:502622	attL	NA	NA	NA	NA
AYV52261.1\|502721_503870_-\|integrase	site-specific integrase	Q9AZF9	Lactococcus_phage	1.4e-210	100.0
AYV52262.1\|503993_504485_-	hypothetical protein	Q9AZF8	Lactococcus_phage	3.7e-83	100.0
AYV52263.1\|504538_504835_-	hypothetical protein	Q9AZF7	Lactococcus_phage	3.3e-50	100.0
AYV52264.1\|504881_505469_-	hypothetical protein	Q9AZF6	Lactococcus_phage	3.6e-109	100.0
AYV52265.1\|505480_505849_-	XRE family transcriptional regulator	Q9AZF5	Lactococcus_phage	1.8e-66	100.0
AYV52266.1\|506142_506334_+	hypothetical protein	Q9AZF4	Lactococcus_phage	8.6e-28	100.0
AYV52267.1\|506349_506610_+	excisionase	Q9AZF3	Lactococcus_phage	8.6e-47	100.0
AYV52268.1\|506768_506963_+	DUF1655 domain-containing protein	Q9AZF2	Lactococcus_phage	1.0e-28	100.0
AYV52269.1\|506967_507393_+	hypothetical protein	Q9AZF1	Lactococcus_phage	2.6e-77	100.0
AYV52270.1\|507427_507667_+	hypothetical protein	Q9AZF0	Lactococcus_phage	3.6e-39	100.0
AYV52271.1\|507663_507918_+	hypothetical protein	Q9AZE9	Lactococcus_phage	3.7e-42	100.0
AYV52272.1\|507914_508109_+	hypothetical protein	Q9AZE8	Lactococcus_phage	2.3e-28	100.0
AYV52273.1\|508095_508422_+	HTH domain-containing protein	Q9AZE7	Lactococcus_phage	1.1e-54	100.0
AYV52274.1\|508429_509008_+	hypothetical protein	Q9AZE6	Lactococcus_phage	1.2e-91	100.0
AYV52275.1\|509000_510443_+	hypothetical protein	Q9AZE5	Lactococcus_phage	1.6e-278	100.0
AYV52276.1\|510594_511179_+	hypothetical protein	Q9AZE4	Lactococcus_phage	2.9e-106	100.0
AYV52277.1\|511355_511541_+	hypothetical protein	Q9AZE3	Lactococcus_phage	7.0e-27	100.0
AYV52278.1\|511567_512176_+	hypothetical protein	Q9AZE2	Lactococcus_phage	1.2e-102	100.0
AYV52279.1\|512184_512775_+\|head,protease	HK97 family phage prohead protease	Q9AZE1	Lactococcus_phage	9.0e-108	100.0
AYV52280.1\|512990_513320_+	hypothetical protein	Q9AZE0	Lactococcus_phage	9.3e-54	100.0
AYV52281.1\|513420_513741_+	sigma-70 family RNA polymerase sigma factor	Q9AZD9	Lactococcus_phage	3.8e-52	100.0
AYV52282.1\|514064_514337_-	hypothetical protein	NA	NA	NA	NA
AYV52283.1\|514453_514675_+	hypothetical protein	Q9AZD7	Lactococcus_phage	3.0e-32	100.0
AYV52284.1\|514843_515332_+	DUF4065 domain-containing protein	Q9AZD6	Lactococcus_phage	5.0e-88	100.0
AYV52285.1\|515297_515864_+	hypothetical protein	Q9AZD5	Lactococcus_phage	4.6e-101	100.0
AYV52286.1\|516182_516365_+	hypothetical protein	Q9AZD4	Lactococcus_phage	5.0e-25	100.0
AYV52287.1\|517112_517313_+	cold-shock protein	Q9AZD3	Lactococcus_phage	6.7e-31	100.0
AYV52288.1\|517853_518351_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
517744:517772	attR	NA	NA	NA	NA
AYV52289.1\|518497_519007_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.3e-26	42.1
AYV52290.1\|519020_519581_+	methylphosphotriester-DNA--protein-cysteine methyltransferase family protein	NA	NA	NA	NA
AYV52291.1\|519674_520484_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.2e-19	36.7

DBSCAN-SWA_6

614996 : 672971

Bacillus_phage(25.0%)

transposase,integrase,tRNA,protease

attL 634320:634379|attR 651788:651899

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV52379.1\|614996_615881_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AYV52380.1\|615963_616632_+	hypothetical protein	NA	NA	NA	NA
AYV52381.1\|616802_617699_+	SPFH domain-containing protein	A0A1V0SL90	Klosneuvirus	1.8e-35	34.8
AYV52382.1\|618073_618334_+	hypothetical protein	NA	NA	NA	NA
AYV52383.1\|618691_619615_+	ribonuclease Z	NA	NA	NA	NA
AYV52384.1\|619607_620309_+	SDR family oxidoreductase	NA	NA	NA	NA
AYV52385.1\|620475_622704_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-79	30.4
AYV52386.1\|622781_623339_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	2.6e-32	43.4
AYV52387.1\|623554_624118_+	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
AYV52388.1\|624254_625907_+	endolytic transglycosylase MltG	NA	NA	NA	NA
AYV52389.1\|625969_626440_+	transcription elongation factor GreA	NA	NA	NA	NA
AYV52390.1\|626558_627706_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.3e-46	41.0
AYV52391.1\|627779_629152_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	3.0e-53	43.1
AYV53994.1\|629351_629807_+	CtsR family transcriptional regulator	NA	NA	NA	NA
AYV52392.1\|629796_632247_+\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A223W0B1	Agrobacterium_phage	5.7e-124	34.0
AYV52393.1\|632381_632939_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
AYV52394.1\|633123_634425_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.0e-217	87.6
634320:634379	attL	NA	NA	NA	NA
AYV52395.1\|634509_635448_+\|integrase	integrase	A0A142F1N9	Bacillus_phage	5.2e-25	27.5
AYV52396.1\|635720_636488_+	hypothetical protein	NA	NA	NA	NA
AYV53995.1\|637075_637216_+	hypothetical protein	NA	NA	NA	NA
AYV52397.1\|637531_637714_+	hypothetical protein	NA	NA	NA	NA
AYV52398.1\|637735_638905_+	hypothetical protein	V9VGE4	Lactococcus_phage	1.1e-37	40.4
AYV52399.1\|640777_643765_+	type I restriction endonuclease subunit R	A0A220A398	Liberibacter_phage	5.5e-20	26.4
AYV52400.1\|643804_645352_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	1.4e-99	39.1
AYV52401.1\|645348_646572_+	restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	1.6e-34	30.7
AYV52402.1\|646592_646718_+	hypothetical protein	NA	NA	NA	NA
AYV52403.1\|646695_647775_+	hypothetical protein	NA	NA	NA	NA
AYV52404.1\|647936_648206_+	hypothetical protein	NA	NA	NA	NA
AYV53996.1\|648540_648708_+	hypothetical protein	NA	NA	NA	NA
AYV52405.1\|648973_649744_+	hypothetical protein	NA	NA	NA	NA
AYV52406.1\|650154_651266_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	4.2e-50	41.1
AYV52407.1\|651419_651509_+	hypothetical protein	NA	NA	NA	NA
AYV52408.1\|652007_652679_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-28	36.0
651788:651899	attR	NA	NA	NA	NA
AYV52409.1\|652681_653755_-	ABC transporter permease	NA	NA	NA	NA
AYV52410.1\|653766_654336_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYV52411.1\|654523_656047_-	long-chain acyl-CoA synthetase	NA	NA	NA	NA
AYV52412.1\|656291_657155_+	magnesium transporter CorA family protein	NA	NA	NA	NA
AYV52413.1\|657415_659779_+	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	9.5e-108	32.0
AYV52414.1\|659910_660570_+	dephospho-CoA kinase	NA	NA	NA	NA
AYV52415.1\|660572_661790_+	MFS transporter	NA	NA	NA	NA
AYV52416.1\|661786_661933_+	50S ribosomal protein L33	NA	NA	NA	NA
AYV52417.1\|662273_663536_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AYV52418.1\|663641_667055_+	pyruvate carboxylase	NA	NA	NA	NA
AYV52419.1\|667178_668504_+	citrate/2-methylcitrate synthase	NA	NA	NA	NA
AYV52420.1\|668500_671047_+	aconitate hydratase AcnA	NA	NA	NA	NA
AYV52421.1\|671067_672306_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
AYV52422.1\|672371_672971_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.1e-51	52.0

DBSCAN-SWA_7

999585 : 1013369

Enterococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV52702.1\|999585_1000278_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.7e-31	34.4
AYV52703.1\|1000270_1001206_+	ABC transporter permease	NA	NA	NA	NA
AYV52704.1\|1001307_1002285_-	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.4e-118	66.2
AYV52705.1\|1002634_1004803_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.0e-257	61.1
AYV52706.1\|1004938_1005361_-	protein NrdI	A0A142F1R4	Bacillus_phage	2.3e-12	37.3
AYV52707.1\|1005362_1005581_-	NrdH-redoxin	C3U2K9	Lactococcus_phage	7.6e-12	47.6
AYV52708.1\|1005754_1006396_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
AYV52709.1\|1006670_1008605_+	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	1.6e-124	43.2
AYV52710.1\|1009340_1010174_+	3'-5' exonuclease	A0A0K2SUJ2	Clostridium_phage	3.1e-21	39.4
AYV52711.1\|1010170_1010620_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYV52712.1\|1010894_1013369_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	4.2e-98	32.2

DBSCAN-SWA_8

1022027 : 1104815

115

Lactococcus_phage(76.92%)

terminase,tail,protease,tRNA,capsid,holin,head,integrase,portal

attL 1027637:1027653|attR 1072825:1072841

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV52720.1\|1022027_1023116_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	8.4e-51	38.8
AYV52721.1\|1023115_1023766_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.2e-41	43.6
AYV52722.1\|1023774_1024971_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.3e-110	51.0
AYV52723.1\|1024998_1025463_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.3e-39	53.0
AYV52724.1\|1025565_1026018_+	signal peptidase II	NA	NA	NA	NA
AYV52725.1\|1026078_1026984_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.4e-11	28.2
AYV52726.1\|1027130_1027574_+	divergent PAP2 family protein	NA	NA	NA	NA
1027637:1027653	attL	NA	NA	NA	NA
AYV52727.1\|1027713_1029336_+	hypothetical protein	NA	NA	NA	NA
AYV52728.1\|1029338_1030295_+	glycosyltransferase	I1TED8	Salmonella_phage	3.1e-49	37.5
AYV52729.1\|1030420_1031107_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	5.5e-32	33.6
AYV52730.1\|1031126_1031642_+	DUF2127 domain-containing protein	NA	NA	NA	NA
AYV52731.1\|1031645_1032971_+	sensor histidine kinase	W8CYF6	Bacillus_phage	3.4e-22	27.5
AYV52732.1\|1032977_1033634_+	phosphatase PAP2 family protein	NA	NA	NA	NA
AYV52733.1\|1033814_1035632_+	glutamine--fructose-6-phosphate aminotransferase	M1HVL7	Paramecium_bursaria_Chlorella_virus	3.5e-94	37.0
AYV52734.1\|1035762_1036443_+	DNA repair protein RadC	NA	NA	NA	NA
AYV52735.1\|1036641_1037766_-\|integrase	site-specific integrase	Q9B016	Lactococcus_phage	1.0e-213	100.0
AYV52736.1\|1037888_1038434_-	hypothetical protein	Q9B015	Lactococcus_phage	8.9e-94	100.0
AYV52737.1\|1038490_1038928_-	ImmA/IrrE family metallo-endopeptidase	Q9B014	Lactococcus_phage	1.1e-81	100.0
AYV52738.1\|1038924_1039467_-	helix-turn-helix domain-containing protein	Q9B013	Lactococcus_phage	3.1e-91	100.0
AYV52739.1\|1039634_1039853_+	DUF739 family protein	O48504	Lactococcus_phage	2.9e-35	100.0
AYV52740.1\|1039889_1040633_+	hypothetical protein	Q9B012	Lactococcus_phage	2.1e-138	100.0
AYV52741.1\|1040645_1040981_+	DUF771 domain-containing protein	Q38331	Lactococcus_phage	1.3e-58	100.0
AYV52742.1\|1041118_1041313_+	hypothetical protein	Q77JL6	Lactococcus_phage	3.0e-28	100.0
AYV52743.1\|1041309_1041585_-	hypothetical protein	Q9AYU7	Lactococcus_phage	3.5e-46	98.9
AYV52744.1\|1041687_1041903_+	DUF1408 domain-containing protein	Q9XJE1	Lactococcus_phage	3.1e-34	100.0
AYV52745.1\|1042018_1042537_+	hypothetical protein	Q9XJE3	Lactococcus_phage	6.3e-89	100.0
AYV52746.1\|1042545_1043169_+	DUF1071 domain-containing protein	Q9B009	Lactococcus_phage	1.9e-116	100.0
AYV52747.1\|1043168_1043621_+	single-stranded DNA-binding protein	Q9B008	Lactococcus_phage	4.6e-80	100.0
AYV54010.1\|1043760_1044528_+	replisome organizer	A5GYR3	Lactococcus_phage	1.7e-122	100.0
AYV52748.1\|1044527_1045253_+	hypothetical protein	Q9XJE7	Lactococcus_phage	1.8e-134	100.0
AYV52749.1\|1045249_1045639_+	RusA family crossover junction endodeoxyribonuclease	R9QLL1	Lactococcus_phage	3.2e-69	100.0
AYV52750.1\|1045641_1045836_+	hypothetical protein	Q9B005	Lactococcus_phage	6.7e-28	100.0
AYV52751.1\|1045816_1046068_+	DUF1031 domain-containing protein	Q9B004	Lactococcus_phage	1.3e-39	98.8
AYV52752.1\|1046179_1046446_+	hypothetical protein	Q9B003	Lactococcus_phage	6.3e-45	100.0
AYV52753.1\|1046467_1046647_+	DUF1497 domain-containing protein	Q9AYU3	Lactococcus_phage	9.2e-24	100.0
AYV52754.1\|1046636_1047206_+	DUF658 domain-containing protein	Q9B002	Lactococcus_phage	2.8e-90	100.0
AYV52755.1\|1047399_1047606_+	DUF1125 domain-containing protein	Q9MC26	Lactococcus_phage	2.6e-30	100.0
AYV52756.1\|1047598_1047871_+	hypothetical protein	Q9AYV0	Lactococcus_phage	5.3e-47	100.0
AYV52757.1\|1047867_1048422_+	DUF1642 domain-containing protein	Q9AYU5	Lactococcus_phage	1.6e-103	100.0
AYV52758.1\|1048418_1048838_+	dUTP diphosphatase	Q9B001	Lactococcus_phage	5.1e-73	100.0
AYV52759.1\|1048840_1049338_+	hypothetical protein	Q9B000	Lactococcus_phage	2.2e-91	100.0
AYV52760.1\|1049327_1049675_+	hypothetical protein	Q9AZZ9	Lactococcus_phage	4.5e-59	100.0
AYV52761.1\|1049696_1049861_+	hypothetical protein	Q9AZZ8	Lactococcus_phage	4.9e-24	100.0
AYV52762.1\|1049907_1050093_+	hypothetical protein	Q9AZZ7	Lactococcus_phage	2.4e-27	100.0
AYV52763.1\|1050134_1050308_+	hypothetical protein	Q9AZZ6	Lactococcus_phage	1.9e-29	100.0
AYV52764.1\|1050308_1050608_+	hypothetical protein	Q9AZZ5	Lactococcus_phage	4.8e-49	100.0
AYV52765.1\|1050604_1050787_+	hypothetical protein	Q9AZZ4	Lactococcus_phage	4.3e-29	100.0
AYV54011.1\|1050724_1050988_-	hypothetical protein	NA	NA	NA	NA
AYV52766.1\|1051150_1051444_+	DUF1359 domain-containing protein	Q9AZZ2	Lactococcus_phage	4.4e-47	100.0
AYV52767.1\|1051521_1051923_+	DUF722 domain-containing protein	Q9AZZ1	Lactococcus_phage	5.6e-69	100.0
AYV52768.1\|1052186_1052486_+	HNH endonuclease	Q9AZZ0	Lactococcus_phage	9.6e-58	100.0
AYV52769.1\|1052577_1052946_+\|terminase	P27 family phage terminase small subunit	Q9AZY9	Lactococcus_phage	1.8e-61	100.0
AYV52770.1\|1052929_1054708_+\|terminase	terminase large subunit	Q9AZY8	Lactococcus_phage	0.0e+00	100.0
AYV52771.1\|1054721_1055927_+\|portal	phage portal protein	Q9AZY7	Lactococcus_phage	3.6e-228	99.8
AYV52772.1\|1055941_1056538_+\|head,protease	HK97 family phage prohead protease	Q9AZY6	Lactococcus_phage	5.5e-105	100.0
AYV52773.1\|1056509_1057703_+\|capsid	phage major capsid protein	Q9AZY5	Lactococcus_phage	3.6e-172	100.0
AYV52774.1\|1057757_1058615_+	hypothetical protein	Q9AZY4	Lactococcus_phage	1.1e-167	100.0
AYV52775.1\|1058607_1058889_+	hypothetical protein	Q9AZY3	Lactococcus_phage	6.7e-45	100.0
AYV52776.1\|1058875_1059193_+	hypothetical protein	Q9AZY2	Lactococcus_phage	4.6e-50	99.0
AYV52777.1\|1059182_1059554_+	hypothetical protein	Q9AZY1	Lactococcus_phage	2.5e-63	100.0
AYV52778.1\|1059550_1059868_+	hypothetical protein	Q9AZY0	Lactococcus_phage	7.5e-53	100.0
AYV52779.1\|1059885_1060494_+\|tail	phage tail protein	Q9AZX9	Lactococcus_phage	3.3e-105	100.0
AYV52780.1\|1060503_1060863_+	hypothetical protein	Q9AZX8	Lactococcus_phage	2.7e-62	100.0
AYV52781.1\|1060889_1061066_+	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	1.8e-08	53.8
AYV52782.1\|1061079_1063341_+\|tail	phage tail tape measure protein	Q9AZX7	Lactococcus_phage	0.0e+00	100.0
AYV52783.1\|1063341_1064091_+\|tail	phage tail protein	Q9AZX6	Lactococcus_phage	1.5e-144	99.6
AYV52784.1\|1064087_1066772_+	hypothetical protein	Q9AZX5	Lactococcus_phage	0.0e+00	99.9
AYV52785.1\|1066784_1068386_+	DUF2479 domain-containing protein	Q9AZX4	Lactococcus_phage	0.0e+00	100.0
AYV52786.1\|1068378_1069209_+	hypothetical protein	Q9AZX3	Lactococcus_phage	3.1e-154	100.0
AYV52787.1\|1069267_1069675_+	hypothetical protein	Q9AZX2	Lactococcus_phage	2.3e-70	100.0
AYV52788.1\|1069661_1070000_+	hypothetical protein	Q9AZX1	Lactococcus_phage	1.3e-55	100.0
AYV52789.1\|1070001_1070229_+	hypothetical protein	Q9AZX0	Lactococcus_phage	1.6e-33	100.0
AYV52790.1\|1070254_1070479_+\|holin	holin	Q9AZW9	Lactococcus_phage	1.0e-32	100.0
AYV52791.1\|1070491_1070779_+\|holin	phage holin	Q9AZW8	Lactococcus_phage	9.5e-47	100.0
AYV52792.1\|1070778_1071558_+\|holin	phage holin	Q9AZW7	Lactococcus_phage	5.5e-129	100.0
AYV52793.1\|1071591_1071795_-	hypothetical protein	A5GYL5	Lactococcus_phage	3.4e-30	92.5
AYV52794.1\|1071764_1071950_+	hypothetical protein	Q77RZ6	Lactococcus_phage	4.1e-19	80.3
AYV52795.1\|1072059_1072710_-	transcriptional regulator	NA	NA	NA	NA
AYV52796.1\|1072934_1073327_+	Spx/MgsR family RNA polymerase-binding regulatory protein	NA	NA	NA	NA
1072825:1072841	attR	NA	NA	NA	NA
AYV52797.1\|1073504_1075412_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	1.6e-49	28.9
AYV52798.1\|1075600_1076401_+	hypothetical protein	NA	NA	NA	NA
AYV52799.1\|1076402_1076768_+	hypothetical protein	NA	NA	NA	NA
AYV52800.1\|1077283_1077469_+	hypothetical protein	NA	NA	NA	NA
AYV52801.1\|1077643_1078501_+	transcriptional regulator	NA	NA	NA	NA
AYV52802.1\|1078747_1079479_+	hypothetical protein	NA	NA	NA	NA
AYV52803.1\|1079491_1079671_+	hypothetical protein	NA	NA	NA	NA
AYV52804.1\|1079704_1079893_+	hypothetical protein	NA	NA	NA	NA
AYV52805.1\|1080178_1080358_+	hypothetical protein	NA	NA	NA	NA
AYV52806.1\|1080700_1081330_+	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	1.4e-05	27.4
AYV52807.1\|1081430_1082756_+	dihydroorotase	NA	NA	NA	NA
AYV52808.1\|1083162_1083831_+	DnaD domain protein	C5J987	Streptococcus_phage	1.5e-05	32.6
AYV52809.1\|1083852_1084509_+	endonuclease III	NA	NA	NA	NA
AYV52810.1\|1084501_1085194_+\|tRNA	tRNA (adenine-N(1))-methyltransferase	NA	NA	NA	NA
AYV52811.1\|1085190_1085964_+	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AYV52812.1\|1086002_1086368_-	hypothetical protein	NA	NA	NA	NA
AYV52813.1\|1086489_1087305_-	sugar-phosphatase	NA	NA	NA	NA
AYV52814.1\|1087351_1088713_-	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	1.2e-25	34.3
AYV52815.1\|1088881_1089289_+	DUF1934 domain-containing protein	NA	NA	NA	NA
AYV52816.1\|1089281_1090457_+	DUF998 domain-containing protein	NA	NA	NA	NA
AYV52817.1\|1090626_1090941_+	50S ribosomal protein L21	NA	NA	NA	NA
AYV52818.1\|1090943_1091279_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
AYV52819.1\|1091280_1091565_+	50S ribosomal protein L27	NA	NA	NA	NA
AYV52820.1\|1093130_1094099_+	phosphate starvation-inducible protein PhoH	H6X2N1	Pseudomonas_phage	5.9e-48	50.5
AYV52821.1\|1094156_1094636_+	NUDIX domain-containing protein	NA	NA	NA	NA
AYV52822.1\|1094787_1095276_+	endoribonuclease YbeY	NA	NA	NA	NA
AYV52823.1\|1095259_1095715_+	diacylglycerol kinase	NA	NA	NA	NA
AYV52824.1\|1095728_1096307_+	nucleotidyltransferase family protein	NA	NA	NA	NA
AYV54012.1\|1096340_1096991_-	ComF family protein	NA	NA	NA	NA
AYV52825.1\|1096987_1098310_-	DNA/RNA helicase	A0A1X9I5S6	Streptococcus_phage	4.5e-115	51.3
AYV52826.1\|1098366_1098996_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	7.2e-55	53.0
AYV52827.1\|1099129_1099627_+	VanZ family protein	NA	NA	NA	NA
AYV52828.1\|1099674_1100694_+	DUF475 domain-containing protein	K4JUR1	Caulobacter_phage	1.1e-55	43.5
AYV52829.1\|1100803_1101556_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
AYV52830.1\|1101840_1102794_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AYV52831.1\|1102793_1104815_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA

DBSCAN-SWA_9

1395767 : 1460496

Lactococcus_phage(90.91%)

integrase,terminase,tail,head,protease,capsid,holin,transposase,portal

attL 1415359:1415418|attR 1457114:1457186

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53081.1\|1395767_1396715_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
AYV53082.1\|1396674_1397082_-	hypothetical protein	NA	NA	NA	NA
AYV53083.1\|1397132_1397567_-	hypothetical protein	NA	NA	NA	NA
AYV53084.1\|1397579_1398161_-	hypothetical protein	NA	NA	NA	NA
AYV53085.1\|1398357_1401552_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
AYV53086.1\|1401863_1402337_-	glutathione peroxidase	NA	NA	NA	NA
AYV53087.1\|1402519_1403149_+	N-acetyl-muramidase	A0A0K2CP65	Brevibacillus_phage	1.5e-28	46.3
AYV53088.1\|1403190_1405827_-	Calcium-transporting ATPase 1	A0A1J0FA34	Only_Syngen_Nebraska_virus	4.5e-90	30.8
AYV53089.1\|1406084_1406810_-	DNA integration/recombination/inversion protein	NA	NA	NA	NA
AYV53090.1\|1407027_1407597_-	hypothetical protein	NA	NA	NA	NA
AYV53091.1\|1407737_1408553_-	hypothetical protein	NA	NA	NA	NA
AYV53092.1\|1409063_1409618_+	DUF1211 domain-containing protein	NA	NA	NA	NA
AYV53093.1\|1409800_1410559_+	pilus assembly protein	NA	NA	NA	NA
AYV53094.1\|1410624_1410978_-	DUF1304 domain-containing protein	NA	NA	NA	NA
AYV53095.1\|1411074_1411503_-	universal stress protein	NA	NA	NA	NA
AYV53096.1\|1411813_1412215_-	arsenate reductase (thioredoxin)	A0A2H4PQT9	Staphylococcus_phage	2.4e-27	48.8
AYV53097.1\|1414181_1414712_-	hypothetical protein	NA	NA	NA	NA
AYV53098.1\|1414900_1415134_+	hypothetical protein	NA	NA	NA	NA
1415359:1415418	attL	NA	NA	NA	NA
AYV53099.1\|1415880_1416084_+	hypothetical protein	A5GYL5	Lactococcus_phage	2.5e-33	100.0
AYV53100.1\|1416117_1416897_-\|holin	phage holin	Q9AZR1	Lactococcus_phage	6.1e-128	100.0
AYV53101.1\|1416896_1417196_-\|holin	phage holin	Q9AZR2	Lactococcus_phage	1.3e-46	100.0
AYV53102.1\|1417221_1418784_-	DUF2479 domain-containing protein	Q9AZR3	Lactococcus_phage	4.0e-256	100.0
AYV53103.1\|1418795_1419020_-\|holin	holin	Q9AZR4	Lactococcus_phage	6.1e-33	100.0
AYV53104.1\|1419039_1421472_-	hypothetical protein	Q9AZR5	Lactococcus_phage	0.0e+00	100.0
AYV53105.1\|1421449_1421623_-	hypothetical protein	Q9AZR6	Lactococcus_phage	8.0e-25	100.0
AYV53106.1\|1421622_1422744_-	hypothetical protein	Q9AZR7	Lactococcus_phage	3.1e-194	99.7
AYV53107.1\|1422759_1424547_-	hypothetical protein	Q9AZR8	Lactococcus_phage	0.0e+00	100.0
AYV53108.1\|1424546_1426082_-\|tail	phage tail protein	Q9AZR9	Lactococcus_phage	2.1e-294	100.0
AYV53109.1\|1426084_1431007_-\|tail	phage tail tape measure protein	Q9AZS0	Lactococcus_phage	0.0e+00	100.0
AYV53110.1\|1431231_1431651_-	hypothetical protein	Q9AZS1	Lactococcus_phage	1.9e-67	100.0
AYV53111.1\|1431795_1432389_-\|tail	phage tail protein	Q9AZS2	Lactococcus_phage	3.8e-106	100.0
AYV53112.1\|1432419_1432815_-	DUF806 family protein	Q9AZS3	Lactococcus_phage	3.9e-67	100.0
AYV53113.1\|1432811_1433318_-	hypothetical protein	Q9AZS4	Lactococcus_phage	3.6e-89	100.0
AYV53114.1\|1433319_1433670_-\|tail	phage tail protein	Q9AZS5	Lactococcus_phage	2.5e-57	100.0
AYV53115.1\|1433644_1433968_-\|head,tail	phage gp6-like head-tail connector protein	Q9AZS6	Lactococcus_phage	6.3e-55	100.0
AYV53116.1\|1433983_1435210_-\|capsid	phage major capsid protein	Q9AZS7	Lactococcus_phage	4.6e-223	99.8
AYV53117.1\|1435221_1435929_-\|protease	Clp protease ClpP	Q9AZS8	Lactococcus_phage	1.4e-120	100.0
AYV53118.1\|1435971_1437150_-\|portal	phage portal protein	Q77P35	Lactococcus_phage	3.1e-224	100.0
AYV53119.1\|1437146_1437356_-	DUF1056 family protein	Q9AZT0	Lactococcus_phage	3.8e-29	100.0
AYV53120.1\|1437324_1439298_-\|terminase	terminase large subunit	Q9AZT1	Lactococcus_phage	0.0e+00	100.0
AYV53121.1\|1439284_1439758_-\|terminase	phage terminase small subunit P27 family	Q9AZT2	Lactococcus_phage	5.9e-86	100.0
AYV53122.1\|1439886_1440402_-	HNH endonuclease	Q9AZT3	Lactococcus_phage	2.3e-99	100.0
AYV53123.1\|1440403_1440709_-	hypothetical protein	Q9AZT4	Lactococcus_phage	1.1e-35	100.0
AYV53124.1\|1440856_1441279_-	DUF722 domain-containing protein	Q9AZT6	Lactococcus_phage	1.5e-51	100.0
AYV53125.1\|1441356_1441716_-	hypothetical protein	Q9AZT7	Lactococcus_phage	1.3e-56	100.0
AYV53126.1\|1441840_1441996_-	hypothetical protein	Q9AZT8	Lactococcus_phage	1.5e-22	100.0
AYV54020.1\|1442003_1442111_-	hypothetical protein	A0A1P8BKA2	Lactococcus_phage	7.7e-10	94.3
AYV53127.1\|1442176_1442371_-	hypothetical protein	Q9AZT9	Lactococcus_phage	5.6e-35	100.0
AYV53128.1\|1442367_1442511_-	hypothetical protein	A0A1P8BMD9	Lactococcus_phage	2.1e-18	100.0
AYV53129.1\|1442529_1442865_-	DUF1140 family protein	Q9AZU1	Lactococcus_phage	5.9e-56	99.1
AYV53130.1\|1442886_1443231_-	hypothetical protein	Q9AZU2	Lactococcus_phage	1.4e-60	99.1
AYV53131.1\|1443234_1443654_-	dUTP diphosphatase	Q9AZU3	Lactococcus_phage	2.3e-73	100.0
AYV53132.1\|1443650_1443938_-	hypothetical protein	Q9AZU4	Lactococcus_phage	2.9e-51	100.0
AYV53133.1\|1443934_1444591_-	DUF1642 domain-containing protein	Q9AZU5	Lactococcus_phage	5.1e-120	100.0
AYV53134.1\|1444562_1444922_-	hypothetical protein	Q9AZU6	Lactococcus_phage	8.2e-64	100.0
AYV53135.1\|1444930_1445440_-	hypothetical protein	Q9AZU7	Lactococcus_phage	1.1e-26	100.0
AYV53136.1\|1445454_1446027_-	DUF658 domain-containing protein	Q9AZU8	Lactococcus_phage	8.7e-92	100.0
AYV53137.1\|1446016_1446196_-	DUF1497 domain-containing protein	Q9AYU3	Lactococcus_phage	9.2e-24	100.0
AYV53138.1\|1446217_1446508_-	hypothetical protein	Q9AZU9	Lactococcus_phage	1.2e-49	100.0
AYV53139.1\|1446619_1446859_-	DUF1031 domain-containing protein	Q9AZV0	Lactococcus_phage	2.3e-38	100.0
AYV53140.1\|1446851_1447346_-	hypothetical protein	Q9AZV1	Lactococcus_phage	5.2e-93	100.0
AYV53141.1\|1447342_1447717_-	DUF1064 domain-containing protein	Q9AZV2	Lactococcus_phage	9.5e-63	100.0
AYV53142.1\|1447697_1447871_-	hypothetical protein	Q9AZV3	Lactococcus_phage	4.7e-25	100.0
AYV53143.1\|1447867_1448752_-	ATP-binding protein	A0A059NT94	Lactococcus_phage	3.9e-163	99.3
AYV53144.1\|1448761_1449601_-	DUF4373 domain-containing protein	Q9AZV5	Lactococcus_phage	5.7e-132	100.0
AYV53145.1\|1449728_1450154_-	single-stranded DNA-binding protein	Q9AZV6	Lactococcus_phage	7.2e-75	100.0
AYV53146.1\|1450146_1450905_-	hypothetical protein	Q9AZV7	Lactococcus_phage	2.5e-147	100.0
AYV53147.1\|1450913_1451309_-	hypothetical protein	Q9AZV8	Lactococcus_phage	8.5e-70	100.0
AYV53148.1\|1451423_1451639_-	DUF1408 domain-containing protein	Q38272	Lactococcus_phage	2.4e-34	100.0
AYV53149.1\|1451741_1452017_+	hypothetical protein	Q9AYU7	Lactococcus_phage	1.6e-46	100.0
AYV53150.1\|1452013_1452208_-	hypothetical protein	Q77JL6	Lactococcus_phage	3.0e-28	100.0
AYV53151.1\|1452350_1452641_-	hypothetical protein	Q9AZW0	Lactococcus_phage	9.3e-50	100.0
AYV53152.1\|1452653_1453364_-	phage antirepressor Ant	Q9AZW1	Lactococcus_phage	3.8e-129	99.6
AYV53153.1\|1453377_1453617_-	XRE family transcriptional regulator	A0A1B1IMF0	Lactococcus_phage	1.5e-37	100.0
AYV53154.1\|1453782_1454304_+	helix-turn-helix domain-containing protein	Q9AZW3	Lactococcus_phage	1.3e-86	99.4
AYV53155.1\|1454313_1454901_+	hypothetical protein	Q9AZW4	Lactococcus_phage	6.8e-108	100.0
AYV53156.1\|1454965_1455817_+	hypothetical protein	Q9AZW5	Lactococcus_phage	1.2e-89	100.0
AYV53157.1\|1455939_1457019_+\|integrase	site-specific integrase	Q9AZW6	Lactococcus_phage	2.5e-204	100.0
AYV53158.1\|1457723_1458059_-	putative DNA-binding protein	NA	NA	NA	NA
1457114:1457186	attR	NA	NA	NA	NA
AYV53159.1\|1458242_1458953_+	DNA-binding response regulator	A0A1V0SGR9	Hokovirus	3.5e-05	29.1
AYV53160.1\|1458942_1460496_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.1e-32	39.1

DBSCAN-SWA_10

1559029 : 1569330

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53238.1\|1559029_1560586_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.3e-70	45.6
AYV53239.1\|1560761_1561304_-	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	1.8e-09	29.9
AYV53240.1\|1561440_1562478_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
AYV53241.1\|1562608_1563139_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYV53242.1\|1563189_1564779_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.0e-09	22.2
AYV53243.1\|1564945_1565494_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	2.8e-18	31.1
AYV53244.1\|1565521_1566538_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	6.4e-61	40.4
AYV53245.1\|1566726_1569330_-	chaperone protein ClpB	K4FB40	Cronobacter_phage	9.4e-125	32.8

DBSCAN-SWA_11

1771198 : 1781057

Prochlorococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53426.1\|1771198_1771960_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-17	30.0
AYV53427.1\|1772125_1772935_-	phosphate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.0e-10	26.5
AYV53428.1\|1772968_1773862_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
AYV53429.1\|1773861_1774785_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AYV53430.1\|1774905_1775757_-	phosphate ABC transporter substrate-binding protein PstS family protein	E3SNT9	Prochlorococcus_phage	4.2e-05	27.3
AYV53431.1\|1776103_1777000_-	phosphate ABC transporter substrate-binding protein	E3SM63	Prochlorococcus_phage	7.2e-08	32.4
AYV53432.1\|1777277_1777745_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.7e-43	56.6
AYV53433.1\|1777776_1778352_-	esterase	NA	NA	NA	NA
AYV53434.1\|1778438_1781057_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.1e-64	33.7

DBSCAN-SWA_12

1977997 : 2031422

Lactococcus_phage(70.37%)

bacteriocin,protease,tRNA,transposase,integrase

attL 2011319:2011339|attR 2025808:2025828

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53618.1\|1977997_1978945_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
AYV53619.1\|1979472_1980369_-	fructose-bisphosphate aldolase	NA	NA	NA	NA
AYV53620.1\|1986435_1987095_-	trimeric intracellular cation channel family protein	NA	NA	NA	NA
AYV53621.1\|1987201_1989142_-\|tRNA	threonine--tRNA ligase	A0A1V0SKZ9	Klosneuvirus	1.4e-64	32.5
AYV53622.1\|1989685_1990003_-	ribonucleotide reductase	NA	NA	NA	NA
AYV53623.1\|1991428_1992037_-	nitroreductase family protein	NA	NA	NA	NA
AYV53624.1\|1992178_1992814_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AYV53625.1\|1993039_1994179_-	cation:proton antiporter	NA	NA	NA	NA
AYV53626.1\|1994233_1995397_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AYV53627.1\|1995643_1996732_-	cystathionine gamma-synthase	NA	NA	NA	NA
AYV53628.1\|1996762_1997728_-	homoserine O-succinyltransferase	NA	NA	NA	NA
AYV53629.1\|1997877_1998438_-	NUDIX domain-containing protein	NA	NA	NA	NA
AYV54040.1\|1998446_1999163_-	AEC family transporter	NA	NA	NA	NA
AYV53630.1\|1999162_1999354_-	hypothetical protein	NA	NA	NA	NA
AYV53631.1\|1999489_2000359_-	aldose 1-epimerase family protein	NA	NA	NA	NA
AYV53632.1\|2000672_2001617_-	HD domain-containing protein	NA	NA	NA	NA
AYV53633.1\|2001863_2003168_-	DNA recombination protein RmuC	NA	NA	NA	NA
AYV53634.1\|2003259_2003910_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AYV53635.1\|2003968_2004226_-	hypothetical protein	NA	NA	NA	NA
AYV53636.1\|2004222_2004483_-	hypothetical protein	NA	NA	NA	NA
AYV53637.1\|2004454_2005378_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
AYV53638.1\|2005437_2006502_-\|protease	aspartate protease	A0A217EQJ4	Bacillus_phage	1.8e-18	55.8
AYV53639.1\|2006728_2009122_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AYV53640.1\|2009158_2010199_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	1.9e-28	34.3
AYV53641.1\|2010652_2011186_+	phenolic acid decarboxylase	NA	NA	NA	NA
2011319:2011339	attL	NA	NA	NA	NA
AYV53642.1\|2011497_2012445_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
AYV53643.1\|2013756_2014677_-	DUF4065 domain-containing protein	Q9AZG0	Lactococcus_phage	1.6e-172	99.7
AYV53644.1\|2014688_2014985_-	hypothetical protein	Q9AZG1	Lactococcus_phage	1.6e-49	100.0
AYV53645.1\|2015173_2015395_-	hypothetical protein	Q9AZD7	Lactococcus_phage	2.5e-31	97.3
AYV53646.1\|2015544_2015775_-	hypothetical protein	Q9AZG3	Lactococcus_phage	1.5e-39	100.0
AYV53647.1\|2015917_2016424_-	GNAT family N-acetyltransferase	Q9AZG4	Lactococcus_phage	4.2e-90	100.0
AYV53648.1\|2017022_2017970_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
AYV53649.1\|2018057_2018420_-	hypothetical protein	Q9AZG6	Lactococcus_phage	3.4e-57	100.0
AYV53650.1\|2018436_2019009_-	hypothetical protein	Q9AZG7	Lactococcus_phage	2.1e-98	100.0
AYV53651.1\|2019170_2019377_-	hypothetical protein	Q9AZG9	Lactococcus_phage	1.6e-32	100.0
AYV53652.1\|2019395_2019578_-	hypothetical protein	Q9AZH0	Lactococcus_phage	1.4e-27	100.0
AYV53653.1\|2019946_2020261_-	hypothetical protein	Q9AZH1	Lactococcus_phage	3.4e-53	100.0
AYV53654.1\|2020173_2021643_-	hypothetical protein	Q9AZH2	Lactococcus_phage	3.2e-279	100.0
AYV53655.1\|2021653_2021923_-	hypothetical protein	Q9AZH3	Lactococcus_phage	1.3e-40	100.0
AYV53656.1\|2021919_2022072_-	hypothetical protein	Q9AZH4	Lactococcus_phage	1.4e-20	100.0
AYV53657.1\|2022159_2022324_-	hypothetical protein	Q9AZH5	Lactococcus_phage	2.1e-22	100.0
AYV53658.1\|2022325_2022496_-	DUF1655 domain-containing protein	Q9AZH6	Lactococcus_phage	4.6e-25	100.0
AYV53659.1\|2022575_2022701_-	hypothetical protein	Q9AZH7	Lactococcus_phage	2.1e-14	100.0
AYV53660.1\|2022734_2023250_-	hypothetical protein	Q9AZH8	Lactococcus_phage	4.2e-93	100.0
AYV53661.1\|2023364_2023571_-	transcriptional regulator	NA	NA	NA	NA
AYV53662.1\|2023719_2024427_+	XRE family transcriptional regulator	Q9AZH9	Lactococcus_phage	1.8e-123	100.0
AYV53663.1\|2024507_2025707_+\|integrase	site-specific integrase	Q9AZI0	Lactococcus_phage	1.4e-224	100.0
AYV53664.1\|2025910_2026450_+	PadR family transcriptional regulator	NA	NA	NA	NA
2025808:2025828	attR	NA	NA	NA	NA
AYV53665.1\|2026616_2028095_+	chitinase	NA	NA	NA	NA
AYV53666.1\|2028114_2028777_+	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	1.2e-15	31.2
AYV53667.1\|2028819_2030112_-	adenylosuccinate synthase	L7Y4J5	Megavirus	1.7e-74	38.1
AYV53668.1\|2030384_2031005_-	cadmium transporter	NA	NA	NA	NA
AYV53669.1\|2031263_2031422_-\|bacteriocin	bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_13

2083137 : 2148300

unidentified_phage(20.0%)

transposase,protease,tRNA,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53715.1\|2083137_2084085_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-33	33.0
AYV53716.1\|2084105_2084315_-	hypothetical protein	NA	NA	NA	NA
AYV53717.1\|2084350_2084869_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AYV53718.1\|2085043_2085901_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
AYV53719.1\|2085946_2086405_-	N-acetyltransferase	NA	NA	NA	NA
AYV53720.1\|2086497_2087055_-	ribosome recycling factor	NA	NA	NA	NA
AYV53721.1\|2087266_2087983_-	UMP kinase	NA	NA	NA	NA
AYV53722.1\|2088067_2088520_-	hypothetical protein	NA	NA	NA	NA
AYV53723.1\|2088653_2089841_-	acetate kinase	NA	NA	NA	NA
AYV53724.1\|2089997_2091185_-	acetate kinase	NA	NA	NA	NA
AYV53725.1\|2091379_2092318_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYV53726.1\|2092405_2092657_-	DUF3165 family protein	NA	NA	NA	NA
AYV53727.1\|2092753_2094595_-	translational GTPase TypA	A0A1S5SF82	Streptococcus_phage	1.2e-17	35.4
AYV53728.1\|2094773_2095232_-	hypothetical protein	NA	NA	NA	NA
AYV53729.1\|2095247_2096021_-	hypothetical protein	NA	NA	NA	NA
AYV53730.1\|2096357_2096984_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.7e-19	34.5
AYV53731.1\|2096984_2098967_-\|bacteriocin	bacteriocin-associated integral membrane family protein	NA	NA	NA	NA
AYV53732.1\|2098970_2099297_-\|bacteriocin	lactococcin 972 family bacteriocin	NA	NA	NA	NA
AYV53733.1\|2099596_2100325_-	LytTR family transcriptional regulator	NA	NA	NA	NA
AYV53734.1\|2100517_2100739_+	DUF910 family protein	NA	NA	NA	NA
AYV53735.1\|2100772_2101744_+	ROK family glucokinase	NA	NA	NA	NA
AYV53736.1\|2101746_2102133_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
AYV53737.1\|2102215_2102662_-	DNA starvation/stationary phase protection protein	A0A2K9VCK5	Lactobacillus_phage	6.5e-18	34.2
AYV53738.1\|2102799_2103911_-\|transposase	IS3-like element IS981 family transposase	A0A1P8CWQ3	Bacillus_phage	1.2e-49	41.4
AYV53739.1\|2104055_2104721_+	prepilin peptidase	NA	NA	NA	NA
AYV53740.1\|2104671_2105763_-	DNA polymerase IV	NA	NA	NA	NA
AYV53741.1\|2105841_2106333_-\|tRNA	prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
AYV53742.1\|2106411_2107905_-	amino acid permease	NA	NA	NA	NA
AYV53743.1\|2108096_2109227_-	aminotransferase	NA	NA	NA	NA
AYV53744.1\|2109490_2110435_-	carbamate kinase	NA	NA	NA	NA
AYV53745.1\|2110466_2111411_-	carbamate kinase	NA	NA	NA	NA
AYV53746.1\|2111427_2113008_-	amino acid permease	NA	NA	NA	NA
AYV53747.1\|2113138_2114203_-	ornithine carbamoyltransferase	NA	NA	NA	NA
AYV53748.1\|2114386_2115619_-	arginine deiminase	NA	NA	NA	NA
AYV53749.1\|2115685_2115883_+	hypothetical protein	NA	NA	NA	NA
AYV53750.1\|2115920_2117615_-\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.1e-80	34.8
AYV53751.1\|2117682_2118141_+	arginine repressor	NA	NA	NA	NA
AYV54046.1\|2118323_2119655_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AYV53752.1\|2119857_2120451_-	hypothetical protein	NA	NA	NA	NA
AYV53753.1\|2120666_2123771_-	helicase	A0A2L1IWL4	Gordonia_phage	5.3e-42	30.1
AYV53754.1\|2124024_2128377_-	VWA domain-containing protein	NA	NA	NA	NA
AYV53755.1\|2128799_2130503_-	pyruvate oxidase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	1.9e-33	27.2
AYV53756.1\|2130699_2131686_-	serine hydrolase	NA	NA	NA	NA
AYV53757.1\|2131758_2132538_-	proteinase	NA	NA	NA	NA
AYV53758.1\|2132891_2133677_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYV53759.1\|2133719_2134589_-	aquaporin family protein	NA	NA	NA	NA
AYV53760.1\|2134760_2137052_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
AYV53761.1\|2137053_2137764_+	gamma-glutamyl-gamma-aminobutyrate hydrolase	H9D1C6	Salinivibrio_phage	5.2e-09	31.8
AYV53762.1\|2137913_2138756_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AYV53763.1\|2140274_2141726_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AYV53764.1\|2141889_2142420_-	cysteine hydrolase	NA	NA	NA	NA
AYV53765.1\|2142518_2143442_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AYV53766.1\|2143670_2144165_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYV53767.1\|2144256_2144580_-	DUF1048 domain-containing protein	NA	NA	NA	NA
AYV53768.1\|2144566_2144914_-	DUF1048 domain-containing protein	NA	NA	NA	NA
AYV53769.1\|2144900_2145263_-	PadR family transcriptional regulator	NA	NA	NA	NA
AYV53770.1\|2145382_2146012_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
AYV53771.1\|2146076_2147162_-	PIN/TRAM domain-containing protein	NA	NA	NA	NA
AYV53772.1\|2147352_2148300_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-33	33.0

DBSCAN-SWA_14

2196208 : 2268606

unidentified_phage(18.18%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYV53834.1\|2196208_2198059_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AYV53835.1\|2198128_2199415_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AYV53836.1\|2199433_2200237_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AYV53837.1\|2200236_2200971_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	5.9e-16	37.0
AYV53838.1\|2201342_2201675_-	preprotein translocase subunit YajC	NA	NA	NA	NA
AYV53839.1\|2202485_2202965_-	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AYV53840.1\|2203003_2203951_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-32	33.0
AYV53841.1\|2204420_2205647_+\|protease	serine protease	A0A1B1IRD3	uncultured_Mediterranean_phage	4.9e-07	26.3
AYV53842.1\|2205772_2206771_+	glycosyltransferase	NA	NA	NA	NA
AYV53843.1\|2206896_2208237_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
AYV53844.1\|2208344_2208569_+	DUF1797 family protein	NA	NA	NA	NA
AYV53845.1\|2208710_2209715_+	hypothetical protein	NA	NA	NA	NA
AYV53846.1\|2209755_2210508_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
AYV53847.1\|2210854_2213488_-	DNA polymerase I	A0A068EMS7	Bacillus_phage	7.7e-50	31.4
AYV53848.1\|2213725_2214535_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AYV53849.1\|2215024_2216172_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.3e-46	41.0
AYV53850.1\|2216244_2217617_-\|transposase	IS3-like element ISLla3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-55	43.8
AYV53851.1\|2217658_2218192_+	hypothetical protein	NA	NA	NA	NA
AYV53852.1\|2223609_2224101_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AYV53853.1\|2224358_2226089_-	septation ring formation regulator EzrA	NA	NA	NA	NA
AYV53854.1\|2226274_2227303_-	elongation factor Ts	NA	NA	NA	NA
AYV53855.1\|2227424_2228192_-	30S ribosomal protein S2	NA	NA	NA	NA
AYV53856.1\|2228550_2229576_+	hypothetical protein	NA	NA	NA	NA
AYV53857.1\|2229808_2232520_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
AYV53858.1\|2232857_2233355_-	hypothetical protein	NA	NA	NA	NA
AYV53859.1\|2233341_2233551_-	hypothetical protein	NA	NA	NA	NA
AYV53860.1\|2233547_2234375_-	radical SAM protein	NA	NA	NA	NA
AYV53861.1\|2234367_2236491_-	radical SAM protein	NA	NA	NA	NA
AYV53862.1\|2236593_2237451_-	transcriptional regulator	A0A1X9I6E0	Streptococcus_phage	2.3e-11	28.7
AYV53863.1\|2237571_2238600_-	PDZ domain-containing protein	NA	NA	NA	NA
AYV53864.1\|2238586_2239084_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.9e-16	31.4
AYV53865.1\|2239131_2239698_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
AYV53866.1\|2239841_2241062_-	MFS transporter	NA	NA	NA	NA
AYV53867.1\|2241145_2242372_-	multidrug efflux MFS transporter LmrP	NA	NA	NA	NA
AYV53868.1\|2242559_2243054_+	RNA polymerase sigma factor	NA	NA	NA	NA
AYV53869.1\|2243077_2244184_+	anti-sigma factor	NA	NA	NA	NA
AYV53870.1\|2244279_2245626_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
AYV53871.1\|2245969_2246476_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
AYV53872.1\|2246509_2247355_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AYV53873.1\|2247581_2247860_+	transcriptional regulator	NA	NA	NA	NA
AYV53874.1\|2247972_2248305_+	hypothetical protein	NA	NA	NA	NA
AYV53875.1\|2248348_2250991_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	2.0e-151	41.2
AYV53876.1\|2251246_2251903_-	elongation factor G-binding protein	NA	NA	NA	NA
AYV53877.1\|2252179_2252428_-	DUF1912 family protein	NA	NA	NA	NA
AYV53878.1\|2252466_2252811_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
AYV53879.1\|2252811_2253321_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYV53880.1\|2253475_2254183_-	hypothetical protein	NA	NA	NA	NA
AYV53881.1\|2254514_2256056_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	1.2e-71	32.7
AYV53882.1\|2256284_2259065_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AYV53883.1\|2259133_2259607_-	cell wall anchor protein	NA	NA	NA	NA
AYV53884.1\|2259892_2260705_+	regulatory protein RecX	NA	NA	NA	NA
AYV53885.1\|2267658_2268606_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.7e-31	32.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033607

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection