CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP033789	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed2, complete sequence	2 crisprs	csa3,RT,cas14j,c2c10_CAS-V-U3	2	12	3	0
CP033795	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 chromosome, complete genome	0 crisprs	WYL,DinG,csa3,cas3,RT,DEDDh,c2c9_V-U4	0	0	8	0
CP033791	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed4, complete sequence	0 crisprs	NA	0	0	0	0
CP033793	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed6, complete sequence	0 crisprs	NA	0	0	5	0
CP033796	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed8	0 crisprs	NA	0	0	0	0
CP033792	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0	0	0
CP033788	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0
CP033790	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0	1	2
CP033794	Bacillus sp. (in: Bacteria) strain FDAARGOS_527 plasmid unnamed7	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP033789_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033789_1

192890-193119

TypeV-U3,TypeI-A?

NA:V-U3

Consensus_repeat	Method
GTTAAAACATAACAATAGATGTATTGAAATT	PILER-CR
GTTAAAACATAACAATAGATGTATTGAAAT	CRISPRCasFinder
AACAATAGATGTATTGAAAT	CRT

3 spacers

c2c10_CAS-V-U3,csa3

The CRISPR arrays of CP033789_1

>merge|CP033789|1|192890-193119|PILER-CR,CRISPRCasFinder,CRT
GTTAAAACATAACAATAGATGTATTGAAATTGATCCACCTCTACAATGTGATAACGGCCATTATCCGTTAAAACATAACAATAGATGTATTGAAATTTAAGTCATTATATGACACCGTATGCTATGTGGATTGTTAAAACAGAACAATAGATGTATTGAAATCAAACAAGATTACAACTATTGAACAATGTCGTCAATCGTTAAAACAGAACAATAGATGTATTTAAAAA

>CP033789|1|1|192890-193052|PILER-CR
GTTAAAACATAACAATAGATGTATTGAAATT	GATCCACCTCTACAATGTGATAACGGCCATTATCC
GTTAAAACATAACAATAGATGTATTGAAATT	TAAGTCATTATATGACACCGTATGCTATGTGGATT
GTTAAAACAGAACAATAGATGTATTGAAATC

>CP033789|1|1|192890-193119|CRISPRCasFinder
GTTAAAACATAACAATAGATGTATTGAAAT	TGATCCACCTCTACAATGTGATAACGGCCATTATCC
GTTAAAACATAACAATAGATGTATTGAAAT	TTAAGTCATTATATGACACCGTATGCTATGTGGATT
GTTAAAACAGAACAATAGATGTATTGAAAT	CAAACAAGATTACAACTATTGAACAATGTCGTCAATC
GTTAAAACAGAACAATAGATGTATTTAAAAA

>CP033789|1|1|192900-193118|CRT
AACAATAGATGTATTGAAAT	TGATCCACCTCTACAATGTGATAACGGCCATTATCCGTTAAAACAT
AACAATAGATGTATTGAAAT	TTAAGTCATTATATGACACCGTATGCTATGTGGATTGTTAAAACAG
AACAATAGATGTATTGAAAT	CAAACAAGATTACAACTATTGAACAATGTCGTCAATCGTTAAAACAG
AACAATAGATGTATTTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP033789.1\|AYY25210.1\|198254_198692_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
CP033789.1\|AYY25207.1\|196950_197595_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214615
CP033789.1\|AYY25204.1\|191266_192628_+\|transposase	c2c10_CAS-V-U3	-	gnl\|CDD\|284650
CP033789.1\|AYY25201.1\|187916_188300_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25208.1\|197646_197850_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25205.1\|193858_196522_+\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
CP033789.1\|AYY25200.1\|187200_187791_-\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25199.1\|185916_186552_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25211.1\|198764_199058_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP033789.1\|AYY25206.1\|196696_196906_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25197.1\|184238_184952_+\|transposase	unknown	unknown	unknown
CP033789.1\|AYY25198.1\|185287_185917_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25212.1\|199365_199551_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|274101
CP033789.1\|AYY25203.1\|189311_191141_-\|DUF4365-domain-containing-protein	unknown	unknown	unknown
CP033789.1\|AYY25202.1\|188316_188955_+\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
CP033789.1\|AYY25213.1\|199742_199874_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	unknown
CP033789.1\|AYY25196.1\|180931_184222_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223627
CP033789.1\|AYY25214.1\|199870_200965_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
CP033789.1\|AYY25269.1\|186602_187181_-\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25209.1\|197923_198211_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP033789.1\|AYY25210.1\|198254_198692_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	2.24357e-36
CP033789.1\|AYY25207.1\|196950_197595_+\|hypothetical-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	1.67397e-31
CP033789.1\|AYY25204.1\|191266_192628_+\|transposase	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	3.32739e-21
CP033789.1\|AYY25202.1\|188316_188955_+\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	4.10175e-25
CP033789.1\|AYY25212.1\|199365_199551_-\|RNA-chaperone-Hfq	gnl\|CDD\|274101	TIGR02383, RNA-binding_protein_Hfq, RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see . The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication. [Regulatory functions, Other].	1.49921e-23
CP033789.1\|AYY25205.1\|193858_196522_+\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	1.77096e-130
CP033789.1\|AYY25196.1\|180931_184222_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	0.000110893
CP033789.1\|AYY25214.1\|199870_200965_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.2592e-20
CP033789.1\|AYY25211.1\|198764_199058_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.42374e-11

>CP033789.1|AYY25204.1|191266_192628_+|transposase
MTYLSTVVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQKLWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQKTIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIKENDLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGACMLHKHKKKWYLSITYKSNIKEELKFDEDLIMGIDMGKINVLYFAFNKGLVRGGISGEEIEAFRKKIEHRRISLLRQGKYCSGNRIGKGRKKRIKPIEVLNDKIAKFRNATNHKYANYIVQQCLKYNCGTIQLEDLQGISKEQTFLKNWTYFDLQEKIKNQANQYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYNIEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN
>CP033789.1|AYY25203.1|189311_191141_-|DUF4365-domain-containing-protein
MKKLNPLDNTIIEHLACLEINKCILQPPFHLQSNVQWNDKGLSFDGDINIYTNKIKKTDFIGTVPIQIKGTTKFKKIKKQQKIAHSISKEDLDVYYKNDNGVLFFVVTIHPETYVSQAYYKTLAPLDLKKLLDEIELTGQKSITVNFKKLEYGELENICKSFLNSLEKQSKRFIEDAKNIAFSQYKIEYGHVQNNVLVDLFEEQAYVYGVLNDVDFPIDIFQLQEMRKETDEIVTIGNETLRIKSVLKISKEIICLTIENSLTFEFSKKFVDGKLRLINGKVHLSKLKTLGSYVKSLKLLKYLLTYNKIPLSSFEIDTTLNEKETFKDIDENIKIHEELIQICKQIGISEDYIFDEKENLFILFNKIINIFKNKQYDLINFTPPLDKNSMVFCNIELSDYVMVTLLFDGYTAIDFFSVKAIKTMGAFLPKDGHVIDYDDANWREKIWKVSLYLNQSIENMERAANFKYEILELSFQDEHHDIDSLNSIDTHLKYISYFDEYSDEKYLKIAQDLIQRYLLKNPKDIIQKINLYQINLRLGNELSDDEINDILTIQENAQNKNDKILDYACEVLLQNRLKSKRLYESLKKDEQDTIKMYPIYHLYKNLISI
>CP033789.1|AYY25202.1|188316_188955_+|NERD-domain-containing-protein
MKVLIFELVLIAILIPLNIVVKKHVPKWKGKAGEKLVKHILNKLDSESYCVLHDVTVHTEYGDTTQIDHIVIAETGVFVIETKNYEGWIYGNEKSARWTQGIFRKKSSFQNPFRQNYKHIKAIEWLMEQQLPSISIAAFHPKCSLKRVNVQSKDKHVLYYNDLQKCIESYTETQLTNDEVQHIYQTILRANIMDKDIEKKHVKYLHNKFAKQ
>CP033789.1|AYY25201.1|187916_188300_+|hypothetical-protein
MKRNREYIALRNSILIGWLLTCIVIGLSIYFSSVVYLLIGCFILSLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIKGLCISYFILGLETHVYRLMRRNARV
>CP033789.1|AYY25200.1|187200_187791_-|hypothetical-protein
MLKLVVDNTVTEPEPKTDSAFSNYFTCKDCVYYLSKSDSCSLQLAADSNSPLIPYECGNFEETYEIGTEDPLNSHIHQRLREEKAQILDESYPAQPAIDPIHKDAIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNMSSKKYASPFPLHDHGAKEGIRHYMCWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNY
>CP033789.1|AYY25269.1|186602_187181_-|hypothetical-protein
MLEHTILFSLVQLVPLILSTGIIYILLELTDTEWKTWFSYEGIFTIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLVSIFLVFFASIPTLLKIAFILQMTVILLLLEYLCLYIDRLPIHNLYRIQEIICDKKQLKIERIILNNAEHGTHTIKTRDEQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR
>CP033789.1|AYY25199.1|185916_186552_+|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLQAAQASVKIDFNELKGNDVSSSFTDGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>CP033789.1|AYY25198.1|185287_185917_+|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLFYAAEGNEIKLKSIKPKLAGDV
>CP033789.1|AYY25197.1|184238_184952_+|transposase
MFTKIFIGLFCYVFLVVRNSRKKFLIEEAKKKEMENKPVERPVYWCPRENRPIGREQERVTVPTKEITLEKDVANIYDLVATSVHKNLGEEESNRLKHEDIEEVEYADAFHHTPTPEVVYDIPFPSDEDIPEELLEYEDMYSQQEYVSIPPETEHVFPVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVDSPYSYTLVEWSNRQLGNI
>CP033789.1|AYY25196.1|180931_184222_+|DEAD/DEAH-box-helicase
MLQEMIQQDTFDQEQTPAMLQLETGTASHSAFCFAMAVNQNNQMQFAVLGANDSTLKSFRAAISMGTRRLYFGEGQKEELHYVLGKKMNVISTGQFEFINTQTVNRKKAIIAFSKELEEKYIVAIDEAPEMQVRDFLMAPPYGLPILEEWAKPIYEEMLTRKLLQPLDVYFDKNEFTSLSIAQVVLKEEDCKEFLSEMIRTGKCKFPQDGTGEKINEINDLNEYLLEYSPVMLDKVTKLDEPLHQPMKEQALSHFDTYQRPLFPVQAHVATGAAKALQVQKGIIIQGEMSSGKSAIMTATVDGYFHLTGKKGYRTCVFVPPTLTEKWAKEEIRHLIPDADVHLIKRTEDLIRIHQSWIQAGRPKPEKPTFFVISFTTMRGDSIKQMPLPYKQIALSKKSKEDVQRYYKNGYYCPDCGAKLRKKTSSIMVQQANGDQKEVCQYKDFTGSDLDSKTNKNSVCADCNSNIWSPKVKTKYASFKDWTKYENKLVQAIKEGNKPLQKQLELENRVKPYEAKQSGRAYRKVATVEYIRRKMKHFFDALICDEVHELKSETAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKRGFEYSSLMEWNETYGNIERTYYHDGEVVSNVASRGAQGMLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELINVPTILVEMSEEQKKAYEHMKGSFEKAIEGAKGTPDVGKLWLSYIRTGNSYPDNMNHYPNYHLDNAEKELVWSNEEFRFDEDCIQPKEKKLQEILQTEISEGRPTIIYVSDTGSTVKERDIQPRLQKVAEQVPGAKVSILRTNTVAPPKRSAWLKEQVSSGVNVIICSQELVKVGLDLLATPTIIFYQLSFSLFTLNQAARRHWRIGQTKQCRTFYLGYKETFQAQMAQLIAQKNKAAEAMNGDATSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVEKLPETMDVAFMKEAQFVQSAVECIKKEQVPGVRVKQNVLEVDGEIEDIIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKEKRKNKVIDGQYEFDLFG
>CP033789.1|AYY25205.1|193858_196522_+|type-IA-DNA-topoisomerase
MGKTLFIAEKPKVANEIMKSPRFRHSQKYTGSKPYYGYYENDHYIVSWCRGHLLELKNPEEMDPKYKVFSLEHLPLIYEPAYKVKQENAEQLQILVKLLQRPDVDHAVNICDADREGELIYREVYEFAGVNKKQSRVYKSSFEAAELERALNRLESASKYDGLAYSAKARQYLDYLLGMNITRGCTTKLAQNKFLLSSGRVQMCLLNEIRQRELAIENYREQSYYHLQLITDLGLKPVMKTEDPVLNPSPLRSLGEDLKGQYLVVEEFKEGTRKKNPKLLYNLTDLYKDAHAQLQINAETSRKHIQTLYEEGFITYPRSSSRHLPTEQVDRVKGVMQALAKSQYSFLVQSVDIEAIDVKHKTFNDELVSSHFAIIPTTKQYQEEGRPEIEKQLYSLVVKRFVGNFMRPAVYLVREVSLIDAMGNIYQTKESVLREKGFLEVFQEEVEEESVEVFKIPIMQKGQELQICDFELQESKTKKPALHTESSILTFMETAGRKIDDEHLKELMKGKRIGTVATEATFIPALHEKNYIAIEKGKITTTPIGRSFIEQFPVSQVKDPLYTAEMEGMIYRIEKNEMSYKEFIVQTNEFIQKITQEIIKIPDAVSYNLIENWKQQIEVCKCPCGNGIILDRGKFFGCSNHPNCNVGFPKRIKEKTIPAAQVKKLFEENKTDVIKGFKSNGKEFSAYLAFINGEVSFNLPTVEELSLGRCPKCQNGHILKRDTFFGCSDYQSGCNFAIFAKIKGKKLSDSQIKKLLKNRVTDFIHGFKGDYGEFTAAIRLKEDLRICFERPTTADRTVGKCPLCQSRVIIGKTNYLCEQYKKDCDFIISGMILEKKITANQIKKLLEKNMTDTIQGFKSKKTGELFGAKLTYDSAQKRLTFINEKKK
>CP033789.1|AYY25206.1|196696_196906_+|hypothetical-protein
MCTSNITSTNVSFEKLKSQEENEKSMASICPNCKKRSFRELYNDYPKWIQFCLCCNYREVNTLESPFVY
>CP033789.1|AYY25207.1|196950_197595_+|hypothetical-protein
MKIWIKAICITSFVIQMSACSSSAQTKIDSRPAQAVQNGIQRHVEGKGIVDIPEAYKGKLKGLETVKGKVLHIKDGDTIDVNVKGQKQTVRLLLLDTPESVSQKIPPQKMGKEASSFLKKQLDGKSVTLVYDQGPKEDKYGRKLAYIFCNGIHINELMAKSGYGIVAYISKPNTTLLPEMLEAEKEAKEAMAGVWSIKGFVNEKKRHYNRNDAA
>CP033789.1|AYY25208.1|197646_197850_+|hypothetical-protein
MDENKRNMLLSFIISILFIFASLLPFSNNEYVYVISKIGAAAGVINIVTMSVFLYFQSKKTGHLLNQ
>CP033789.1|AYY25209.1|197923_198211_+|hypothetical-protein
MSQVPGFLKFVLAKERRYVYLVVAEKKNKKIHTHMVYRFGPLEKALETMYEMRGDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY
>CP033789.1|AYY25210.1|198254_198692_+|disulfide-bond-formation-protein-B
MSIIQKYHIAIAWTIATSAMLISLIFSEWMKLPPCNLCWYQRMAMYPLVLILGIGMYRKDPNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTEDYLNLFGFISIPMLSFVGFLAIIILLYIKPDKETKEQITQRL
>CP033789.1|AYY25211.1|198764_199058_+|ArsR-family-transcriptional-regulator
MTTIQASNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNVTQLTELLDIPQSTVSQHLSKMRGKILRSERRGLEMYYHIVNSKACQIVSVLGL
>CP033789.1|AYY25212.1|199365_199551_-|RNA-chaperone-Hfq
MHTQEDFYTKLIEEKRLVTIFLLNGIRVPGIIIAVDKFSVLVSSHGKQQFIYKQAISTVSL
>CP033789.1|AYY25213.1|199742_199874_-|Phr-family-secreted-Rap-phosphatase-inhibitor
MKKTILGLAGVITIFTLMFGAQSPTETQKAIDVIQYAHGNHGG
>CP033789.1|AYY25214.1|199870_200965_-|tetratricopeptide-repeat-protein
MIVSTKGNNEITKLLNDWYLEIRSRRIGNAHQLKEIIDTKIHSIEEDQNLLLYYSLLDFRYQFVIDNLSVSKSSFDKVEAFDMPTDNFLAYYYHFFKGIHASTIGEYQIAKESYENAEKLLDCIPDELEKAEFYYKVGAFHYDIYQGLLSYKKVSEAREIFAQHAGYEINVAFCDNLIGLACTHLREWELAEEYFTKAMDMFQKINEEQFILMVRQNLGLMYATQNLSPLAIRYLSEVNQKMPNNYKALFIEAREHMKEGNHSVAKDLIVKGHSICEEVANIEYLHHFKILDAMNGDFPAEALERTVLEGVSYFKEQELFEYIKEYEEYLATAFYKENNHVKASCYFYSCSQAGKKAFEKEALK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP033789_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP033789_2

193414-193708

TypeV-U3,TypeI-A?

V-U3

Consensus_repeat	Method
GTTAAAACATAACAATAGATGTATTGAAAT	PILER-CR
GTTAAAACATAACAATAGATGTATTGAAAT	CRISPRCasFinder
GTTAAAACANAACAATAGATGTATTGAAAT	CRT

4 spacers

c2c10_CAS-V-U3,csa3

The CRISPR arrays of CP033789_2

>merge|CP033789|2|193414-193708|PILER-CR,CRISPRCasFinder,CRT
GTTAAAACATAACAATAGATGTATTGAAATTGTATAGCGACAGATAATTCATTCGTCTCAGTATTTCGTTAAAACATAACAATAGATGTATTGAAATATGTATTGTTTTTATAAGGCGATAAGAGAAACTGGTTAAAACATAACAATAGATGTATTGAAATTATTACCCACAATATATTTTGCTCCTTTCTATTCCTTGTTAAAACAAAACAATAGATGTATTGAAATTGGGGAGACGCTCGGCACTTCACAAAATCATTGCGAAGTTTAAACAACACGATAGATATATAGGAGT

>CP033789|2|2|193414-193641|PILER-CR
GTTAAAACATAACAATAGATGTATTGAAAT	TGTATAGCGACAGATAATTCATTCGTCTCAGTATTTC
GTTAAAACATAACAATAGATGTATTGAAAT	ATGTATTGTTTTTATAAGGCGATAAGAGAAACTG
GTTAAAACATAACAATAGATGTATTGAAAT	TATTACCCACAATATATTTTGCTCCTTTCTATTCCTT
GTTAAAACAAAACAATAGATGTATTGAAAT

>CP033789|2|2|193414-193708|CRISPRCasFinder
GTTAAAACATAACAATAGATGTATTGAAAT	TGTATAGCGACAGATAATTCATTCGTCTCAGTATTTC
GTTAAAACATAACAATAGATGTATTGAAAT	ATGTATTGTTTTTATAAGGCGATAAGAGAAACTG
GTTAAAACATAACAATAGATGTATTGAAAT	TATTACCCACAATATATTTTGCTCCTTTCTATTCCTT
GTTAAAACAAAACAATAGATGTATTGAAAT	TGGGGAGACGCTCGGCACTTCACAAAATCATTGCGAA
GTTTAAACAACACGATAGATATATAGGAGT

>CP033789|2|2|193414-193708|CRT
GTTAAAACATAACAATAGATGTATTGAAAT	TGTATAGCGACAGATAATTCATTCGTCTCAGTATTTC
GTTAAAACATAACAATAGATGTATTGAAAT	ATGTATTGTTTTTATAAGGCGATAAGAGAAACTG
GTTAAAACATAACAATAGATGTATTGAAAT	TATTACCCACAATATATTTTGCTCCTTTCTATTCCTT
GTTAAAACAAAACAATAGATGTATTGAAAT	TGGGGAGACGCTCGGCACTTCACAAAATCATTGCGAA
GTTTAAACAACACGATAGATATATAGGAGT

Protein	Signature genes	Signature genes Name	Protein_function
CP033789.1\|AYY25210.1\|198254_198692_+\|disulfide-bond-formation-protein-B	unknown	unknown	gnl\|CDD\|179540
CP033789.1\|AYY25207.1\|196950_197595_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|214615
CP033789.1\|AYY25204.1\|191266_192628_+\|transposase	c2c10_CAS-V-U3	-	gnl\|CDD\|284650
CP033789.1\|AYY25201.1\|187916_188300_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25208.1\|197646_197850_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25205.1\|193858_196522_+\|type-IA-DNA-topoisomerase	unknown	unknown	gnl\|CDD\|236078
CP033789.1\|AYY25200.1\|187200_187791_-\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25199.1\|185916_186552_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25211.1\|198764_199058_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP033789.1\|AYY25206.1\|196696_196906_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25197.1\|184238_184952_+\|transposase	unknown	unknown	unknown
CP033789.1\|AYY25198.1\|185287_185917_+\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25212.1\|199365_199551_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|274101
CP033789.1\|AYY25203.1\|189311_191141_-\|DUF4365-domain-containing-protein	unknown	unknown	unknown
CP033789.1\|AYY25202.1\|188316_188955_+\|NERD-domain-containing-protein	unknown	unknown	gnl\|CDD\|377990
CP033789.1\|AYY25213.1\|199742_199874_-\|Phr-family-secreted-Rap-phosphatase-inhibitor	unknown	unknown	unknown
CP033789.1\|AYY25196.1\|180931_184222_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|223627
CP033789.1\|AYY25214.1\|199870_200965_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
CP033789.1\|AYY25269.1\|186602_187181_-\|hypothetical-protein	unknown	unknown	unknown
CP033789.1\|AYY25209.1\|197923_198211_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP033789.1\|AYY25210.1\|198254_198692_+\|disulfide-bond-formation-protein-B	gnl\|CDD\|179540	PRK03113, PRK03113, putative disulfide oxidoreductase; Provisional.	2.24357e-36
CP033789.1\|AYY25207.1\|196950_197595_+\|hypothetical-protein	gnl\|CDD\|214615	smart00318, SNc, Staphylococcal nuclease homologues.	1.67397e-31
CP033789.1\|AYY25204.1\|191266_192628_+\|transposase	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	3.32739e-21
CP033789.1\|AYY25202.1\|188316_188955_+\|NERD-domain-containing-protein	gnl\|CDD\|377990	pfam08378, NERD, Nuclease-related domain. The nuclease-related domain (NERD) is found in a range of bacterial as well as archaeal and plant proteins. It has distant similarity to endonucleases (hence its name) and its predicted secondary structure is helix - sheet - sheet - sheet - sheet - weak sheet/long loop - helix - sheet - sheet. The majority of NERD-containing proteins are single-domain, but in several cases proteins containing NERD have additional domains which in 75% of cases are involved in DNA processing.	4.10175e-25
CP033789.1\|AYY25212.1\|199365_199551_-\|RNA-chaperone-Hfq	gnl\|CDD\|274101	TIGR02383, RNA-binding_protein_Hfq, RNA chaperone Hfq. This model represents the RNA-binding pleiotropic regulator Hfq, a small, Sm-like protein of bacteria. It helps pair regulatory noncoding RNAs with complementary mRNA target regions. It enhances the elongation of poly(A) tails on mRNA. It appears also to protect RNase E recognition sites (A/U-rich sequences with adjacent stem-loop structures) from cleavage. Being pleiotropic, it differs in some of its activities in different species. Hfq binds the non-coding regulatory RNA DsrA (see Rfam RF00014) in the few species known to have it: Escherichia coli, Shigella flexneri, Salmonella spp. In Azorhizobium caulinodans, an hfq mutant is unable to express nifA, and Hfq is called NrfA, for nif regulatory factor (see . The name hfq reflects phenomenology as a host factor for phage Q-beta RNA replication. [Regulatory functions, Other].	1.49921e-23
CP033789.1\|AYY25205.1\|193858_196522_+\|type-IA-DNA-topoisomerase	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	1.77096e-130
CP033789.1\|AYY25196.1\|180931_184222_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	0.000110893
CP033789.1\|AYY25214.1\|199870_200965_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.2592e-20
CP033789.1\|AYY25211.1\|198764_199058_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.42374e-11

>CP033789.1|AYY25204.1|191266_192628_+|transposase
MTYLSTVVKVMKYQIVCPVNIEWKTFEIYLRTLSYHFRTIGNRTIQKLWEYDNQSLKHFKDTGQYPSAQQLYGCTQKTISGYIYDQLKEEYQDINKANMSTTLQKTIKTWNSRKKEIWSGEMSIPSFRNNLPIDIHGNSIQIIKEKSGDYIASVSLFSSKFIKENDLPNGKILVKLSTRKQNSMKVILDRIIDSTYAKGACMLHKHKKKWYLSITYKSNIKEELKFDEDLIMGIDMGKINVLYFAFNKGLVRGGISGEEIEAFRKKIEHRRISLLRQGKYCSGNRIGKGRKKRIKPIEVLNDKIAKFRNATNHKYANYIVQQCLKYNCGTIQLEDLQGISKEQTFLKNWTYFDLQEKIKNQANQYGIKVVKIDPSYTSQRCSECGYIHKNNRQNQSTFECQQCSFKVHADYNAAKNISVYNIEKVIQKQLKLQEKLNLTKYKEQYIEQMENIN
>CP033789.1|AYY25203.1|189311_191141_-|DUF4365-domain-containing-protein
MKKLNPLDNTIIEHLACLEINKCILQPPFHLQSNVQWNDKGLSFDGDINIYTNKIKKTDFIGTVPIQIKGTTKFKKIKKQQKIAHSISKEDLDVYYKNDNGVLFFVVTIHPETYVSQAYYKTLAPLDLKKLLDEIELTGQKSITVNFKKLEYGELENICKSFLNSLEKQSKRFIEDAKNIAFSQYKIEYGHVQNNVLVDLFEEQAYVYGVLNDVDFPIDIFQLQEMRKETDEIVTIGNETLRIKSVLKISKEIICLTIENSLTFEFSKKFVDGKLRLINGKVHLSKLKTLGSYVKSLKLLKYLLTYNKIPLSSFEIDTTLNEKETFKDIDENIKIHEELIQICKQIGISEDYIFDEKENLFILFNKIINIFKNKQYDLINFTPPLDKNSMVFCNIELSDYVMVTLLFDGYTAIDFFSVKAIKTMGAFLPKDGHVIDYDDANWREKIWKVSLYLNQSIENMERAANFKYEILELSFQDEHHDIDSLNSIDTHLKYISYFDEYSDEKYLKIAQDLIQRYLLKNPKDIIQKINLYQINLRLGNELSDDEINDILTIQENAQNKNDKILDYACEVLLQNRLKSKRLYESLKKDEQDTIKMYPIYHLYKNLISI
>CP033789.1|AYY25202.1|188316_188955_+|NERD-domain-containing-protein
MKVLIFELVLIAILIPLNIVVKKHVPKWKGKAGEKLVKHILNKLDSESYCVLHDVTVHTEYGDTTQIDHIVIAETGVFVIETKNYEGWIYGNEKSARWTQGIFRKKSSFQNPFRQNYKHIKAIEWLMEQQLPSISIAAFHPKCSLKRVNVQSKDKHVLYYNDLQKCIESYTETQLTNDEVQHIYQTILRANIMDKDIEKKHVKYLHNKFAKQ
>CP033789.1|AYY25201.1|187916_188300_+|hypothetical-protein
MKRNREYIALRNSILIGWLLTCIVIGLSIYFSSVVYLLIGCFILSLKYGLMGTVKNVEKRLPTWANFGVIEKPVNRRVTRPFQFRGGLLVSLALGFVEMVIKGLCISYFILGLETHVYRLMRRNARV
>CP033789.1|AYY25200.1|187200_187791_-|hypothetical-protein
MLKLVVDNTVTEPEPKTDSAFSNYFTCKDCVYYLSKSDSCSLQLAADSNSPLIPYECGNFEETYEIGTEDPLNSHIHQRLREEKAQILDESYPAQPAIDPIHKDAIWYGSVNYGCWIINDSKKRFALAEQVPFGDNNMSSKKYASPFPLHDHGAKEGIRHYMCWYVNEKGIGEYHLLIGGVIMKIAEGVKKLGFNY
>CP033789.1|AYY25269.1|186602_187181_-|hypothetical-protein
MLEHTILFSLVQLVPLILSTGIIYILLELTDTEWKTWFSYEGIFTIIFLITRFQVFQNKKSIISLNQHEKWFSKLNIFLVSIFLVFFASIPTLLKIAFILQMTVILLLLEYLCLYIDRLPIHNLYRIQEIICDKKQLKIERIILNNAEHGTHTIKTRDEQYFLYTAVYLSGILSPISEEVFEEYERKNLMGR
>CP033789.1|AYY25199.1|185916_186552_+|hypothetical-protein
MKREKGMIGVLCTLVLMILLLVPLQAAQASVKIDFNELKGNDVSSSFTDGLNNRTKTTEKDDSFGSSIIQKIEGLYAPAFKVGVNIFSISFVLGVIVMVMALITKNGQWMKWATGSMIFSFISMMSMRLSVYFLFSSDVFSFMNIFTDFLDLFKATALIFTPFMLIAGIRLRRIHESTKQPEYYRWANRVITGSCLLCMLAVLAPWLFANM
>CP033789.1|AYY25198.1|185287_185917_+|hypothetical-protein
MNINSISNNVVEKLEQTVRYEKKQVQVLRVSKSSSNIHAYMIFPEFSEVKISNTELDEYIENLSTSVKYVIDRKLSQQEIEKQNHSFIMTCEVEEDGVIDDETIHFNTTYVKPPTIANKVFKLVCGLGNRLDSLKELHITVLNNNINRIEIEFYNENETYVAVEKEEIANAIMGAYTKANIYYAADLFYAAEGNEIKLKSIKPKLAGDV
>CP033789.1|AYY25197.1|184238_184952_+|transposase
MFTKIFIGLFCYVFLVVRNSRKKFLIEEAKKKEMENKPVERPVYWCPRENRPIGREQERVTVPTKEITLEKDVANIYDLVATSVHKNLGEEESNRLKHEDIEEVEYADAFHHTPTPEVVYDIPFPSDEDIPEELLEYEDMYSQQEYVSIPPETEHVFPVQQGVADVEDMDFVRWTAKVIEQEQGLTRVINMSNKKRYWIHTEGEILPKNQLLYMKLEVDSPYSYTLVEWSNRQLGNI
>CP033789.1|AYY25196.1|180931_184222_+|DEAD/DEAH-box-helicase
MLQEMIQQDTFDQEQTPAMLQLETGTASHSAFCFAMAVNQNNQMQFAVLGANDSTLKSFRAAISMGTRRLYFGEGQKEELHYVLGKKMNVISTGQFEFINTQTVNRKKAIIAFSKELEEKYIVAIDEAPEMQVRDFLMAPPYGLPILEEWAKPIYEEMLTRKLLQPLDVYFDKNEFTSLSIAQVVLKEEDCKEFLSEMIRTGKCKFPQDGTGEKINEINDLNEYLLEYSPVMLDKVTKLDEPLHQPMKEQALSHFDTYQRPLFPVQAHVATGAAKALQVQKGIIIQGEMSSGKSAIMTATVDGYFHLTGKKGYRTCVFVPPTLTEKWAKEEIRHLIPDADVHLIKRTEDLIRIHQSWIQAGRPKPEKPTFFVISFTTMRGDSIKQMPLPYKQIALSKKSKEDVQRYYKNGYYCPDCGAKLRKKTSSIMVQQANGDQKEVCQYKDFTGSDLDSKTNKNSVCADCNSNIWSPKVKTKYASFKDWTKYENKLVQAIKEGNKPLQKQLELENRVKPYEAKQSGRAYRKVATVEYIRRKMKHFFDALICDEVHELKSETAQGTALGSLAKVCKKVVAGTGTLFGGRASDVFYTLWRLFPQKMVKRGFEYSSLMEWNETYGNIERTYYHDGEVVSNVASRGAQGMLDKTKVVPGISPYVFTQFLMDTTINVRLKDVWPNPVELINVPTILVEMSEEQKKAYEHMKGSFEKAIEGAKGTPDVGKLWLSYIRTGNSYPDNMNHYPNYHLDNAEKELVWSNEEFRFDEDCIQPKEKKLQEILQTEISEGRPTIIYVSDTGSTVKERDIQPRLQKVAEQVPGAKVSILRTNTVAPPKRSAWLKEQVSSGVNVIICSQELVKVGLDLLATPTIIFYQLSFSLFTLNQAARRHWRIGQTKQCRTFYLGYKETFQAQMAQLIAQKNKAAEAMNGDATSDGLNAMLGDTGDLQTLLIQNIKSGNQLKGSTEEWTKAASDESKRVLANIGNVITPVFESIEIQFTNWVEKLPETMDVAFMKEAQFVQSAVECIKKEQVPGVRVKQNVLEVDGEIEDIIRALTTLNTDKRMLVQKQDITFWDSVIVEVDSSKKKEKRKNKVIDGQYEFDLFG
>CP033789.1|AYY25205.1|193858_196522_+|type-IA-DNA-topoisomerase
MGKTLFIAEKPKVANEIMKSPRFRHSQKYTGSKPYYGYYENDHYIVSWCRGHLLELKNPEEMDPKYKVFSLEHLPLIYEPAYKVKQENAEQLQILVKLLQRPDVDHAVNICDADREGELIYREVYEFAGVNKKQSRVYKSSFEAAELERALNRLESASKYDGLAYSAKARQYLDYLLGMNITRGCTTKLAQNKFLLSSGRVQMCLLNEIRQRELAIENYREQSYYHLQLITDLGLKPVMKTEDPVLNPSPLRSLGEDLKGQYLVVEEFKEGTRKKNPKLLYNLTDLYKDAHAQLQINAETSRKHIQTLYEEGFITYPRSSSRHLPTEQVDRVKGVMQALAKSQYSFLVQSVDIEAIDVKHKTFNDELVSSHFAIIPTTKQYQEEGRPEIEKQLYSLVVKRFVGNFMRPAVYLVREVSLIDAMGNIYQTKESVLREKGFLEVFQEEVEEESVEVFKIPIMQKGQELQICDFELQESKTKKPALHTESSILTFMETAGRKIDDEHLKELMKGKRIGTVATEATFIPALHEKNYIAIEKGKITTTPIGRSFIEQFPVSQVKDPLYTAEMEGMIYRIEKNEMSYKEFIVQTNEFIQKITQEIIKIPDAVSYNLIENWKQQIEVCKCPCGNGIILDRGKFFGCSNHPNCNVGFPKRIKEKTIPAAQVKKLFEENKTDVIKGFKSNGKEFSAYLAFINGEVSFNLPTVEELSLGRCPKCQNGHILKRDTFFGCSDYQSGCNFAIFAKIKGKKLSDSQIKKLLKNRVTDFIHGFKGDYGEFTAAIRLKEDLRICFERPTTADRTVGKCPLCQSRVIIGKTNYLCEQYKKDCDFIISGMILEKKITANQIKKLLEKNMTDTIQGFKSKKTGELFGAKLTYDSAQKRLTFINEKKK
>CP033789.1|AYY25206.1|196696_196906_+|hypothetical-protein
MCTSNITSTNVSFEKLKSQEENEKSMASICPNCKKRSFRELYNDYPKWIQFCLCCNYREVNTLESPFVY
>CP033789.1|AYY25207.1|196950_197595_+|hypothetical-protein
MKIWIKAICITSFVIQMSACSSSAQTKIDSRPAQAVQNGIQRHVEGKGIVDIPEAYKGKLKGLETVKGKVLHIKDGDTIDVNVKGQKQTVRLLLLDTPESVSQKIPPQKMGKEASSFLKKQLDGKSVTLVYDQGPKEDKYGRKLAYIFCNGIHINELMAKSGYGIVAYISKPNTTLLPEMLEAEKEAKEAMAGVWSIKGFVNEKKRHYNRNDAA
>CP033789.1|AYY25208.1|197646_197850_+|hypothetical-protein
MDENKRNMLLSFIISILFIFASLLPFSNNEYVYVISKIGAAAGVINIVTMSVFLYFQSKKTGHLLNQ
>CP033789.1|AYY25209.1|197923_198211_+|hypothetical-protein
MSQVPGFLKFVLAKERRYVYLVVAEKKNKKIHTHMVYRFGPLEKALETMYEMRGDFENLFPLELKERGYDWEDINDWILSIETGYSKHGNKLVIY
>CP033789.1|AYY25210.1|198254_198692_+|disulfide-bond-formation-protein-B
MSIIQKYHIAIAWTIATSAMLISLIFSEWMKLPPCNLCWYQRMAMYPLVLILGIGMYRKDPNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTEDYLNLFGFISIPMLSFVGFLAIIILLYIKPDKETKEQITQRL
>CP033789.1|AYY25211.1|198764_199058_+|ArsR-family-transcriptional-regulator
MTTIQASNEMHKIPEADVELLKIMAHPVRLQIVKELEHRKICNVTQLTELLDIPQSTVSQHLSKMRGKILRSERRGLEMYYHIVNSKACQIVSVLGL
>CP033789.1|AYY25212.1|199365_199551_-|RNA-chaperone-Hfq
MHTQEDFYTKLIEEKRLVTIFLLNGIRVPGIIIAVDKFSVLVSSHGKQQFIYKQAISTVSL
>CP033789.1|AYY25213.1|199742_199874_-|Phr-family-secreted-Rap-phosphatase-inhibitor
MKKTILGLAGVITIFTLMFGAQSPTETQKAIDVIQYAHGNHGG
>CP033789.1|AYY25214.1|199870_200965_-|tetratricopeptide-repeat-protein
MIVSTKGNNEITKLLNDWYLEIRSRRIGNAHQLKEIIDTKIHSIEEDQNLLLYYSLLDFRYQFVIDNLSVSKSSFDKVEAFDMPTDNFLAYYYHFFKGIHASTIGEYQIAKESYENAEKLLDCIPDELEKAEFYYKVGAFHYDIYQGLLSYKKVSEAREIFAQHAGYEINVAFCDNLIGLACTHLREWELAEEYFTKAMDMFQKINEEQFILMVRQNLGLMYATQNLSPLAIRYLSEVNQKMPNNYKALFIEAREHMKEGNHSVAKDLIVKGHSICEEVANIEYLHHFKILDAMNGDFPAEALERTVLEGVSYFKEQELFEYIKEYEEYLATAFYKENNHVKASCYFYSCSQAGKKAFEKEALK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	CP033790.1	52269-52303	2	0.943
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	CP033790.1	52269-52304	2	0.944

1. spacer 1.1|192921|35|CP033789|PILER-CR matches to position: 52269-52303, mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctccacgatgtgataacggccattatcc	Protospacer
**********.**.*********************

2. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to position: 52269-52304, mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctccacgatgtgataacggccattatcc	Protospacer
***********.**.*********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75785-75819	0	1.0
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101608-101642	0	1.0
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28425-28459	0	1.0
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178390-178424	0	1.0
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192921-192955	0	1.0
CP033789_1	1.2\|192987\|35\|CP033789\|PILER-CR	192987-193021	35	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75851-75885	0	1.0
CP033789_1	1.2\|192987\|35\|CP033789\|PILER-CR	192987-193021	35	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101542-101576	0	1.0
CP033789_1	1.2\|192987\|35\|CP033789\|PILER-CR	192987-193021	35	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178456-178490	0	1.0
CP033789_1	1.2\|192987\|35\|CP033789\|PILER-CR	192987-193021	35	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192987-193021	0	1.0
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101608-101643	0	1.0
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28425-28460	0	1.0
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75819	0	1.0
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178424	0	1.0
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192955	0	1.0
CP033789_1	1.4\|192986\|36\|CP033789\|CRISPRCasFinder	192986-193021	36	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75885	0	1.0
CP033789_1	1.4\|192986\|36\|CP033789\|CRISPRCasFinder	192986-193021	36	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178490	0	1.0
CP033789_1	1.4\|192986\|36\|CP033789\|CRISPRCasFinder	192986-193021	36	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193021	0	1.0
CP033789_1	1.4\|192986\|36\|CP033789\|CRISPRCasFinder	192986-193021	36	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101542-101577	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1897	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77787	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75952	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68495	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178557	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193088	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68181-68217	0	1.0
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101475-101511	0	1.0
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101598-101643	0	1.0
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75784-75829	0	1.0
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192920-192965	0	1.0
CP033789_1	1.7\|192986\|46\|CP033789\|CRT	192986-193031	46	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101532-101577	0	1.0
CP033789_1	1.7\|192986\|46\|CP033789\|CRT	192986-193031	46	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75850-75895	0	1.0
CP033789_1	1.7\|192986\|46\|CP033789\|CRT	192986-193031	46	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178455-178500	0	1.0
CP033789_1	1.7\|192986\|46\|CP033789\|CRT	192986-193031	46	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	192986-193031	0	1.0
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	75916-75962	0	1.0
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101465-101511	0	1.0
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178521-178567	0	1.0
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193052-193098	0	1.0
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76308-76344	0	1.0
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193444-193480	0	1.0
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101083-101119	0	1.0
CP033789_2	2.2\|193511\|34\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193511-193544	34	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76375-76408	0	1.0
CP033789_2	2.2\|193511\|34\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193511-193544	34	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	101019-101052	0	1.0
CP033789_2	2.2\|193511\|34\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193511-193544	34	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193511-193544	0	1.0
CP033789_2	2.3\|193575\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193575-193611	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76439-76475	0	1.0
CP033789_2	2.3\|193575\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193575-193611	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	100952-100988	0	1.0
CP033789_2	2.3\|193575\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193575-193611	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193575-193611	0	1.0
CP033789_2	2.4\|193642\|37\|CP033789\|CRISPRCasFinder,CRT	193642-193678	37	NZ_CP009299	Bacillus cereus D17 plasmid unnamed, complete sequence	100885-100921	0	1.0
CP033789_2	2.4\|193642\|37\|CP033789\|CRISPRCasFinder,CRT	193642-193678	37	NZ_CP053930	Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence	76506-76542	0	1.0
CP033789_2	2.4\|193642\|37\|CP033789\|CRISPRCasFinder,CRT	193642-193678	37	NZ_CP033789	Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence	193642-193678	0	1.0
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30747-30781	1	0.971
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31058-31092	1	0.971
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10170-10204	1	0.971
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229028-229062	1	0.971
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30747-30782	1	0.972
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229028-229063	1	0.972
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31092	1	0.972
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10204	1	0.972
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34324	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51730	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141247	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122405-122441	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65545	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4166-4202	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76378-76414	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87139-87175	1	0.973
CP033789_1	1.5\|193052\|37\|CP033789\|CRISPRCasFinder	193052-193088	37	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61179-61215	1	0.973
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NC_018492	Bacillus cereus FRI-35 plasmid p01, complete sequence	178389-178434	1	0.978
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	74103-74139	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	36086-36122	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	15046-15082	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	28951-28987	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	26794-26830	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	36563-36599	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	33929-33965	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	124409-124445	1	0.973
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	21364-21400	1	0.973
CP033789_2	2.2\|193511\|34\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193511-193544	34	NC_011654	Bacillus cereus AH187 plasmid pAH187_12, complete sequence	10959-10992	1	0.971
CP033789_2	2.2\|193511\|34\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193511-193544	34	NZ_CP045535	Bacillaceae bacterium C02 plasmid unnamed2, complete sequence	5364-5397	1	0.971
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12853-12887	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18682-18716	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36970-37004	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6377-6411	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39234-39268	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25999-26033	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6946-6980	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40708-40742	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11865-11899	2	0.943
CP033789_1	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52269-52303	2	0.943
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP009594	Bacillus cereus strain 3a plasmid pBFC_2, complete sequence	12853-12888	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP009603	Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence	36970-37005	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP010109	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence	39234-39269	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP016597	Bacillus cereus strain K8 plasmid pBCK802, complete sequence	18681-18716	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP053996	Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence	25998-26033	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP053990	Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence	40707-40742	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP029457	Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence	11865-11900	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP033790	Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence	52269-52304	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6411	2	0.944
CP033789_1	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6980	2	0.944
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NZ_CP015180	Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB71, complete sequence	66676-66712	2	0.946
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NC_020240	Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pAW63, complete sequence	66757-66793	2	0.946
CP033789_2	2.1\|193444\|37\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193444-193480	37	NC_018686	Bacillus thuringiensis MC28 plasmid pMC183, complete sequence	34985-35021	2	0.946
CP033789_2	2.4\|193642\|37\|CP033789\|CRISPRCasFinder,CRT	193642-193678	37	NZ_CP041978	Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence	176775-176811	2	0.946
CP033789_2	2.4\|193642\|37\|CP033789\|CRISPRCasFinder,CRT	193642-193678	37	CP041980	Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence	159726-159762	2	0.946
CP033789_2	2.4\|193642\|37\|CP033789\|CRISPRCasFinder,CRT	193642-193678	37	NZ_CP040343	Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence	283685-283721	2	0.946
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	229018-229063	4	0.913
CP033789_2	2.2\|193511\|34\|CP033789\|PILER-CR,CRISPRCasFinder,CRT	193511-193544	34	NC_010895	Bacillus thuringiensis serovar tenebrionis plasmid pBMB175, complete sequence	44-77	4	0.882
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP015728	Bacillus cereus strain A1 plasmid pBCA2, complete sequence	28415-28460	5	0.891
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP014285	Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence	30737-30782	6	0.87
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP032612	Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence	31057-31102	6	0.87
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP040339	Bacillus luti strain FJ plasmid unnamed3, complete sequence	10169-10214	6	0.87
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NC_007105	Bacillus cereus E33L plasmid pE33L54, complete sequence	6376-6421	7	0.848
CP033789_1	1.6\|192920\|46\|CP033789\|CRT	192920-192965	46	NZ_CP009966	Bacillus cereus E33L plasmid pBCO_2, complete sequence	6945-6990	7	0.848
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	1861-1907	8	0.83
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP018936	Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence	77751-77797	8	0.83
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP018934	Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence	68171-68217	8	0.83
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP018932	Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence	68459-68505	8	0.83
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NC_006578	[Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence	34288-34334	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP019234	Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence	4156-4202	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP053937	Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence	76368-76414	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP053978	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence	51694-51740	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP034684	Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence	87129-87175	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	122395-122441	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP014852	Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence	141211-141257	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP010087	Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence	61169-61215	9	0.809
CP033789_1	1.8\|193052\|47\|CP033789\|CRT	193052-193098	47	NZ_CP009333	Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence	65509-65555	9	0.809

1. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

2. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

3. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

4. spacer 1.1|192921|35|CP033789|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

5. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtgataacggccattatcc	Protospacer
***********************************

6. spacer 1.2|192987|35|CP033789|PILER-CR matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

7. spacer 1.2|192987|35|CP033789|PILER-CR matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

8. spacer 1.2|192987|35|CP033789|PILER-CR matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

9. spacer 1.2|192987|35|CP033789|PILER-CR matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

taagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
taagtcattatatgacaccgtatgctatgtggatt	Protospacer
***********************************

10. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

11. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

12. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

13. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

14. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtgataacggccattatcc	Protospacer
************************************

15. spacer 1.4|192986|36|CP033789|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

16. spacer 1.4|192986|36|CP033789|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

17. spacer 1.4|192986|36|CP033789|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

18. spacer 1.4|192986|36|CP033789|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggatt	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggatt	Protospacer
************************************

19. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

20. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

21. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

22. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

23. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

24. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

25. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

26. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc	Protospacer
*************************************

27. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccgttaaaacat	Protospacer
**********************************************

28. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccgttaaaacat	Protospacer
**********************************************

29. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccgttaaaacat	Protospacer
**********************************************

30. spacer 1.7|192986|46|CP033789|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	Protospacer
**********************************************

31. spacer 1.7|192986|46|CP033789|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	Protospacer
**********************************************

32. spacer 1.7|192986|46|CP033789|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	Protospacer
**********************************************

33. spacer 1.7|192986|46|CP033789|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	CRISPR spacer
ttaagtcattatatgacaccgtatgctatgtggattgttaaaacag	Protospacer
**********************************************

34. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	Protospacer
***********************************************

35. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	Protospacer
***********************************************

36. spacer 1.8|193052|47|CP033789|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	Protospacer
***********************************************

37. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	Protospacer
***********************************************

38. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcagtatttc	Protospacer
*************************************

39. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcagtatttc	Protospacer
*************************************

40. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcagtatttc	Protospacer
*************************************

41. spacer 2.2|193511|34|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

atgtattgtttttataaggcgataagagaaactg	CRISPR spacer
atgtattgtttttataaggcgataagagaaactg	Protospacer
**********************************

42. spacer 2.2|193511|34|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

atgtattgtttttataaggcgataagagaaactg	CRISPR spacer
atgtattgtttttataaggcgataagagaaactg	Protospacer
**********************************

43. spacer 2.2|193511|34|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

atgtattgtttttataaggcgataagagaaactg	CRISPR spacer
atgtattgtttttataaggcgataagagaaactg	Protospacer
**********************************

44. spacer 2.3|193575|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccacaatatattttgctcctttctattcctt	CRISPR spacer
tattacccacaatatattttgctcctttctattcctt	Protospacer
*************************************

45. spacer 2.3|193575|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccacaatatattttgctcctttctattcctt	CRISPR spacer
tattacccacaatatattttgctcctttctattcctt	Protospacer
*************************************

46. spacer 2.3|193575|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tattacccacaatatattttgctcctttctattcctt	CRISPR spacer
tattacccacaatatattttgctcctttctattcctt	Protospacer
*************************************

47. spacer 2.4|193642|37|CP033789|CRISPRCasFinder,CRT matches to NZ_CP009299 (Bacillus cereus D17 plasmid unnamed, complete sequence) position: , mismatch: 0, identity: 1.0

tggggagacgctcggcacttcacaaaatcattgcgaa	CRISPR spacer
tggggagacgctcggcacttcacaaaatcattgcgaa	Protospacer
*************************************

48. spacer 2.4|193642|37|CP033789|CRISPRCasFinder,CRT matches to NZ_CP053930 (Bacillus cereus strain FDAARGOS_797 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tggggagacgctcggcacttcacaaaatcattgcgaa	CRISPR spacer
tggggagacgctcggcacttcacaaaatcattgcgaa	Protospacer
*************************************

49. spacer 2.4|193642|37|CP033789|CRISPRCasFinder,CRT matches to NZ_CP033789 (Bacillus sp. FDAARGOS_527 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tggggagacgctcggcacttcacaaaatcattgcgaa	CRISPR spacer
tggggagacgctcggcacttcacaaaatcattgcgaa	Protospacer
*************************************

50. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtggtaacggccattatcc	Protospacer
*******************.***************

51. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtggtaacggccattatcc	Protospacer
*******************.***************

52. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtaataacggccattatcc	Protospacer
******************.****************

53. spacer 1.1|192921|35|CP033789|PILER-CR matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.971

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctctacaatgtggtaacggccattatcc	Protospacer
*******************.***************

54. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatcc	Protospacer
********************.***************

55. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatcc	Protospacer
********************.***************

56. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatcc	Protospacer
********************.***************

57. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.972

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctctacaatgtaataacggccattatcc	Protospacer
*******************.****************

58. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

59. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

60. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatc	Protospacer
***************************.*********

61. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatc	Protospacer
***************************.*********

62. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

63. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattgcacaatgtcgtcaatc	Protospacer
********************* ***************

64. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

65. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

66. spacer 1.5|193052|37|CP033789|CRISPRCasFinder matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

caaacaagattacaactattgaacaatgtcgtcaatc	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc	Protospacer
********************.****************

67. spacer 1.6|192920|46|CP033789|CRT matches to NC_018492 (Bacillus cereus FRI-35 plasmid p01, complete sequence) position: , mismatch: 1, identity: 0.978

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccgttaaaacag	Protospacer
*********************************************

68. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

69. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

70. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

71. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

72. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

73. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

74. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

75. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

76. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.973

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagataattcattcgtctcggtatttc	Protospacer
*****************************.*******

77. spacer 2.2|193511|34|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NC_011654 (Bacillus cereus AH187 plasmid pAH187_12, complete sequence) position: , mismatch: 1, identity: 0.971

atgtattgtttttataaggcgataagagaaactg	CRISPR spacer
atgtattgtttttataaagcgataagagaaactg	Protospacer
*****************.****************

78. spacer 2.2|193511|34|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045535 (Bacillaceae bacterium C02 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.971

atgtattgtttttataaggcgataagagaaactg	CRISPR spacer
atgtattgtttttataaagcgataagagaaactg	Protospacer
*****************.****************

79. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

80. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacttctacaatgtgataacggccattatca	Protospacer
*******.**************************

81. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

82. spacer 1.1|192921|35|CP033789|PILER-CR matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
aatccacctcaacaatgtgataacggccattatcc	Protospacer
.********* ************************

83. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacttctacaatgtgataacggccattatca	Protospacer
*******.**************************

84. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

85. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
aatccacctcaacaatgtgataacggccattatcc	Protospacer
.********* ************************

86. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatcgacctctacaatgtgataacggccattatcg	Protospacer
**** *****************************

87. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatctacctctacaatgtggtaacggccattatcc	Protospacer
****.**************.***************

88. spacer 1.1|192921|35|CP033789|PILER-CR matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.943

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctccacgatgtgataacggccattatcc	Protospacer
**********.**.*********************

89. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP009594 (Bacillus cereus strain 3a plasmid pBFC_2, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

90. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP009603 (Bacillus cereus strain S2-8 plasmid pBFR_3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

91. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP010109 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacttctacaatgtgataacggccattatca	Protospacer
********.**************************

92. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP016597 (Bacillus cereus strain K8 plasmid pBCK802, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacttctacaatgtgataacggccattatca	Protospacer
********.**************************

93. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP053996 (Bacillus cereus strain FDAARGOS_780 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

94. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP053990 (Bacillus cereus strain FDAARGOS_781 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatcgacctctacaatgtgataacggccattatcg	Protospacer
***** *****************************

95. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP029457 (Bacillus cereus strain FORC087 plasmid pFORC087.3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatctacctctacaatgtggtaacggccattatcc	Protospacer
*****.**************.***************

96. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP033790 (Bacillus sp. FDAARGOS_527 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctccacgatgtgataacggccattatcc	Protospacer
***********.**.*********************

97. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
taatccacctcaacaatgtgataacggccattatcc	Protospacer
*.********* ************************

98. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 2, identity: 0.944

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
taatccacctcaacaatgtgataacggccattatcc	Protospacer
*.********* ************************

99. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015180 (Bacillus thuringiensis serovar alesti strain BGSC 4C1 plasmid pBMB71, complete sequence) position: , mismatch: 2, identity: 0.946

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagatagttcattcgtctcagtattcc	Protospacer
****************.******************.*

100. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NC_020240 (Bacillus thuringiensis serovar kurstaki str. HD73 plasmid pAW63, complete sequence) position: , mismatch: 2, identity: 0.946

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagatagttcattcgtctcagtattcc	Protospacer
****************.******************.*

101. spacer 2.1|193444|37|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NC_018686 (Bacillus thuringiensis MC28 plasmid pMC183, complete sequence) position: , mismatch: 2, identity: 0.946

tgtatagcgacagataattcattcgtctcagtatttc	CRISPR spacer
tgtatagcgacagatagttcattcgtctcagtattcc	Protospacer
****************.******************.*

102. spacer 2.4|193642|37|CP033789|CRISPRCasFinder,CRT matches to NZ_CP041978 (Bacillus pacificus strain NCCP 15909 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

tggggagacgctcggcacttcacaaaatcattgcgaa	CRISPR spacer
tggggaaatgctcggcacttcacaaaatcattgcgaa	Protospacer
******.*.****************************

103. spacer 2.4|193642|37|CP033789|CRISPRCasFinder,CRT matches to CP041980 (Bacillus paranthracis strain NCCP 15910 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.946

tggggagacgctcggcacttcacaaaatcattgcgaa	CRISPR spacer
tggggaaatgctcggcacttcacaaaatcattgcgaa	Protospacer
******.*.****************************

104. spacer 2.4|193642|37|CP033789|CRISPRCasFinder,CRT matches to NZ_CP040343 (Bacillus cereus strain DLOU-Weihai plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.946

tggggagacgctcggcacttcacaaaatcattgcgaa	CRISPR spacer
tggggaaatgctcggcacttcacaaaatcattgcgaa	Protospacer
******.*.****************************

105. spacer 1.6|192920|46|CP033789|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 4, identity: 0.913

tgatccacctctacaatgtgataacggccattatccgttaa-aacat	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatccgtgaataacg-	Protospacer
********************.***************** ** ***.

106. spacer 2.2|193511|34|CP033789|PILER-CR,CRISPRCasFinder,CRT matches to NC_010895 (Bacillus thuringiensis serovar tenebrionis plasmid pBMB175, complete sequence) position: , mismatch: 4, identity: 0.882

atgtattgtttttataaggcgataagagaaactg	CRISPR spacer
ttgtattgtttttataaagcgataaaagaaacta	Protospacer
 ****************.*******.*******.

107. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP015728 (Bacillus cereus strain A1 plasmid pBCA2, complete sequence) position: , mismatch: 5, identity: 0.891

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtgataacggccattatccgtgaatagtg	Protospacer
************************************** ** *

108. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP014285 (Bacillus thuringiensis strain Bt185 plasmid pBT1850055, complete sequence) position: , mismatch: 6, identity: 0.87

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatccgtgaatagtg	Protospacer
********************.***************** ** *

109. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP032612 (Bacillus thuringiensis strain QZL38 plasmid p.4, complete sequence) position: , mismatch: 6, identity: 0.87

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtggtaacggccattatccgtgaatagtg	Protospacer
********************.***************** ** *

110. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP040339 (Bacillus luti strain FJ plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.87

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
tgatccacctctacaatgtaataacggccattatccgtgaatagtg	Protospacer
*******************.****************** ** *

111. spacer 1.6|192920|46|CP033789|CRT matches to NC_007105 (Bacillus cereus E33L plasmid pE33L54, complete sequence) position: , mismatch: 7, identity: 0.848

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
taatccacctcaacaatgtgataacggccattatccgtgaataatg	Protospacer
*.********* ************************** ** *

112. spacer 1.6|192920|46|CP033789|CRT matches to NZ_CP009966 (Bacillus cereus E33L plasmid pBCO_2, complete sequence) position: , mismatch: 7, identity: 0.848

tgatccacctctacaatgtgataacggccattatccgttaaaacat	CRISPR spacer
taatccacctcaacaatgtgataacggccattatccgtgaataatg	Protospacer
*.********* ************************** ** *

113. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.83

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc-------cattttttct	Protospacer
*************************************       **

114. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP018936 (Bacillus cereus strain JEM-2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.83

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc-------cattttttct	Protospacer
*************************************       **

115. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP018934 (Bacillus cereus strain ISSFR-9F plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.83

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc-------cattttttct	Protospacer
*************************************       **

116. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP018932 (Bacillus cereus strain ISSFR-3F plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.83

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattgaacaatgtcgtcaatc-------cattttttct	Protospacer
*************************************       **

117. spacer 1.8|193052|47|CP033789|CRT matches to NC_006578 ([Bacillus thuringiensis] serovar konkukian str. 97-27 plasmid pBT9727, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc-------cattttttct	Protospacer
********************.****************       **

118. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP019234 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD83, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattgcacaatgtcgtcaatc-------cattttttct	Protospacer
********************* ***************       **

119. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP053937 (Bacillus thuringiensis strain FDAARGOS_792 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc-------cattttttct	Protospacer
********************.****************       **

120. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP053978 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc-------cattttttct	Protospacer
********************.****************       **

121. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP034684 (Bacillus sp. BD59S plasmid pBTBD59S1, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc-------cattttttct	Protospacer
********************.****************       **

122. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatccatattttct	Protospacer
***************************.*********  **   .

123. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP014852 (Bacillus thuringiensis strain HD12 plasmid pHD120161, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag	CRISPR spacer
caaacaagattacaactattgaacaatatcgtcaatccatattttct	Protospacer
***************************.*********  **   .

124. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP010087 (Bacillus thuringiensis strain 97-27 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc-------cattttttct	Protospacer
********************.****************       **

125. spacer 1.8|193052|47|CP033789|CRT matches to NZ_CP009333 (Bacillus thuringiensis strain HD1011 plasmid 4, complete sequence) position: , mismatch: 9, identity: 0.809

caaacaagattacaactattgaacaatgtcgtcaatcgttaaaacag-------	CRISPR spacer
caaacaagattacaactattaaacaatgtcgtcaatc-------cattttttct	Protospacer
********************.****************       **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

930 : 61462

Clostridium_phage(23.53%)

transposase,protease,integrase

attL 779:794|attR 63011:63026

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
779:794	attL	NA	NA	NA	NA
AYY25036.1\|930_1512_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
AYY25037.1\|1754_2624_-	DUF421 domain-containing protein	NA	NA	NA	NA
AYY25038.1\|2644_2851_-	DUF1657 domain-containing protein	NA	NA	NA	NA
AYY25039.1\|2860_3211_-	stage V sporulation protein AE	NA	NA	NA	NA
AYY25040.1\|3207_4224_-	stage V sporulation protein AD	NA	NA	NA	NA
AYY25041.1\|4224_4701_-	stage V sporulation protein AC	NA	NA	NA	NA
AYY25042.1\|4730_5216_-	hypothetical protein	NA	NA	NA	NA
AYY25043.1\|5309_5516_-	DUF1657 domain-containing protein	NA	NA	NA	NA
AYY25044.1\|6000_6711_+\|integrase	integrase	NA	NA	NA	NA
AYY25045.1\|6784_8215_-\|transposase	IS4-like element ISBce2 family transposase	NA	NA	NA	NA
AYY25046.1\|8446_9883_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AYY25047.1\|10170_10623_-	spore gernimation protein GerC	NA	NA	NA	NA
AYY25048.1\|11599_11902_-	N-acetylmuramoyl-L-alanine amidase	A0A142F1B8	Bacillus_phage	2.7e-15	52.1
AYY25049.1\|12263_12716_+	hypothetical protein	NA	NA	NA	NA
AYY25050.1\|12970_13546_-	recombinase family protein	M9Q1K0	Clostridium_phage	5.6e-14	30.6
AYY25051.1\|13673_14519_-	AraC family transcriptional regulator	A0A1B0RXG1	Streptococcus_phage	4.4e-23	42.9
AYY25052.1\|14631_15207_-	recombinase family protein	M9Q1K0	Clostridium_phage	4.6e-16	30.3
AYY25258.1\|15746_18794_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	5.2e-50	22.8
AYY25053.1\|18796_19423_-	recombinase family protein	A0A1S6L009	Salmonella_phage	1.3e-11	35.7
AYY25054.1\|19815_20292_+	DUF2975 domain-containing protein	NA	NA	NA	NA
AYY25055.1\|20301_20532_+	transcriptional regulator	NA	NA	NA	NA
AYY25056.1\|20616_21285_+	alpha/beta hydrolase	NA	NA	NA	NA
AYY25057.1\|21661_22462_-	methyltransferase type 11	NA	NA	NA	NA
AYY25259.1\|22582_23281_-	HAD family hydrolase	NA	NA	NA	NA
AYY25260.1\|23297_23882_-	serine/threonine protein kinase	A0A075BUR2	Microcystis_phage	1.6e-11	31.8
AYY25058.1\|23997_24813_-	hypothetical protein	NA	NA	NA	NA
AYY25059.1\|25457_26060_-	adenylyl-sulfate kinase	A0A2P1ELS9	Moumouvirus	2.4e-23	37.4
AYY25261.1\|26282_27464_-	sulfate adenylyltransferase	A0A2K9L0F0	Tupanvirus	4.8e-52	34.2
AYY25060.1\|30749_31355_-	recombinase family protein	M9Q1K0	Clostridium_phage	1.8e-15	30.7
AYY25262.1\|31688_32021_+	hypothetical protein	NA	NA	NA	NA
AYY25061.1\|32200_32581_+	GtrA family protein	NA	NA	NA	NA
AYY25062.1\|32615_33590_+	glycosyltransferase	A8CG95	Salmonella_phage	1.4e-57	41.3
AYY25063.1\|33896_35576_+	hypothetical protein	NA	NA	NA	NA
AYY25064.1\|35667_35892_-	DUF2187 domain-containing protein	NA	NA	NA	NA
AYY25065.1\|36569_39530_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.2e-211	40.0
AYY25066.1\|39673_40234_-	recombinase family protein	M9Q1K0	Clostridium_phage	1.3e-31	42.1
AYY25067.1\|40530_40908_-	VOC family protein	NA	NA	NA	NA
AYY25068.1\|40961_41825_-	AraC family transcriptional regulator	NA	NA	NA	NA
AYY25069.1\|42236_43673_+\|transposase	IS4 family transposase	NA	NA	NA	NA
AYY25070.1\|44775_46269_-	cardiolipin synthase	NA	NA	NA	NA
AYY25071.1\|46621_47032_-	DUF421 domain-containing protein	NA	NA	NA	NA
AYY25072.1\|48135_48342_-	DUF1657 domain-containing protein	NA	NA	NA	NA
AYY25073.1\|48925_50362_+\|transposase	IS4 family transposase	NA	NA	NA	NA
AYY25074.1\|50935_51424_-	hypothetical protein	NA	NA	NA	NA
AYY25075.1\|51660_51960_-	transcriptional regulator	NA	NA	NA	NA
AYY25076.1\|52475_52664_+	hypothetical protein	NA	NA	NA	NA
AYY25077.1\|52815_54129_-	hypothetical protein	NA	NA	NA	NA
AYY25078.1\|54690_55071_+	DUF4878 domain-containing protein	NA	NA	NA	NA
AYY25079.1\|55112_55565_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AYY25080.1\|55579_56812_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	3.0e-65	58.0
AYY25081.1\|57182_57425_-	hypothetical protein	NA	NA	NA	NA
AYY25082.1\|57525_58128_+	hypothetical protein	A0A1B0T6B1	Bacillus_phage	1.5e-12	41.3
AYY25083.1\|59300_59813_-	DNA-binding protein	NA	NA	NA	NA
AYY25084.1\|59834_60185_-	zinc-finger domain-containing protein	NA	NA	NA	NA
AYY25085.1\|60418_61462_+\|integrase	integrase	A0A0E3T6D9	Bacillus_phage	2.0e-09	22.9
63011:63026	attR	NA	NA	NA	NA

DBSCAN-SWA_2

72806 : 136155

Bacillus_phage(54.55%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY25100.1\|72806_74045_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	5.4e-54	34.3
AYY25101.1\|75577_76060_+	thioredoxin	NA	NA	NA	NA
AYY25102.1\|76099_77245_+	DUF418 domain-containing protein	NA	NA	NA	NA
AYY25103.1\|77503_77683_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	3.6e-12	59.3
AYY25104.1\|77941_79378_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AYY25105.1\|79614_80118_-	hypothetical protein	NA	NA	NA	NA
AYY25106.1\|80176_80407_-	hypothetical protein	NA	NA	NA	NA
AYY25107.1\|80545_81079_-	HAD family hydrolase	NA	NA	NA	NA
AYY25108.1\|81110_81815_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYY25109.1\|81864_82257_-	hypothetical protein	NA	NA	NA	NA
AYY25110.1\|82493_82907_-	hypothetical protein	A0A1B1P7B4	Bacillus_phage	3.9e-65	83.2
AYY25111.1\|82938_83343_-	hypothetical protein	A0A0A7AR60	Bacillus_phage	5.9e-10	33.1
AYY25112.1\|83553_83748_-	hypothetical protein	NA	NA	NA	NA
AYY25264.1\|83780_84149_-	hypothetical protein	NA	NA	NA	NA
AYY25113.1\|84204_84387_-	hypothetical protein	A0A0U3B243	Bacillus_phage	1.3e-25	85.0
AYY25114.1\|84546_85788_-	glutathionylspermidine synthase	B2ZXR7	Ralstonia_phage	4.5e-24	26.1
AYY25115.1\|85806_86499_-	hypothetical protein	NA	NA	NA	NA
AYY25116.1\|86656_86941_-	hypothetical protein	NA	NA	NA	NA
AYY25117.1\|87105_87408_-	hypothetical protein	NA	NA	NA	NA
AYY25118.1\|87492_87798_-	DUF2325 domain-containing protein	NA	NA	NA	NA
AYY25119.1\|87788_88172_-	hypothetical protein	NA	NA	NA	NA
AYY25120.1\|88336_88912_-	hypothetical protein	NA	NA	NA	NA
AYY25121.1\|88928_91136_-	lytic transglycosylase	A7KUS1	Bacillus_phage	3.0e-15	40.7
AYY25122.1\|91132_95113_-	hypothetical protein	NA	NA	NA	NA
AYY25123.1\|95143_97243_-	DUF87 domain-containing protein	NA	NA	NA	NA
AYY25124.1\|97245_98160_-	hypothetical protein	NA	NA	NA	NA
AYY25125.1\|98160_98511_-	PrgI family protein	NA	NA	NA	NA
AYY25126.1\|98577_98991_-	hypothetical protein	NA	NA	NA	NA
AYY25127.1\|99147_99336_-	hypothetical protein	NA	NA	NA	NA
AYY25128.1\|99544_100468_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
AYY25129.1\|100892_101816_-	DUF3854 domain-containing protein	NA	NA	NA	NA
AYY25130.1\|101899_103783_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.3e-30	26.6
AYY25131.1\|104518_105049_-	hypothetical protein	NA	NA	NA	NA
AYY25132.1\|105038_106814_-	hypothetical protein	Q08J70	Stx2-converting_phage	1.1e-23	39.5
AYY25133.1\|106926_107478_-	hypothetical protein	NA	NA	NA	NA
AYY25134.1\|107826_108645_+	hypothetical protein	NA	NA	NA	NA
AYY25135.1\|111279_111825_-	hypothetical protein	NA	NA	NA	NA
AYY25136.1\|111863_113804_-	DNA-binding protein	NA	NA	NA	NA
AYY25137.1\|113820_114906_-	DUF916 domain-containing protein	NA	NA	NA	NA
AYY25138.1\|114976_115582_-	hypothetical protein	NA	NA	NA	NA
AYY25139.1\|115653_115860_-	hypothetical protein	NA	NA	NA	NA
AYY25140.1\|115932_116136_-	hypothetical protein	NA	NA	NA	NA
AYY25141.1\|116202_116406_-	hypothetical protein	NA	NA	NA	NA
AYY25142.1\|116448_117315_-	hypothetical protein	NA	NA	NA	NA
AYY25143.1\|117316_118249_-	hypothetical protein	NA	NA	NA	NA
AYY25144.1\|118241_119678_-	CpaF family protein	NA	NA	NA	NA
AYY25145.1\|119693_120515_-	chromosome partitioning protein ParA	NA	NA	NA	NA
AYY25146.1\|120531_121392_-	Flp pilus assembly protein CpaB	NA	NA	NA	NA
AYY25147.1\|121990_123350_+\|transposase	IS3-like element ISBce15 family transposase	A0A1B1P773	Bacillus_phage	2.5e-89	60.4
AYY25148.1\|123653_124241_+	hypothetical protein	NA	NA	NA	NA
AYY25149.1\|124606_126952_-	hypothetical protein	NA	NA	NA	NA
AYY25150.1\|127101_128556_-	cell surface protein	NA	NA	NA	NA
AYY25151.1\|128811_129207_-	DUF4320 family protein	NA	NA	NA	NA
AYY25152.1\|129232_129682_-	hypothetical protein	NA	NA	NA	NA
AYY25153.1\|129698_131198_-	hypothetical protein	NA	NA	NA	NA
AYY25154.1\|131217_132171_-	hypothetical protein	NA	NA	NA	NA
AYY25155.1\|132880_134017_-	hypothetical protein	NA	NA	NA	NA
AYY25156.1\|135042_136155_+\|transposase	transposase	A0A286QQB7	Streptococcus_phage	2.0e-79	45.0

DBSCAN-SWA_3

171474 : 253936

Bacillus_phage(30.77%)

transposase,integrase

attL 169851:169866|attR 258185:258200

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
169851:169866	attL	NA	NA	NA	NA
AYY25189.1\|171474_172422_-\|integrase	integrase	A0A1B1P793	Bacillus_phage	5.4e-38	32.0
AYY25190.1\|172465_172645_+	hypothetical protein	NA	NA	NA	NA
AYY25191.1\|173647_175357_-	hypothetical protein	NA	NA	NA	NA
AYY25192.1\|176428_178174_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYY25193.1\|178850_179264_+	hypothetical protein	NA	NA	NA	NA
AYY25194.1\|179525_180617_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AYY25195.1\|180632_180872_+	hypothetical protein	NA	NA	NA	NA
AYY25196.1\|180931_184222_+	DEAD/DEAH box helicase	NA	NA	NA	NA
AYY25197.1\|184238_184952_+\|transposase	transposase	NA	NA	NA	NA
AYY25198.1\|185287_185917_+	hypothetical protein	NA	NA	NA	NA
AYY25199.1\|185916_186552_+	hypothetical protein	NA	NA	NA	NA
AYY25269.1\|186602_187181_-	hypothetical protein	NA	NA	NA	NA
AYY25200.1\|187200_187791_-	hypothetical protein	NA	NA	NA	NA
AYY25201.1\|187916_188300_+	hypothetical protein	NA	NA	NA	NA
AYY25202.1\|188316_188955_+	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	1.1e-21	34.6
AYY25203.1\|189311_191141_-	DUF4365 domain-containing protein	A0A2R2ZGM4	Clostridioides_phage	4.3e-23	24.4
AYY25204.1\|191266_192628_+\|transposase	transposase	A0A142F1Q5	Bacillus_phage	1.4e-79	38.1
AYY25205.1\|193858_196522_+	type IA DNA topoisomerase	A0A1V0SIB2	Klosneuvirus	9.9e-13	21.4
AYY25206.1\|196696_196906_+	hypothetical protein	NA	NA	NA	NA
AYY25207.1\|196950_197595_+	hypothetical protein	A0A2P1JU10	Anoxybacillus_phage	8.3e-06	33.3
AYY25208.1\|197646_197850_+	hypothetical protein	NA	NA	NA	NA
AYY25209.1\|197923_198211_+	hypothetical protein	NA	NA	NA	NA
AYY25210.1\|198254_198692_+	disulfide bond formation protein B	NA	NA	NA	NA
AYY25211.1\|198764_199058_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AYY25212.1\|199365_199551_-	RNA chaperone Hfq	NA	NA	NA	NA
AYY25213.1\|199742_199874_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
AYY25214.1\|199870_200965_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.6e-95	48.2
AYY25215.1\|201975_202353_+	hypothetical protein	NA	NA	NA	NA
AYY25216.1\|202436_202931_+	hypothetical protein	NA	NA	NA	NA
AYY25217.1\|203742_204951_+	MFS transporter	NA	NA	NA	NA
AYY25218.1\|205268_206414_+	radical SAM protein	NA	NA	NA	NA
AYY25219.1\|206406_206721_+	hypothetical protein	NA	NA	NA	NA
AYY25220.1\|206695_208219_+	radical SAM protein	NA	NA	NA	NA
AYY25221.1\|208215_210324_+	nodulation protein-related protein	M1ICZ5	Pelagibacter_phage	8.3e-47	29.0
AYY25222.1\|210345_211401_+	cytochrome P450	NA	NA	NA	NA
AYY25223.1\|211411_212557_+	hypothetical protein	NA	NA	NA	NA
AYY25224.1\|212553_213546_+	hypothetical protein	NA	NA	NA	NA
AYY25225.1\|213565_214330_-	AAA family ATPase	U5N3V8	Enterobacteria_phage	2.3e-63	47.6
AYY25226.1\|214326_215565_-\|transposase	IS21 family transposase	U5N3F9	Enterobacteria_phage	5.4e-54	34.3
AYY25227.1\|215861_216509_+	pentapeptide repeat-containing protein	NA	NA	NA	NA
AYY25228.1\|216714_217194_+	hypothetical protein	NA	NA	NA	NA
AYY25270.1\|217263_218922_+	hypothetical protein	NA	NA	NA	NA
AYY25229.1\|219027_220122_+	tyrosine recombinase XerS	A0A1B1IQT7	uncultured_Mediterranean_phage	3.3e-07	28.1
AYY25230.1\|220492_221227_+	hypothetical protein	NA	NA	NA	NA
AYY25231.1\|221658_221868_-	hypothetical protein	NA	NA	NA	NA
AYY25232.1\|222350_223361_-	hypothetical protein	A0A1B1P7Q7	Bacillus_phage	1.8e-119	58.4
AYY25233.1\|223374_223677_-	hypothetical protein	NA	NA	NA	NA
AYY25234.1\|226599_227280_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.8e-35	36.7
AYY25235.1\|227308_228124_-	hypothetical protein	NA	NA	NA	NA
AYY25236.1\|230538_231069_+	cysteine hydrolase	NA	NA	NA	NA
AYY25271.1\|231345_231537_+	hypothetical protein	NA	NA	NA	NA
AYY25237.1\|231546_246579_+	DUF11 domain-containing protein	NA	NA	NA	NA
AYY25238.1\|246906_248067_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
AYY25239.1\|248460_248655_+	hypothetical protein	NA	NA	NA	NA
AYY25240.1\|248909_250064_-	Ger(x)C family spore germination protein	NA	NA	NA	NA
AYY25241.1\|250060_250753_-	spore gernimation protein XB	NA	NA	NA	NA
AYY25242.1\|250844_252275_+\|transposase	IS4-like element ISBce2 family transposase	NA	NA	NA	NA
AYY25243.1\|252505_253936_+\|transposase	IS4-like element ISBce2 family transposase	NA	NA	NA	NA
258185:258200	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP033795

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1146147 : 1155477

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY26536.1\|1146147_1147428_+	peptidoglycan endopeptidase	A0A1V0DZX6	Clostridioides_phage	4.5e-11	31.5
AYY26537.1\|1147525_1148290_-	alpha/beta hydrolase	NA	NA	NA	NA
AYY26538.1\|1148529_1150290_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-270	96.7
AYY26539.1\|1150378_1151056_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.6e-119	94.7
AYY26540.1\|1151052_1152126_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.3e-176	90.5
AYY26541.1\|1152933_1153653_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
AYY26542.1\|1153800_1154472_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.7e-63	89.8
AYY26543.1\|1154604_1155477_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	6.5e-62	42.5

DBSCAN-SWA_2

1284215 : 1330179

Bacillus_phage(98.21%)

capsid,head,integrase,tail,terminase,protease,portal,holin

attL 1301414:1301430|attR 1325263:1325279

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY26673.1\|1284215_1285385_+	DEAD/DEAH box family ATP-dependent RNA helicase	A0A1V0SBR7	Catovirus	2.2e-41	29.6
AYY26674.1\|1285508_1285694_+	lactoylglutathione lyase	NA	NA	NA	NA
AYY26675.1\|1285767_1286877_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	3.9e-181	100.0
AYY26676.1\|1287175_1288369_+	transcriptional regulator	A0A0U3TNF6	Bacillus_phage	2.6e-215	100.0
AYY26677.1\|1288777_1289131_-	XRE family transcriptional regulator	A0A0U3SD25	Bacillus_phage	3.9e-58	100.0
AYY26678.1\|1289332_1289518_+	XRE family transcriptional regulator	A0A0U3SLC2	Bacillus_phage	3.7e-28	100.0
AYY30512.1\|1289673_1289949_+	DNA-binding protein	A0A0U3ULL9	Bacillus_phage	1.4e-42	100.0
AYY26679.1\|1290379_1291270_+	chromosomal replication initiator DnaA	A0A0U3TZZ4	Bacillus_phage	1.6e-148	99.3
AYY26680.1\|1291284_1292199_+	AAA family ATPase	A0A0U3U1U1	Bacillus_phage	2.0e-170	100.0
AYY26681.1\|1292211_1292406_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	2.2e-31	100.0
AYY26682.1\|1292431_1292605_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
AYY26683.1\|1292619_1292874_+	hypothetical protein	A0A0U3SU43	Bacillus_phage	2.8e-42	100.0
AYY26684.1\|1292886_1293174_+	helix-turn-helix domain-containing protein	A0A1B1P7W1	Bacillus_phage	1.5e-44	100.0
AYY26685.1\|1293212_1294157_+	sigma-70 family RNA polymerase sigma factor	A0A0U3TKA0	Bacillus_phage	1.3e-172	100.0
AYY26686.1\|1294165_1294309_+	Fur-regulated basic protein FbpA	A0A1B1P7V2	Bacillus_phage	2.1e-18	100.0
AYY26687.1\|1294292_1294487_+	hypothetical protein	A0A1B1P7U9	Bacillus_phage	1.0e-28	98.4
AYY26688.1\|1294636_1294876_+	glutaredoxin	A0A0U3TI10	Bacillus_phage	5.5e-40	100.0
AYY26689.1\|1295066_1295513_+	dUTP diphosphatase	A0A0U3SLD3	Bacillus_phage	4.3e-78	100.0
AYY30513.1\|1295873_1296056_+	hypothetical protein	A0A0U3B243	Bacillus_phage	1.8e-30	100.0
AYY26690.1\|1296085_1296484_+	hypothetical protein	A0A0U3SQD7	Bacillus_phage	7.0e-72	100.0
AYY26691.1\|1296808_1297030_+	hypothetical protein	D2XR53	Bacillus_phage	2.0e-36	100.0
AYY26692.1\|1297555_1298275_+	hypothetical protein	D2XR55	Bacillus_phage	1.8e-134	100.0
AYY26693.1\|1298313_1298577_+	hypothetical protein	A0A0U3K3K8	Bacillus_phage	1.8e-39	100.0
AYY26694.1\|1298799_1299048_+	XRE family transcriptional regulator	A0A0U3J7D7	Bacillus_phage	8.8e-41	100.0
AYY26695.1\|1299370_1299502_+	DUF3983 domain-containing protein	A0A1B1P7V8	Bacillus_phage	4.8e-14	97.7
AYY26696.1\|1299800_1300274_+	ArpU family transcriptional regulator	A0A1B1P7X5	Bacillus_phage	4.0e-82	100.0
AYY26697.1\|1300270_1300813_+\|integrase	site-specific integrase	A0A1B1P7Y2	Bacillus_phage	5.5e-96	100.0
1301414:1301430	attL	NA	NA	NA	NA
AYY26698.1\|1301443_1301626_+	hypothetical protein	A0A1B1P7W3	Bacillus_phage	8.8e-06	100.0
AYY30514.1\|1301744_1302047_+	hypothetical protein	A0A1B1P7X2	Bacillus_phage	1.4e-48	100.0
AYY26699.1\|1302033_1302246_+	hypothetical protein	A0A1B1P8F3	Bacillus_phage	3.5e-30	100.0
AYY30515.1\|1302691_1302907_+	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	1.4e-34	100.0
AYY26700.1\|1303068_1303449_+\|terminase	phage terminase small subunit P27 family	A0A1B1P7R2	Bacillus_phage	2.2e-67	100.0
AYY26701.1\|1303429_1305202_+\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	0.0e+00	100.0
AYY26702.1\|1305217_1306432_+\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	4.7e-236	100.0
AYY26703.1\|1306409_1307165_+\|protease	Clp protease ClpP	A0A0U3U021	Bacillus_phage	2.5e-139	100.0
AYY26704.1\|1307161_1308349_+\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	1.8e-216	100.0
AYY26705.1\|1308407_1308626_+	fibronectin type III domain-containing protein	NA	NA	NA	NA
AYY26706.1\|1308634_1308910_+\|head,tail	phage gp6-like head-tail connector protein	A0A1B1P7Q8	Bacillus_phage	2.8e-43	100.0
AYY30516.1\|1308896_1309244_+\|head,tail	head-tail adaptor protein	A0A1B1P7T4	Bacillus_phage	1.7e-61	100.0
AYY26707.1\|1309231_1309669_+	HK97 gp10 family phage protein	A0A1B1P7R6	Bacillus_phage	1.2e-77	100.0
AYY26708.1\|1309665_1310025_+	structural protein	A0A1B1P7S7	Bacillus_phage	9.7e-65	100.0
AYY26709.1\|1310038_1310623_+\|tail	phage tail protein	A0A1B1P7S4	Bacillus_phage	5.2e-108	100.0
AYY26710.1\|1310683_1311079_+	hypothetical protein	A0A1B1P7S9	Bacillus_phage	3.9e-59	100.0
AYY26711.1\|1311096_1311237_+	LysR family transcriptional regulator	A0A1B1P7R9	Bacillus_phage	1.5e-18	100.0
AYY26712.1\|1311252_1316268_+\|tail	phage tail tape measure protein	A0A1B1P7S6	Bacillus_phage	0.0e+00	100.0
AYY26713.1\|1316304_1317786_+\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	7.1e-295	100.0
AYY26714.1\|1317782_1321796_+	hypothetical protein	A0A0U3SD62	Bacillus_phage	0.0e+00	100.0
AYY26715.1\|1321818_1322268_+	hypothetical protein	A0A1B1P7S5	Bacillus_phage	7.1e-81	100.0
AYY26716.1\|1324087_1325047_+\|integrase	site-specific integrase	A0A0U3B271	Bacillus_phage	1.6e-183	100.0
AYY26717.1\|1325062_1325503_+\|holin	holin	A0A1B1P7S2	Bacillus_phage	6.8e-76	100.0
1325263:1325279	attR	NA	NA	NA	NA
AYY26718.1\|1325502_1326258_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	1.0e-143	100.0
AYY26719.1\|1326300_1326507_-	helix-turn-helix domain-containing protein	A0A1B1P7S8	Bacillus_phage	8.4e-29	100.0
AYY26720.1\|1326811_1327204_+	hypothetical protein	A0A1B1P7T3	Bacillus_phage	6.9e-72	100.0
AYY26721.1\|1327216_1327543_+	hypothetical protein	A0A1B1P7T1	Bacillus_phage	2.7e-53	100.0
AYY26722.1\|1327552_1328710_+	DNA translocase FtsK	A0A1B1P7T5	Bacillus_phage	6.3e-222	100.0
AYY30517.1\|1328714_1329350_+	hypothetical protein	A0A0U3J2H0	Bacillus_phage	3.8e-120	100.0
AYY26723.1\|1329370_1329586_+	hypothetical protein	A0A0U3TKC9	Bacillus_phage	4.1e-34	100.0
AYY26724.1\|1329591_1330179_-	hypothetical protein	A0A0U3TZ58	Bacillus_phage	3.1e-100	100.0

DBSCAN-SWA_3

1871890 : 1880233

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY27254.1\|1871890_1873258_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	7.4e-20	38.1
AYY27255.1\|1873615_1874809_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	4.8e-07	26.8
AYY27256.1\|1874894_1875575_-	formylglycine-generating enzyme family protein	A0A075BUR2	Microcystis_phage	1.7e-30	38.2
AYY27257.1\|1875721_1876225_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-42	45.5
AYY27258.1\|1876246_1876633_-	DUF2809 domain-containing protein	NA	NA	NA	NA
AYY27259.1\|1876698_1877406_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.0e-16	26.5
AYY27260.1\|1877427_1877781_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
AYY27261.1\|1877794_1878202_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYY27262.1\|1878632_1880018_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.7e-78	59.9
AYY27263.1\|1880020_1880233_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.1e-12	54.4

DBSCAN-SWA_4

1939485 : 1966162

Bacillus_phage(85.71%)

coat,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY27327.1\|1939485_1939938_-\|coat	spore coat protein	NA	NA	NA	NA
AYY27328.1\|1939952_1940153_-\|coat	spore coat protein W	NA	NA	NA	NA
AYY27329.1\|1940523_1941135_-\|coat	spore coat protein	NA	NA	NA	NA
AYY27330.1\|1941982_1942414_+	N-acetyltransferase	NA	NA	NA	NA
AYY27331.1\|1942916_1943714_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AYY27332.1\|1943956_1944736_-	hypothetical protein	NA	NA	NA	NA
AYY27333.1\|1944973_1945294_+	hypothetical protein	NA	NA	NA	NA
AYY30530.1\|1946272_1947739_-	recombinase family protein	A0A288WFZ3	Bacillus_phage	4.5e-132	49.6
AYY27334.1\|1948344_1949448_+	S-layer homology domain-containing protein	NA	NA	NA	NA
AYY27335.1\|1949584_1950205_-	hypothetical protein	H0USY2	Bacillus_phage	1.6e-94	80.8
AYY27336.1\|1950146_1951328_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	1.5e-178	79.0
AYY27337.1\|1951443_1951626_-	hypothetical protein	Q2I8E2	Bacillus_phage	9.7e-21	86.7
AYY27338.1\|1951622_1951925_-	hypothetical protein	A0A288WG38	Bacillus_phage	6.1e-28	59.2
AYY27339.1\|1951924_1952191_-	hypothetical protein	NA	NA	NA	NA
AYY27340.1\|1952376_1952577_+	XRE family transcriptional regulator	Q2I8E4	Bacillus_phage	3.1e-12	51.5
AYY27341.1\|1953222_1953345_-	DUF3961 domain-containing protein	Q3HKZ4	Bacillus_phage	9.1e-07	51.3
AYY27342.1\|1953527_1953767_+	XRE family transcriptional regulator	A0A288WFZ7	Bacillus_phage	6.8e-22	68.4
AYY27343.1\|1953839_1954187_+	hypothetical protein	A0A0S2GLG3	Bacillus_phage	1.0e-18	47.2
AYY30531.1\|1954179_1955403_-	abortive phage resistance protein	NA	NA	NA	NA
AYY27344.1\|1955407_1956274_-	hypothetical protein	NA	NA	NA	NA
AYY27345.1\|1956413_1957199_-	N-acetylmuramoyl-L-alanine amidase	D2XQ00	Bacillus_virus	4.2e-36	86.5
AYY27346.1\|1957215_1957446_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	2.8e-25	75.0
AYY27347.1\|1957460_1957745_-	hypothetical protein	NA	NA	NA	NA
AYY27348.1\|1957796_1960751_-	hypothetical protein	W8CYT7	Bacillus_phage	2.2e-207	36.0
AYY27349.1\|1960747_1962253_-\|tail	phage tail family protein	A0A1B1P7W7	Bacillus_phage	3.5e-188	68.4
AYY30532.1\|1962265_1966162_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	5.0e-45	41.7

DBSCAN-SWA_5

2992958 : 3075939

Bacillus_phage(67.8%)

capsid,head,integrase,transposase,tail,terminase,tRNA,protease,portal,holin

attL 3029027:3029042|attR 3078499:3078514

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY28327.1\|2992958_2995724_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	7.0e-86	27.1
AYY28328.1\|2996071_2996578_-	DivIVA domain-containing protein	NA	NA	NA	NA
AYY28329.1\|2996667_2997435_-	RNA-binding protein	NA	NA	NA	NA
AYY28330.1\|2997450_2997714_-	YggT family protein	NA	NA	NA	NA
AYY28331.1\|2997720_2998191_-	cell division protein SepF	NA	NA	NA	NA
AYY28332.1\|2998210_2998885_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AYY28333.1\|2998881_2999700_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
AYY28334.1\|2999818_3000103_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
AYY28335.1\|3000270_3001050_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
AYY28336.1\|3001207_3001927_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
AYY28337.1\|3001946_3002864_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
AYY28338.1\|3003179_3004334_-	cell division protein FtsZ	NA	NA	NA	NA
AYY28339.1\|3004373_3005681_-	cell division protein FtsA	NA	NA	NA	NA
AYY28340.1\|3006081_3006852_-	cell division protein DivIB	NA	NA	NA	NA
AYY28341.1\|3006950_3007856_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
AYY28342.1\|3007917_3009012_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
AYY28343.1\|3009116_3010208_-	stage V sporulation protein E	NA	NA	NA	NA
AYY28344.1\|3010298_3011651_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
AYY28345.1\|3011651_3012626_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
AYY28346.1\|3012648_3014124_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AYY28347.1\|3014332_3016249_-	stage V sporulation protein D	NA	NA	NA	NA
AYY28348.1\|3016330_3018430_-	penicillin-binding protein	NA	NA	NA	NA
AYY28349.1\|3018502_3018865_-	cell division protein FtsL	NA	NA	NA	NA
AYY28350.1\|3018880_3019813_-	ribosomal RNA small subunit methyltransferase H	NA	NA	NA	NA
AYY28351.1\|3020181_3021798_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
AYY28352.1\|3021877_3022768_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AYY28353.1\|3023061_3023535_+	N-acetyltransferase	NA	NA	NA	NA
AYY28354.1\|3023569_3024076_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	1.0e-11	35.5
AYY28355.1\|3024205_3024379_-	50S ribosomal protein L32	NA	NA	NA	NA
AYY28356.1\|3024440_3024941_-	DUF177 domain-containing protein	NA	NA	NA	NA
AYY28357.1\|3025214_3025832_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	4.7e-83	79.5
AYY28358.1\|3025773_3026958_-	cell division protein FtsK	A0A288WFS1	Bacillus_phage	1.8e-144	62.7
AYY28359.1\|3027076_3027259_-	hypothetical protein	A0A288WGN6	Bacillus_phage	2.4e-19	78.3
AYY28360.1\|3027255_3027558_-	hypothetical protein	H0USY0	Bacillus_phage	3.1e-24	54.6
AYY28361.1\|3027742_3027964_+	XRE family transcriptional regulator	Q2I8E4	Bacillus_phage	7.6e-28	90.4
AYY28362.1\|3027956_3028448_+	hypothetical protein	Q3HL01	Bacillus_phage	5.1e-72	89.6
AYY28363.1\|3028485_3029271_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	2.1e-35	84.3
3029027:3029042	attL	NA	NA	NA	NA
AYY28364.1\|3029287_3029518_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.4e-32	94.7
AYY28365.1\|3029560_3029800_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
AYY28366.1\|3029815_3030775_-\|integrase	site-specific integrase	D2XR30	Bacillus_phage	7.1e-171	92.2
AYY28367.1\|3031010_3032204_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-218	100.0
AYY28368.1\|3032489_3036392_-	peptidase S74	Q2I8E8	Bacillus_phage	0.0e+00	86.1
AYY28369.1\|3036388_3037879_-\|tail	phage tail family protein	A0A2H4JC38	uncultured_Caudovirales_phage	9.1e-274	91.1
AYY28370.1\|3037893_3040512_-\|tail	phage tail tape measure protein	A0A288WFS3	Bacillus_phage	9.4e-282	96.0
AYY28371.1\|3040687_3042004_-\|tail	phage tail tape measure protein	A0A288WG36	Bacillus_phage	5.7e-163	96.5
AYY28372.1\|3042225_3042543_-	hypothetical protein	A0A288WFU2	Bacillus_phage	3.7e-52	97.1
AYY28373.1\|3042591_3043197_-\|tail	phage tail protein	A0A288WG55	Bacillus_phage	5.1e-98	91.0
AYY28374.1\|3043197_3043557_-	DUF3168 domain-containing protein	A0A2H4JAR3	uncultured_Caudovirales_phage	9.4e-60	96.6
AYY28375.1\|3043553_3043988_-	hypothetical protein	H0USW9	Bacillus_phage	1.2e-72	93.1
AYY28376.1\|3043980_3044304_-\|head,tail	head-tail adaptor protein	A0A2H4J374	uncultured_Caudovirales_phage	1.3e-55	97.2
AYY28377.1\|3044300_3044579_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J6E5	uncultured_Caudovirales_phage	9.6e-44	98.9
AYY28378.1\|3044599_3045772_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	8.4e-198	90.0
AYY28379.1\|3045809_3046520_-\|protease	Clp protease ClpP	W8CYT5	Bacillus_phage	1.1e-123	94.5
AYY28380.1\|3046506_3047760_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	1.5e-237	97.6
AYY28381.1\|3047948_3049643_-\|terminase	terminase large subunit	A0A2H4JB98	uncultured_Caudovirales_phage	0.0e+00	100.0
AYY28382.1\|3049644_3050148_-\|terminase	phage terminase small subunit P27 family	A0A2H4J8E3	uncultured_Caudovirales_phage	2.3e-88	100.0
AYY28383.1\|3050277_3050655_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	2.6e-68	98.4
AYY28384.1\|3050991_3051246_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	1.6e-37	84.5
AYY28385.1\|3051265_3051457_-	hypothetical protein	Q3HKW9	Bacillus_phage	2.1e-18	74.6
AYY28386.1\|3051589_3051802_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.5e-28	92.9
AYY28387.1\|3051788_3052064_-	hypothetical protein	A0A1B1P7X2	Bacillus_phage	3.9e-21	61.8
AYY28388.1\|3052094_3052841_-	site-specific DNA-methyltransferase	A0A0H3UZL7	Geobacillus_virus	1.2e-80	59.4
AYY28389.1\|3053365_3053908_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	92.2
AYY28390.1\|3053907_3054390_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.4e-73	83.1
AYY28391.1\|3054705_3054828_-	DUF3983 domain-containing protein	NA	NA	NA	NA
AYY28392.1\|3054845_3055175_-	permease	NA	NA	NA	NA
AYY28393.1\|3055651_3056029_-	hypothetical protein	A0A0S2MVH4	Bacillus_phage	1.3e-32	79.1
AYY28394.1\|3056066_3056264_-	hypothetical protein	A0A1B1P864	Bacillus_phage	2.4e-25	86.2
AYY28395.1\|3056515_3056791_+	hypothetical protein	NA	NA	NA	NA
AYY28396.1\|3057152_3057761_-	hypothetical protein	A0A0A7AQW7	Bacillus_phage	3.7e-80	73.4
AYY28397.1\|3057798_3058071_-	hypothetical protein	D2XR50	Bacillus_phage	1.2e-22	62.1
AYY30557.1\|3058109_3058592_-	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
AYY28398.1\|3058607_3059027_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	2.2e-15	44.2
AYY28399.1\|3059039_3059294_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.1e-38	92.9
AYY28400.1\|3059308_3059482_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
AYY28401.1\|3059507_3059702_-	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.5e-24	84.4
AYY28402.1\|3059716_3060520_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	1.9e-145	98.5
AYY28403.1\|3060488_3061268_-	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	1.8e-79	76.4
AYY28404.1\|3061699_3061900_-	DNA-binding protein	A0A0U4IIS1	Bacillus_phage	5.1e-07	48.0
AYY28405.1\|3062009_3062204_-	XRE family transcriptional regulator	A0A0A7AQV9	Bacillus_phage	1.2e-05	45.2
AYY28406.1\|3062372_3062729_+	XRE family transcriptional regulator	A0A0P0IZG9	Lactobacillus_phage	1.9e-12	39.6
AYY28407.1\|3062725_3062908_-	hypothetical protein	NA	NA	NA	NA
AYY28408.1\|3063049_3063184_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AYY28409.1\|3063185_3064331_-	hypothetical protein	H0UST6	Bacillus_phage	1.1e-58	33.2
AYY28410.1\|3064767_3065112_+	XRE family transcriptional regulator	A8ASM2	Listeria_phage	1.3e-05	28.9
AYY28411.1\|3065201_3065381_-	hypothetical protein	NA	NA	NA	NA
AYY28412.1\|3065657_3065963_-	DUF4325 domain-containing protein	J7KJ12	Streptococcus_phage	4.8e-12	45.2
AYY28413.1\|3065953_3066856_-	ATP-binding protein	NA	NA	NA	NA
AYY28414.1\|3067084_3068215_+\|integrase	site-specific integrase	A0A0U4JNS1	Bacillus_phage	3.1e-64	38.8
AYY28415.1\|3068364_3069591_+	nucleotidyltransferase	NA	NA	NA	NA
AYY28416.1\|3069620_3070643_-	PDZ domain-containing protein	NA	NA	NA	NA
AYY28417.1\|3070635_3071427_-	patatin family protein	A0A1V0SCG0	Catovirus	3.1e-10	29.0
AYY28418.1\|3071540_3072770_+	sporulation integral membrane protein YlbJ	NA	NA	NA	NA
AYY28419.1\|3072761_3073253_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	8.5e-27	42.9
AYY28420.1\|3073249_3073816_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
AYY28421.1\|3074319_3074709_+	methylthioribose kinase	NA	NA	NA	NA
AYY28422.1\|3074782_3075939_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7
3078499:3078514	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4034742 : 4086996

Streptococcus_phage(21.43%)

coat,tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY29401.1\|4034742_4034991_-\|coat	spore coat protein	NA	NA	NA	NA
AYY29402.1\|4035004_4035190_-	hypothetical protein	NA	NA	NA	NA
AYY29403.1\|4035336_4036050_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AYY29404.1\|4036469_4036757_-	DUF2178 domain-containing protein	NA	NA	NA	NA
AYY29405.1\|4036753_4036981_-	transcriptional regulator	A0A1V0E021	Clostridioides_phage	3.4e-07	45.6
AYY29406.1\|4037162_4037729_-	permease	NA	NA	NA	NA
AYY29407.1\|4037827_4038385_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AYY29408.1\|4038388_4039111_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	2.5e-11	31.4
AYY29409.1\|4039272_4041057_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AYY29410.1\|4041130_4041313_-	hypothetical protein	NA	NA	NA	NA
AYY29411.1\|4041444_4042617_-	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
AYY29412.1\|4042638_4045020_-	3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase family protein	NA	NA	NA	NA
AYY29413.1\|4045255_4045390_+	YuzL family protein	NA	NA	NA	NA
AYY29414.1\|4045443_4045626_-	hypothetical protein	NA	NA	NA	NA
AYY29415.1\|4045640_4046480_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
AYY29416.1\|4046502_4047420_-	proline dehydrogenase	A0A2H4PQT6	Staphylococcus_phage	1.0e-65	43.9
AYY29417.1\|4047730_4047976_-	DUF2573 family protein	NA	NA	NA	NA
AYY29418.1\|4048023_4048326_-	MTH1187 family thiamine-binding protein	NA	NA	NA	NA
AYY29419.1\|4048403_4050404_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.3e-12	51.1
AYY29420.1\|4050562_4051693_-\|transposase	transposase	D2XQ03	Bacillus_virus	4.7e-73	43.2
AYY29421.1\|4052505_4053264_+	TrmB family transcriptional regulator	NA	NA	NA	NA
AYY29422.1\|4053294_4055178_-	TQXA domain-containing protein	NA	NA	NA	NA
AYY30598.1\|4055698_4056883_-	MFS transporter	NA	NA	NA	NA
AYY29423.1\|4057281_4057989_+	hypothetical protein	NA	NA	NA	NA
AYY29424.1\|4058056_4059271_+	hypothetical protein	NA	NA	NA	NA
AYY29425.1\|4059395_4060709_-	amino acid permease	NA	NA	NA	NA
AYY29426.1\|4060957_4062505_-\|transposase	transposase	D5GVD8	Campylobacter_virus	3.2e-11	26.6
AYY29427.1\|4063078_4063306_+	hypothetical protein	NA	NA	NA	NA
AYY29428.1\|4063387_4064203_-	hypothetical protein	NA	NA	NA	NA
AYY29429.1\|4064411_4065567_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7
AYY29430.1\|4065628_4066411_-	membrane protein insertase YidC	NA	NA	NA	NA
AYY29431.1\|4066439_4066724_-	hypothetical protein	NA	NA	NA	NA
AYY29432.1\|4067001_4067895_+	YitT family protein	M1Q1P6	Streptococcus_phage	3.8e-25	32.6
AYY29433.1\|4067994_4068516_-	N-acetyltransferase	D0R097	Streptococcus_phage	3.9e-54	57.2
AYY29434.1\|4068580_4068832_-	hypothetical protein	NA	NA	NA	NA
AYY29435.1\|4068978_4069365_+	DUF3938 domain-containing protein	NA	NA	NA	NA
AYY29436.1\|4069560_4069701_-	DUF3985 domain-containing protein	NA	NA	NA	NA
AYY30599.1\|4069802_4070855_-	M50 family peptidase	NA	NA	NA	NA
AYY30600.1\|4070897_4071605_-	DUF3169 family protein	NA	NA	NA	NA
AYY29437.1\|4071594_4071816_-	transcriptional regulator	NA	NA	NA	NA
AYY29438.1\|4072014_4072629_-	DedA family protein	NA	NA	NA	NA
AYY29439.1\|4073033_4073477_+	DUF3978 domain-containing protein	NA	NA	NA	NA
AYY29440.1\|4073507_4073969_+	L,D-transpeptidase	NA	NA	NA	NA
AYY29441.1\|4074333_4074999_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.8e-35	33.5
AYY29442.1\|4074976_4076419_+	sensor histidine kinase	W8CYF6	Bacillus_phage	2.6e-15	25.2
AYY29443.1\|4076558_4077461_+	DMT family transporter	NA	NA	NA	NA
AYY29444.1\|4077533_4077788_+	hypothetical protein	NA	NA	NA	NA
AYY29445.1\|4077829_4079464_-\|tRNA	methionine--tRNA ligase	H2EDI7	Moumouvirus	5.2e-73	32.6
AYY29446.1\|4079899_4080718_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AYY29447.1\|4081131_4082826_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-10	27.4
AYY29448.1\|4083050_4084742_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.7e-13	29.5
AYY29449.1\|4084860_4085178_+	metal-sulfur cluster assembly factor	NA	NA	NA	NA
AYY29450.1\|4085220_4086996_-\|protease	neutral protease NprB	NA	NA	NA	NA

DBSCAN-SWA_7

4811633 : 4819582

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY30118.1\|4811633_4811918_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
AYY30119.1\|4811956_4813591_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
AYY30120.1\|4813998_4815537_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.8e-22	31.2
AYY30121.1\|4815921_4817247_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
AYY30122.1\|4817391_4818093_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	7.3e-40	36.9
AYY30123.1\|4818076_4819582_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	2.4e-32	31.3

DBSCAN-SWA_8

4864939 : 4873312

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY30141.1\|4864939_4866247_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5
AYY30142.1\|4866335_4867055_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
AYY30143.1\|4867047_4867302_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AYY30144.1\|4867298_4867982_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AYY30145.1\|4867965_4870185_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.2
AYY30146.1\|4870169_4871585_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.4
AYY30147.1\|4871687_4872728_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.9
AYY30148.1\|4872724_4873312_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP033790

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

5577 : 52996

Bacillus_phage(70.49%)

capsid,tail,terminase,portal,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY25278.1\|5577_6189_-	DUF4352 domain-containing protein	D2XQ09	Bacillus_virus	7.2e-68	99.0
AYY25279.1\|6511_6829_-	XRE family transcriptional regulator	B5LPU3	Bacillus_virus	1.2e-50	94.3
AYY25280.1\|7396_8548_+	hypothetical protein	A0A0S2MVK2	Bacillus_phage	4.5e-55	34.2
AYY25281.1\|8588_8735_+	complement C1q protein	NA	NA	NA	NA
AYY25336.1\|9055_9406_-	XRE family transcriptional regulator	A0A0U3SD25	Bacillus_phage	2.9e-21	46.9
AYY25282.1\|9537_9759_+	XRE family transcriptional regulator	Q0H243	Geobacillus_phage	1.3e-06	44.8
AYY25283.1\|9798_10575_+	phage repressor protein/antirepressor Ant	A0A2H4PQV4	Staphylococcus_phage	1.2e-72	53.1
AYY25284.1\|10691_11543_+	hypothetical protein	A0A141E1C9	Streptococcus_phage	4.0e-32	37.6
AYY25285.1\|12299_12548_+	hypothetical protein	A0A1B1P8A5	Bacillus_phage	5.9e-37	84.1
AYY25286.1\|12548_13292_+	DnaD domain protein	A0A1B1P7T6	Bacillus_phage	6.5e-71	78.3
AYY25287.1\|13233_14106_+	ATP-binding protein	A0A097PAQ0	Streptococcus_pyogenes_phage	3.8e-14	25.6
AYY25288.1\|14125_14599_+	hypothetical protein	A0A1B1P8D4	Bacillus_phage	3.0e-82	98.1
AYY25289.1\|14585_14777_+	hypothetical protein	B5LPM2	Bacillus_virus	4.6e-29	95.2
AYY25290.1\|14773_15055_+	hypothetical protein	B5LPM3	Bacillus_virus	1.0e-45	100.0
AYY25291.1\|15065_15491_+	nucleoside permease	A0A1B1P8B9	Bacillus_phage	1.4e-78	100.0
AYY25292.1\|15516_15978_+	hypothetical protein	B5LPM5	Bacillus_virus	8.7e-58	98.7
AYY25293.1\|15980_16361_+	hypothetical protein	B5LPM6	Bacillus_virus	4.6e-65	98.4
AYY25338.1\|17049_17190_+	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	4.1e-19	97.8
AYY25294.1\|17173_17368_+	hypothetical protein	A0A1B1P7U9	Bacillus_phage	8.8e-20	76.6
AYY25337.1\|17452_17689_+	glutaredoxin family protein	B5LPN1	Bacillus_virus	4.3e-21	66.7
AYY25295.1\|17879_18362_+	deoxyuridine 5'-triphosphate nucleotidohydrolase	A0A1B1P8C0	Bacillus_phage	1.9e-71	85.6
AYY25339.1\|18571_18826_+	hypothetical protein	A0A218KBU4	Bacillus_phage	1.1e-14	44.0
AYY25296.1\|18864_19050_+	calcium ABC transporter ATPase	NA	NA	NA	NA
AYY25297.1\|19087_19372_+	hypothetical protein	A0A1B1P8C3	Bacillus_phage	2.8e-43	95.7
AYY25298.1\|19696_19918_+	hypothetical protein	D2XR53	Bacillus_phage	2.0e-36	100.0
AYY25299.1\|19949_20378_+	hypothetical protein	NA	NA	NA	NA
AYY25300.1\|20401_20599_+	hypothetical protein	A0A1B1P864	Bacillus_phage	9.5e-30	100.0
AYY25301.1\|20637_20901_+	hypothetical protein	A0A1B1P871	Bacillus_phage	1.8e-39	100.0
AYY25302.1\|20998_21274_+	hypothetical protein	A0A1B1P870	Bacillus_phage	1.2e-46	100.0
AYY25303.1\|22165_22588_+	DUF1064 domain-containing protein	A0A1B1P859	Bacillus_phage	1.6e-74	100.0
AYY25304.1\|22568_22775_+	hypothetical protein	A0A1B1P854	Bacillus_phage	1.0e-34	100.0
AYY25305.1\|22913_23297_+	ArpU family transcriptional regulator	A0A1B1P853	Bacillus_phage	1.8e-64	100.0
AYY25306.1\|24534_24810_+	hypothetical protein	A0A1B1P857	Bacillus_phage	2.9e-45	100.0
AYY25307.1\|24843_25227_+	hypothetical protein	A0A1B1P874	Bacillus_phage	9.7e-63	100.0
AYY25308.1\|25320_25542_+	hypothetical protein	A0A1B1P881	Bacillus_phage	3.0e-32	100.0
AYY25309.1\|26130_26352_+	hypothetical protein	A0A1B1P880	Bacillus_phage	1.4e-34	100.0
AYY25310.1\|26395_26614_+	hypothetical protein	A0A1B1P884	Bacillus_phage	2.7e-33	100.0
AYY25311.1\|26610_26826_+	hypothetical protein	A0A1B1P862	Bacillus_phage	5.0e-32	100.0
AYY25312.1\|26909_27800_+\|terminase	terminase	A0A1B1P867	Bacillus_phage	1.8e-160	99.7
AYY25313.1\|27783_29082_+\|terminase	PBSX family phage terminase large subunit	A0A1B1P869	Bacillus_phage	2.3e-257	100.0
AYY25314.1\|29097_30600_+\|portal	phage portal protein	A0A1B1P863	Bacillus_phage	1.7e-275	100.0
AYY25315.1\|30599_31721_+\|capsid	minor capsid protein	A0A1B1P858	Bacillus_phage	1.8e-202	99.7
AYY25316.1\|31732_32365_+	hypothetical protein	A0A1B1P865	Bacillus_phage	2.5e-92	100.0
AYY25317.1\|32392_33295_+\|capsid	capsid protein	A0A1B1P885	Bacillus_phage	2.2e-169	100.0
AYY25318.1\|33346_33601_+	hypothetical protein	A0A1B1P891	Bacillus_phage	7.7e-24	100.0
AYY25319.1\|33609_34011_+	hypothetical protein	A0A1B1P889	Bacillus_phage	3.9e-70	100.0
AYY25320.1\|34003_34360_+\|capsid	minor capsid protein	A0A1B1P893	Bacillus_phage	2.2e-64	100.0
AYY25321.1\|34356_34707_+\|capsid	minor capsid protein	A0A1B1P872	Bacillus_phage	1.7e-61	100.0
AYY25322.1\|34718_35141_+\|capsid	minor capsid protein	A0A1B1P879	Bacillus_phage	4.3e-72	100.0
AYY25340.1\|35157_35586_+\|capsid	capsid protein	A0A1B1P877	Bacillus_phage	2.3e-65	100.0
AYY25323.1\|35661_36066_+	hypothetical protein	A0A1B1P876	Bacillus_phage	7.3e-69	100.0
AYY25324.1\|36077_36740_+	hypothetical protein	A0A1B1P868	Bacillus_phage	2.2e-115	100.0
AYY25325.1\|36732_40665_+	carbamoyl-phosphate synthase large subunit	A0A1B1P873	Bacillus_phage	0.0e+00	100.0
AYY25326.1\|40714_42193_+\|tail	phage tail family protein	A0A1B1P894	Bacillus_phage	3.2e-295	100.0
AYY25327.1\|42192_45762_+	peptidase S74	A0A1B1P8A2	Bacillus_phage	0.0e+00	98.5
AYY25328.1\|47330_47846_+	hypothetical protein	A0A1B1P805	Bacillus_phage	5.5e-69	73.1
AYY25329.1\|48083_48320_+	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.2e-18	100.0
AYY25330.1\|48319_48559_+\|holin	holin	A0A2H4J378	uncultured_Caudovirales_phage	1.7e-33	98.7
AYY25331.1\|48555_49620_+	N-acetylmuramoyl-L-alanine amidase	A0A2H4JAS1	uncultured_Caudovirales_phage	2.9e-197	94.6
AYY25332.1\|49655_50030_-	hypothetical protein	D2XQ01	Bacillus_virus	6.6e-64	98.4
AYY25333.1\|50154_50376_-	XRE family transcriptional regulator	A0A0S2GLH4	Bacillus_phage	1.7e-27	78.1
AYY25334.1\|50675_51974_+	cell division protein FtsK	B3RH36	Bacillus_virus	8.9e-108	45.9
AYY25341.1\|51912_52488_+	hypothetical protein	B3RH37	Bacillus_virus	3.0e-68	64.2
AYY25335.1\|52507_52996_+	hypothetical protein	A6XML4	Bacillus_virus	6.7e-16	53.8

Anti-CRISPR protein detection

Acr_ID: CP033790.1|AYY25280.1|7396_8548_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: CP033790.1|AYY25281.1|8588_8735_+|complement-C1q-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP033790.1|AYY25280.1|7396_8548_+|hypothetical-protein

7396_8548_+

383 aa aa

5577-52996

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP033789_1	TypeV-U3,TypeI-A?	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	52303-52269	2
CP033789_1	TypeV-U3,TypeI-A?	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	52304-52269	2

1. spacer 1.1|192921|35|CP033789|PILER-CR matches to CP033790 position: 52303-52269, mismatch: 2

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctccacgatgtgataacggccattatcc	Protospacer
**********.**.*********************

2. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to CP033790 position: 52304-52269, mismatch: 2

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctccacgatgtgataacggccattatcc	Protospacer
***********.**.*********************

CP033790.1|AYY25281.1|8588_8735_+|complement-C1q-protein

8588_8735_+

48 aa aa

5577-52996

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP033789_1	TypeV-U3,TypeI-A?	1.1\|192921\|35\|CP033789\|PILER-CR	192921-192955	35	52303-52269	2
CP033789_1	TypeV-U3,TypeI-A?	1.3\|192920\|36\|CP033789\|CRISPRCasFinder	192920-192955	36	52304-52269	2

1. spacer 1.1|192921|35|CP033789|PILER-CR matches to CP033790 position: 52303-52269, mismatch: 2

gatccacctctacaatgtgataacggccattatcc	CRISPR spacer
gatccacctccacgatgtgataacggccattatcc	Protospacer
**********.**.*********************

2. spacer 1.3|192920|36|CP033789|CRISPRCasFinder matches to CP033790 position: 52304-52269, mismatch: 2

tgatccacctctacaatgtgataacggccattatcc	CRISPR spacer
tgatccacctccacgatgtgataacggccattatcc	Protospacer
***********.**.*********************

4. CP033793

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12463

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY25418.1\|159_393_+	XRE family transcriptional regulator	NA	NA	NA	NA
AYY25365.1\|574_2839_+	TQXA domain-containing protein	NA	NA	NA	NA
AYY25366.1\|2873_3059_+	hypothetical protein	NA	NA	NA	NA
AYY25367.1\|3091_3628_+	DUF87 domain-containing protein	NA	NA	NA	NA
AYY25368.1\|3688_3913_+	hypothetical protein	NA	NA	NA	NA
AYY25369.1\|3983_4211_+	hypothetical protein	NA	NA	NA	NA
AYY25370.1\|4243_7048_+	ATP-binding protein	NA	NA	NA	NA
AYY25371.1\|7053_7896_+	hypothetical protein	NA	NA	NA	NA
AYY25372.1\|7900_8116_+	hypothetical protein	NA	NA	NA	NA
AYY25373.1\|8118_9096_+	conjugal transfer protein	NA	NA	NA	NA
AYY25374.1\|9105_9357_+	hypothetical protein	NA	NA	NA	NA
AYY25375.1\|9384_9933_+	conjugal transfer protein	NA	NA	NA	NA
AYY25376.1\|9892_12463_+	recombinase RmuC	A0A1S5SF64	Streptococcus_phage	2.2e-86	28.6

DBSCAN-SWA_2

18794 : 22459

Clostridium_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY25383.1\|18794_19355_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.3e-31	42.1
AYY25384.1\|19498_22459_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.2e-211	40.0

DBSCAN-SWA_3

27418 : 29829

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY25390.1\|27418_27991_+	recombinase	A0A1B1P7Y2	Bacillus_phage	1.4e-33	44.4
AYY25391.1\|28008_28260_+	hypothetical protein	NA	NA	NA	NA
AYY25392.1\|28282_28717_+	sporulation protein	F8WPS9	Bacillus_phage	1.8e-33	52.1
AYY25393.1\|28959_29829_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A0H3UYZ1	Geobacillus_virus	1.8e-35	31.8

DBSCAN-SWA_4

33752 : 39121

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AYY25399.1\|33752_34520_-	restriction endonuclease	Q331T5	Clostridium_botulinum_C_phage	5.6e-09	32.0
AYY25400.1\|34600_35026_-	hypothetical protein	NA	NA	NA	NA
AYY25401.1\|35379_35712_+	hypothetical protein	O48480	Bacillus_phage	1.6e-08	44.2
AYY25402.1\|35829_36192_+	glycosyltransferase	W8EK86	Geobacillus_phage	1.0e-37	67.5
AYY25403.1\|36206_36560_+	hypothetical protein	A0A2I7QIL8	Bacillus_phage	1.3e-29	54.7
AYY25404.1\|36562_39121_+	ATP-binding protein	W8EEX6	Geobacillus_phage	0.0e+00	74.5

DBSCAN-SWA_5

45443 : 51477

Bacillus_phage(66.67%)

integrase

attL 36727:36742|attR 51328:51343

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
36727:36742	attL	NA	NA	NA	NA
AYY25412.1\|45443_45725_-	DNA-binding protein	A0A142F1N8	Bacillus_phage	6.1e-06	55.0
AYY25422.1\|45708_46134_-	hypothetical protein	NA	NA	NA	NA
AYY25413.1\|46179_46623_-	molecular chaperone DnaJ	NA	NA	NA	NA
AYY25414.1\|46821_47748_-\|integrase	site-specific integrase	A0A1B1P793	Bacillus_phage	9.6e-72	45.6
AYY25415.1\|48821_49823_-	Replicase RepFR55	NA	NA	NA	NA
AYY25416.1\|50352_51477_+	XRE family transcriptional regulator	D2XQ10	Bacillus_virus	3.5e-52	33.9
51328:51343	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP033789

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP033795

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP033790

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

4. CP033793

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection