CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP029250	Lactobacillus delbrueckii subsp. lactis isolate NWC_1_2 chromosome, complete genome	3 crisprs	cas14j,cas14k,Cas14u_CAS-V,cas3,DEDDh,cas5,cas8c,cas7,cas4,cas2,DinG,cas1,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6,c2c9_V-U4,csa3	1	13	20	2
CP029251	Lactobacillus delbrueckii subsp. lactis isolate NWC_1_2 plasmid p1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029250_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029250_2

950430-951207

TypeI

Consensus_repeat	Method
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	PILER-CR
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	CRISPRCasFinder
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	CRT

11 spacers

cas2,cas4,cas7,cas8c,cas5

The CRISPR arrays of CP029250_2

>merge|CP029250|2|950430-951207|PILER-CR,CRISPRCasFinder,CRT
GTCGCATCCCGCATGGGATGCGTGGATTGAAATGTCGCCCACTTGGGTCACTTGGACAAGCACCATGTGTCGCATCCCGCATGGGATGCGTGGATTGAAATTAGTTAATAGATGGCATCAGCGTGATGATCGCTTGCCGTCGCATCCCGCATGGGATGCGTGGATTGAAATAACGGAAGCAACCCGATACTGCCAGTAACGTCTTGTCGCATCCCGCATGGGATGCGTGGATTGAAATATGACGGGCATCGGCTTAATTTCATGGGCTTTTGATGTCGCATCCCGCATGGGATGCGTGGATTGAAATCAGATAGCCCGGCCTTGTCGAACGTCTCAGCCTGGTCGCATCCCGCATGGGATGCGTGGATTGAAATAACGCTCCTACGGCGTAATCGGCGACCCGGAAAAGGTCGCATCCCGCATGGGATGCGTGGATTGAAATAACTTGATGGCAAGACTTATCCGGTCTACGCTAACGTCGCATCCCGCATGGGATGCGTGGATTGAAATTCAATCCATGCACTGAGAGTAACCGTTTGCCCATGTCGCATCCCGCATGGGATGCGTGGATTGAAATACTGACTGGTGAAGACGTCAACCGCTTGCGTAGGTCGCATCCCGCATGGGATGCGTGGATTGAAATTTCTCCCAATCGCGAAAGTTTGGCTATGACATCATGTCGCATCCCGCATGGGATGCGTGGATTGAAATATTTGCTGGTACAAAAGTAACAGAGTTACAACAAGTCGCATCCCACATAAGATGTGTGGATCGAAAT

>CP029250|2|1|950430-951140|PILER-CR
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	GTCGCCCACTTGGGTCACTTGGACAAGCACCATGT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TAGTTAATAGATGGCATCAGCGTGATGATCGCTTGCC
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACGGAAGCAACCCGATACTGCCAGTAACGTCTT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ATGACGGGCATCGGCTTAATTTCATGGGCTTTTGAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	CAGATAGCCCGGCCTTGTCGAACGTCTCAGCCTG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACGCTCCTACGGCGTAATCGGCGACCCGGAAAAG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACTTGATGGCAAGACTTATCCGGTCTACGCTAAC
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TCAATCCATGCACTGAGAGTAACCGTTTGCCCAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ACTGACTGGTGAAGACGTCAACCGCTTGCGTAG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TTCTCCCAATCGCGAAAGTTTGGCTATGACATCAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT

>CP029250|2|2|950430-951207|CRISPRCasFinder
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	GTCGCCCACTTGGGTCACTTGGACAAGCACCATGT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TAGTTAATAGATGGCATCAGCGTGATGATCGCTTGCC
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACGGAAGCAACCCGATACTGCCAGTAACGTCTT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ATGACGGGCATCGGCTTAATTTCATGGGCTTTTGAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	CAGATAGCCCGGCCTTGTCGAACGTCTCAGCCTG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACGCTCCTACGGCGTAATCGGCGACCCGGAAAAG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACTTGATGGCAAGACTTATCCGGTCTACGCTAAC
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TCAATCCATGCACTGAGAGTAACCGTTTGCCCAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ACTGACTGGTGAAGACGTCAACCGCTTGCGTAG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TTCTCCCAATCGCGAAAGTTTGGCTATGACATCAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ATTTGCTGGTACAAAAGTAACAGAGTTACAACAA
GTCGCATCCCACATAAGATGTGTGGATCGAAAT

>CP029250|2|1|950430-951207|CRT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	GTCGCCCACTTGGGTCACTTGGACAAGCACCATGT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TAGTTAATAGATGGCATCAGCGTGATGATCGCTTGCC
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACGGAAGCAACCCGATACTGCCAGTAACGTCTT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ATGACGGGCATCGGCTTAATTTCATGGGCTTTTGAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	CAGATAGCCCGGCCTTGTCGAACGTCTCAGCCTG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACGCTCCTACGGCGTAATCGGCGACCCGGAAAAG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	AACTTGATGGCAAGACTTATCCGGTCTACGCTAAC
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TCAATCCATGCACTGAGAGTAACCGTTTGCCCAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ACTGACTGGTGAAGACGTCAACCGCTTGCGTAG
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	TTCTCCCAATCGCGAAAGTTTGGCTATGACATCAT
GTCGCATCCCGCATGGGATGCGTGGATTGAAAT	ATTTGCTGGTACAAAAGTAACAGAGTTACAACAA
GTCGCATCCCACATAAGATGTGTGGATCGAAAT

Protein	Signature genes	Signature genes Name	Protein_function
CP029250.1\|AZA25180.1\|955063_956422_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377697
CP029250.1\|AZA25177.1\|951403_952504_+\|acetyl-CoA-C-acyltransferase	unknown	unknown	gnl\|CDD\|238383
CP029250.1\|AZA26219.1\|944518_945373_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	cas7	COG3649_cas7_CAS-I-C	gnl\|CDD\|187820
CP029250.1\|AZA25179.1\|953736_954900_+\|hydroxymethylglutaryl-CoA-synthase	unknown	unknown	gnl\|CDD\|213655
CP029250.1\|AZA26220.1\|948508_948799_+\|CRISPR-associated-endonuclease-Cas2	cas2	cd09725_cas2_CAS-I:CAS-II:CAS-III:CAS-V	gnl\|CDD\|187856
CP029250.1\|AZA25183.1\|958132_960394_+\|GTP-pyrophosphokinase	unknown	unknown	gnl\|CDD\|223394
CP029250.1\|AZA25176.1\|946799_947849_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
CP029250.1\|AZA25184.1\|960422_960860_+\|D-tyrosyl-tRNA(Tyr)-deacylase	unknown	unknown	gnl\|CDD\|235383
CP029250.1\|AZA25174.1\|945377_945821_+\|CRISPR-associated-protein-Cas4	cas4	cd09637_cas4_CAS-I:CAS-II:CAS-V	gnl\|CDD\|273040
CP029250.1\|AZA25182.1\|957047_957992_+\|50S-ribosomal-protein-L11-methyltransferase	unknown	unknown	gnl\|CDD\|234786
CP029250.1\|AZA25170.1\|939000_939348_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|377551
CP029250.1\|AZA25171.1\|939403_939637_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379018
CP029250.1\|AZA25172.1\|941893_942628_+\|type-I-C-CRISPR-associated-protein-Cas5	cas5	cd09752_cas5_CAS-I-C	gnl\|CDD\|187782
CP029250.1\|AZA25181.1\|956478_956985_-\|Cys-tRNA(Pro)-deacylase	unknown	unknown	gnl\|CDD\|237976
CP029250.1\|AZA25173.1\|942624_944499_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	cas8c	pfam09709_cas8c_CAS-I-C	gnl\|CDD\|378245
CP029250.1\|AZA25178.1\|952506_953733_+\|hydroxymethylglutaryl-CoA-reductase,-degradative	unknown	unknown	gnl\|CDD\|153082
CP029250.1\|AZA26221.1\|949094_950357_+\|IS3-family-transposase-ISL6	unknown	unknown	gnl\|CDD\|222853
CP029250.1\|AZA25185.1\|961144_962431_+\|histidine--tRNA-ligase	unknown	unknown	gnl\|CDD\|273080
CP029250.1\|AZA25175.1\|945960_946215_+\|hypothetical-protein	cas4	pfam01930_cas4_CAS-I	gnl\|CDD\|224385
CP029250.1\|AZA25186.1\|962446_964291_+\|aspartate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234775

Protein	Function_ID	Function_description	E-value
CP029250.1\|AZA25180.1\|955063_956422_+\|hypothetical-protein	gnl\|CDD\|377697	pfam06738, ThrE, Putative threonine/serine exporter. ThrE is a family of bacterial and Archaeal proteins that catalyze the export of L-threonine from the cell. UniProtKB:Q79VD1 has been characterized as being necessary for this export. The domain exhibits 10 putative TMs and catalyzes the proton-motive-force-dependent efflux of threonine and serine.	1.01642e-64
CP029250.1\|AZA25177.1\|951403_952504_+\|acetyl-CoA-C-acyltransferase	gnl\|CDD\|238383	cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine. They are found in prokaryotes and eukaryotes (cytosol, microbodies and mitochondria). There are 2 functional different classes: thiolase-I (3-ketoacyl-CoA thiolase) and thiolase-II (acetoacetyl-CoA thiolase). Thiolase-I can cleave longer fatty acid molecules and plays an important role in the beta-oxidative degradation of fatty acids. Thiolase-II has a high substrate specificity. Although it can cleave acetoacyl-CoA, its main function is the synthesis of acetoacyl-CoA from two molecules of acetyl-CoA, which gives it importance in several biosynthetic pathways.	4.74999e-160
CP029250.1\|AZA26219.1\|944518_945373_+\|type-I-C-CRISPR-associated-protein-Cas7/Csd2	gnl\|CDD\|187820	cd09689, Cas7_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas7. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas7 is a RAMP superfamily protein; Subunit of the Cascade complex; also known as Csd2 family.	1.36191e-107
CP029250.1\|AZA25179.1\|953736_954900_+\|hydroxymethylglutaryl-CoA-synthase	gnl\|CDD\|213655	TIGR01835, 3-hydroxy-3-methylglutaryl_CoA_synthase, 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade. This clade of hydroxymethylglutaryl-CoA (HMG-CoA) synthases is found in a limited spectrum of mostly gram-positive bacteria which make isopentenyl pyrophosphate (IPP) via the mevalonate pathway. This pathway is found primarily in eukaryotes and archaea, but the bacterial homologs are distinct, having aparrently diverged after being laterally transferred from an early eukaryote. HMG-CoA synthase is the first step in the pathway and joins acetyl-CoA with acetoacetyl-CoA with the release of one molecule of CoA. The Borellia sequence may have resulted from a separate lateral transfer event.	9.16099e-131
CP029250.1\|AZA26220.1\|948508_948799_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|187856	cd09725, Cas2_I_II_III, CRISPR/Cas system-associated protein Cas2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas2 is present in majority of CRISPR/Cas systems along with Cas1; RNAse specific to U-rich regions; Possesses an RRM/ferredoxin fold.	2.54047e-25
CP029250.1\|AZA25183.1\|958132_960394_+\|GTP-pyrophosphokinase	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	0
CP029250.1\|AZA25176.1\|946799_947849_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.21651e-69
CP029250.1\|AZA25184.1\|960422_960860_+\|D-tyrosyl-tRNA(Tyr)-deacylase	gnl\|CDD\|235383	PRK05273, PRK05273, D-tyrosyl-tRNA(Tyr) deacylase; Provisional.	5.77324e-87
CP029250.1\|AZA25174.1\|945377_945821_+\|CRISPR-associated-protein-Cas4	gnl\|CDD\|273040	TIGR00372, conserved_hypothetical_protein, CRISPR-associated protein Cas4. This model represents a family of proteins associated with CRISPR repeats in a wide set of prokaryotic genomes. This scope of this model has been broadened since it was first built to describe an archaeal subset only. The function of the protein is undefined. Distantly related proteins, excluded from this model, include ORFs from Mycobacteriophage D29 and Sulfolobus islandicus filamentous virus and a region of the Schizosaccharomyces pombe DNA replication helicase Dna2p.	8.42977e-15
CP029250.1\|AZA25182.1\|957047_957992_+\|50S-ribosomal-protein-L11-methyltransferase	gnl\|CDD\|234786	PRK00517, prmA, 50S ribosomal protein L11 methyltransferase.	4.47612e-92
CP029250.1\|AZA25170.1\|939000_939348_+\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	5.1801e-45
CP029250.1\|AZA25171.1\|939403_939637_+\|hypothetical-protein	gnl\|CDD\|379018	pfam13007, LZ_Tnp_IS66, Transposase C of IS166 homeodomain. This is a leucine-zipper-like or homeodomain-like region of transposase TnpC of insertion element IS66.	3.66552e-07
CP029250.1\|AZA25172.1\|941893_942628_+\|type-I-C-CRISPR-associated-protein-Cas5	gnl\|CDD\|187782	cd09651, Cas5_I-C, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex; in subtype I-C this protein might be the endoribonuclease that generates crRNAs; also known as DevS family.	4.6317e-89
CP029250.1\|AZA25181.1\|956478_956985_-\|Cys-tRNA(Pro)-deacylase	gnl\|CDD\|237976	cd00002, YbaK_deacylase, This CD includes cysteinyl-tRNA(Pro) deacylases from Haemophilus influenzae and Escherichia coli and other related bacterial proteins. These trans-acting, single-domain proteins are homologs of ProX and also the cis-acting prolyl-tRNA synthetase (ProRS) inserted (INS) editing domain. The bacterial amino acid trans-editing enzyme YbaK is a deacylase that hydrolyzes cysteinyl-tRNA(Pro)'s mischarged by prolyl-tRNA synthetase. YbaK also hydrolyzes glycyl-tRNA's, alanyl-tRNA's, seryl-tRNA's, and prolyl-tRNA's. YbaK is homologous to the INS domain of prolyl-tRNA synthetase (ProRS) as well as the trans-editing enzyme ProX of Aeropyrum pernix which hydrolyzes alanyl-tRNA's and glycyl-tRNA's.	1.07467e-65
CP029250.1\|AZA25173.1\|942624_944499_+\|type-I-C-CRISPR-associated-protein-Cas8c/Csd1	gnl\|CDD\|378245	pfam09709, Cas_Csd1, CRISPR-associated protein (Cas_Csd1). CRISPR loci appear to be mobile elements with a wide host range. This entry represents proteins that tend to be found near CRISPR repeats. The species range, so far, is exclusively bacterial and mesophilic, although CRISPR loci are particularly common among the archaea and thermophilic bacteria. Clusters of short DNA repeats with nonhomologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins.	4.40224e-95
CP029250.1\|AZA25178.1\|952506_953733_+\|hydroxymethylglutaryl-CoA-reductase,-degradative	gnl\|CDD\|153082	cd00644, HMG-CoA_reductase_classII, Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR). Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class II, prokaryotic enzyme is a homodimer. Class II enzymes are found primarily in prokaryotes and Archaeoglobus fulgidus and are soluble as they lack the membrane region. Enzymes catalyze the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. Bacteria, such as Pseudomonas mevalonii, which rely solely on mevalonate for their carbon source, catalyze the reverse reaction, using an NAD-dependent HMGR to deacetylate mevalonate into 3-hydroxy-3-methylglutaryl-CoA. Human and bacterial HMGR differ in their active site architecture.	0
CP029250.1\|AZA26221.1\|949094_950357_+\|IS3-family-transposase-ISL6	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.30896e-46
CP029250.1\|AZA25185.1\|961144_962431_+\|histidine--tRNA-ligase	gnl\|CDD\|273080	TIGR00442, hisS, histidyl-tRNA synthetase. This model finds a histidyl-tRNA synthetase in every completed genome. Apparent second copies from Bacillus subtilis, Synechocystis sp., and Aquifex aeolicus are slightly shorter, more closely related to each other than to other hisS proteins, and actually serve as regulatory subunits for an enzyme of histidine biosynthesis. They were excluded from the seed alignment and score much lower than do single copy histidyl-tRNA synthetases of other genomes not included in the seed alignment. These putative second copies of HisS score below the trusted cutoff. The regulatory protein kinase GCN2 of Saccharomyces cerevisiae (YDR283c), and related proteins from other species designated eIF-2 alpha kinase, have a domain closely related to histidyl-tRNA synthetase that may serve to detect and respond to uncharged tRNA(his), an indicator of amino acid starvation; these regulatory proteins are not orthologous and so score below the noise cutoff. [Protein synthesis, tRNA aminoacylation].	0
CP029250.1\|AZA25175.1\|945960_946215_+\|hypothetical-protein	gnl\|CDD\|224385	COG1468, COG1468, CRISPR-associated protein Cas4 (RecB family exonuclease) [Defense mechanisms].	5.3464e-09
CP029250.1\|AZA25186.1\|962446_964291_+\|aspartate--tRNA-ligase	gnl\|CDD\|234775	PRK00476, aspS, aspartyl-tRNA synthetase; Validated.	0

>CP029250.1|AZA26221.1|949094_950357_+|IS3-family-transposase-ISL6
MVDLIQKHGEDILDRPQQKYTANFKLAAIDRVLLGGEALSQVSLDLGLTNTGILANWLRSFKESGYTVITKKKGRPPKNAQKQGQTTDQRAGRAGKEAYSRACIHKKIGGLNSRTEEPRKEELARAITELRQELRLSVKYIIDVINANPGLPHISRSNYYYQTHKPDKDSGNQKLMDRIKEIFLEHSRRYGYRRIYGQLRREVYEINHKKVQRLMQKMGLFAISIRKKRKYSSYYGVQGKIKPDLIKRNFYAIIPDRHWFTDVTEFHLKDQKFYLSPIIDGCTQEIISYNISRHPDLKQVMTMLDDAFEKHPALNGLIFHSDRGWQYQHQAYQAALANRGIDQSMSRLGNSLDDGLMEGFFGILKREMFYGQEHKYKDLNELEQAIHKYIDYYNNVRIKTGRKNMTPIEYRNHVLTTLTA
>CP029250.1|AZA26220.1|948508_948799_+|CRISPR-associated-endonuclease-Cas2
MMVIVSYDVNTETASGKKRLRNVSKICNDYGQRVQNSVFECLVDSTKLEEMKERLLKVYDEECDSLYFFNVGKKYENKVQSYGCKQVLDLGKPVVF
>CP029250.1|AZA25176.1|946799_947849_-|IS30-family-transposase
MDHSYSNTKPHQKGKHLTLNDRTTIQELHSKGYSNRAIARELNCSPSTVGYELKRGTVSVYTGNVKRYKAVEGQSTYELHRSECGRKSLFLRRHKFIDYVSHCFHNHGWSLDACVGYALAKGIFQKDQVVSTKTLYNYVDLGLMDIKNGDLPEKVKRNTKTRRARVNKRILGRSIDERSPRIESRKDFGHWECDLVLGHKTKDDDVLLTLCERKTRQFFMIKIEDKTSASVMKAFDKLREYYGSKWNQIFKSITTDNGSEFADLSDLEQVSKTLVYYAHPYTSCDKGSVERHNGLIRRYIPKGDRMDKYSVEDIAKIEVWCNSLPRKILNYKTPEEYFDTELDRIYRRR
>CP029250.1|AZA25175.1|945960_946215_+|hypothetical-protein
MSSNLWEISNYGKTKHRTKVEFTPELRAMLVRTVNEMHQYWDRKYTPKVKPTEKCKSCSLRNICLPSLLKTETVDEYLRRRLDD
>CP029250.1|AZA25174.1|945377_945821_+|CRISPR-associated-protein-Cas4
MAYYEDDFLMISGIQHFVFCRRQWALGHIEDQWEDNYLTLKGDQLHEKADDPFLKESRGSKFIVRAMPIHSVEYGLTGICDIVEFTKDDVNGVPVRGKKEKYLPIPVEYKHGQKKSDHSDELQLLAEAVCLEEMLFCHLEYGYLYYC
>CP029250.1|AZA26219.1|944518_945373_+|type-I-C-CRISPR-associated-protein-Cas7/Csd2
MANVLNHRIDFKVVFSVAGANPNGDPLNGNRPRQTSDGYGEVSDVAIKRKLRNRLQEMGEKIFVQSQDRADDGLKSLKARADSVKELKGQKDESKYQEVACQTWFDVRAFGQVFAFDKGSSVGVRGPVSIQTARSITPIMINDMQITKSVNSKDAAGRSSDTMGMKYSIDYAVYQFNGSINVQLAEKTGFTEEDANAIHEALKTLFYNDESSARPAGSMEVLRVYWWEHKNKLGDESPAKIFRTVEIKPNEGVDVVKSTEDIDWGSADSAAKTIQCDKLDIFED
>CP029250.1|AZA25173.1|942624_944499_+|type-I-C-CRISPR-associated-protein-Cas8c/Csd1
MSWLSEFVDVYDKNEKNLGITSYRIYHPKSGEESKKAYQMLPVSHIFLNCTLQIDLNADGTFAGAFVVDDPKTIVPATIESSIRSGSGSYLVPLPVDDKLQYLARDYSKWSGDEKYIESHKKYLEQFRAYLIFLKEYPDQYVYRTLQAVYRYVTENDIINDLWTGKIFGENVAKEKVAGNNLFKSTVRFNIRNPENVKRFENRRFFDAWTQYYHQVLQTDTVSGGTDEGIDYITGEENVILTSKHPKGILDNAANAKLISANDTTNFTFKGRFLTADEAVTIGYDSSQKAHAAMKWLLTKQGFKIGDRYYLAWEVNGENTADLSIVSQNPLLALAQKKFAETTEIDTNTNIAENFRKVLIDGANKDDYSLQGSVHLIELESPVNGRFGVVYYQAMSLQQYINNLASWYGKITIDDRQSFFNLKQVCYDIYGDRVDDKRMAATVSQLSHMILGSQIVPWSLLSAIYNRAIRPASFNDDKGWRRVMRTASKLFKAYYDEGEIKTMLNDSYHDRSYSFGRLLAIADVIEEGVLQGSENNEGRVTNAKRYMSSFAQRPLDTWKIIYTNLQPYLRKSKYSFKASKLIDEIFASLDAEDKHLNDPLNGKFLIGYSQQRNDWYQKKKTSNE
>CP029250.1|AZA25172.1|941893_942628_+|type-I-C-CRISPR-associated-protein-Cas5
MEENTTFNFKVYGDYALFTDPIMKIGGEKFTYPVPTYQALKGITESIYWKPTIQIYIDKVRVMNPIITEAKDIRVPKYNDMTKTDLSRYTYLKDVEYQVQAHFEFNQNRPDLAGDRNAKKHYAIMKRCIEKGGRRDIFLGTRECQGYVEPCKFGEGESFYDNSDDRLFGTMVHGIDYPDETGRDELGVRLWNVVMKQGVIEFPRPDDETLVRRSLHKLKAKQFSLSNIESVDALYAELLKEGDL
>CP029250.1|AZA25171.1|939403_939637_+|hypothetical-protein
MADKETLDLIETLKANNEELLKQVALLTEQVAYLTNKLYGKSSEKRAVNPDQLSLFEEDNAFQDDEDLPSHYRNYYL
>CP029250.1|AZA25170.1|939000_939348_+|IS66-family-insertion-sequence-hypothetical-protein
MINLAELGRVFIVCGKTDMRRGIDSLAYIVKKSFNLDPFSGCVFLFCGSRRDRFKALYWDGQGFWLLYKRFENGKLAWPNNEDEVRELSDEQVMRLMQGFTIDPKINTARARELY
>CP029250.1|AZA25177.1|951403_952504_+|acetyl-CoA-C-acyltransferase
MQDIYIVAAKRTPFGRYHKQLADFSAIDLGQIALHGALKEAGLDAEALDALFMGNVLSAGLGQNMARQVALNAGMRQDSVAVSINEVCGSSLKAARLAEAQMLIGDLGLVAVGGSESMTNAPKEIMFSDGLVDSFSGKSMGITAENVAKRNHISRQDADAFSLSSHQKAVKAQAEGLFADEIIQIEDLKQDENVRPDTSLEALAGLKTSFLEDGTVTAGNASPISDGASMIILATAEKVAEYQLTPLAKLGAYAEVGYDPEFMGYGPYYAIRKLLNETGRQVADYDFFEINEAFAATTLAVARDLEIPLAKVNKQGGAIALGHPLGASGTRLLATAARQLQRGGQRAIASLCIGGGLAIAFEIEKA
>CP029250.1|AZA25178.1|952506_953733_+|hydroxymethylglutaryl-CoA-reductase,-degradative
MKFYQLPPEERRQFLQEDGVALEDIPAADLARLDEMSENVVGEVKLPLSCLTSALVNGKNWRIPMTTEEASVVAAANHGMSVFAKAGGVKATSQRDGIYGQIVLEVTEAFSLAGFKKEFPAYIKEANKEFASLIRHGGGLKDLTARQEADLVYLLALVDPAEAMGANKTNAILEFLAQKMLAFPGVEAKLFAILSNYPSQLTTAKVAISVSLLSKKGDLAEGREVAKKMALLAKIGSSDPYRAVTNNKGIMNGVDAVMLATGNDYRAVEAACHAYAAKSGQYRSLSSWKLEGENLLGQVTLPLALGVVGGSISSRPDIRQSYAILGKIKAAELAELTASVALANNFAALNAISTKGIQAGHMRLQSRNVVQTLPAAAEEKEAVYQMMISQGKYGETAAKNFLKELRGQ
>CP029250.1|AZA25179.1|953736_954900_+|hydroxymethylglutaryl-CoA-synthase
MDIGIDQIGFYTPNKFVDMVDLANARNQDPNKFLIGIGQDRMAVADKTQDAVSMGINATAEYLDQVDLEQLGLLIFATESGIDQSKSASLFVKEALNLPARIRTFEIKEACFALTASLQVARDYVRAHPHHSAMIIGSDIARYGLATAGEVTQGAGAISMLIKENPAIIALEDGHTSHSENINDFWRPNNLATAVVDGHYSRDVYLDFFKSTFKPFLAEKQLQVSDFAGICYHLPYTKMGYKAHKIAIEGQDDETVKRLSDNFQLSAKYSRQVGNIYTASLYMSVLSLLENGDLEAGDRIGFFSYGSGAMAEFFSGKVVAGYQKRLRPALHARMLKERIRLGVGQYEDIFTEGLEALPENVEFTSDANHGTWYLAGQEGYVRQYKQK
>CP029250.1|AZA25180.1|955063_956422_+|hypothetical-protein
MKTESTEQEYHHHLSHHHHMRVQWEEFFQSDDETKIKEATLIEKGSIISRVGMMMLSCGTGAWRVRDAMDTLARTLDLTCSTDIGLISIVCTYFDVDNQSYSQSLSLPTTGVNMAKLNELEKFVRQFEAAGGDFEIKTIRRRLGEIEHMKGRYPLWGSSLAAALACGGFIFLLGGGIPEIICSFIGAGLGQFARGSLAKRRITIAATTAVAVAAACLSYYLAFMLGHLLFNVDMIYMRGYIGAMLFVIPGFPFITSGLDISKLDMRSGLERMAYAIFIILIATGTGWVMATALQIKPGDLPALHLSKAILTACRLVASFCGVFGFSLMFNSHRRMAAAAGLVGAIANTMRLSLVDFAHFPAPLAAFLAALLAGLLAGYVREKVGYPRIALTVPSIVIMVPGLYMYRGIFLLVLTNVGAGATWMTEALMLVMSLPAGLLTARILTDKKWRRVD
>CP029250.1|AZA25181.1|956478_956985_-|Cys-tRNA(Pro)-deacylase
MSKKKKNKDKLDKTLVEKILDQHKIAYEQHISKISEDHGVAQVGTGKPVLDVHPVYKTLAVNGNKTGPIVGVVPLSGHLDLKKIAKASGNKKCEMIPLKQLEKTTGYVHGANTPIGIYHSKKFPIFLDESVLNEDGIWVSSGEVGRSVMVNPLDLQKLVKATVADLQE
>CP029250.1|AZA25182.1|957047_957992_+|50S-ribosomal-protein-L11-methyltransferase
MKLLEIKIESSYDVEDALAYFATEDLKALGTEARRRSDFEQAGWLHDSTVVDMDDIPNLPDELEFIAYFDEETDPEETVKCFKDKLAELAGYGLKTAPGEISVDYVADQDWNTVWQKYYHVINLSRHLAIVPEWEDYQPAFKDQEIIRLDPGLAFGTGNHQTTQLAMLGIERAMVKPLTVADVGTGSGILAIAAHKLGAKSVLATDISDESMTAAKENAALNGIHDIALQKTSLLAGVDGKFDLIVANILAEILLDLIPQLDSHLSEDGQVIFSGIDYLQLPKIEQALAENGFQIDLKIRAGRWIGLAISRKHD
>CP029250.1|AZA25183.1|958132_960394_+|GTP-pyrophosphokinase
MSKYVEMTHEQVMAACKKYMTADQLAFVESAYQFAARAHEGQTRASGQPYIVHPTQVAGTLANLGLDPDTVAAGFLHDTVEDTSVTNDDIKEEFGADVAFIVDGVTKLNKYEYKSHKEFLAENHRKMLIAMAKDLRVILVKLADRLHNMHTLEHLRPDKQRRIAAETLDIYAPLADRLGIGTIKWELEDMSFHYMNPEAYYKIASMMDAKRSEREDYIKDAIDYLRGTLDSLGIKYDISGRPKHIYSTYKKMVNKHKDFNEIYDLLAVRVIVPTVKDCYAVLGAVHTKWKPMPGRFKDYIAMPKANGYQSLHTTIIGPGGKPLEIQIRTEEMHKVAEYGVAAHWAYKRGNFQGVDEKDGGALDIGREILELQKDSNNADEFMEAVHSDIFADKVYVFTPKGEVYELPKGSVTLDFAYAIHTQVGDHGIGAKVNDKLVPLDYKLKNGDVVDILTQSNARPSRDWAEMVKTSRAKNKIRRYFRDVDREESLARGKSELVDLLKENGLSAKDFLDKSHIDEVLDHFSFKTDEDMYAAIGFGNMSAVSIYNRLTADLRRQQEEEKQKQFEAQIMSAGQQAAASSVVKKPASQKDDAKSKTKGKKPDSLVRVQGLEDLDMHFAKCCNPVPGDPIVGYVTKGRGVTVHRADCRNVVSADPAAQGRMIDVEWNSIDEGKQASFNANFELFGYNRQKLLGDVINRLNALTKNITNVSASVNEENIAHFYITAEVRNAAQLNDIMAKLRDIPDVYDTKRTDN
>CP029250.1|AZA25184.1|960422_960860_+|D-tyrosyl-tRNA(Tyr)-deacylase
MRVVIQRVNHAAVRIDGETVGQIQKGLLLLVGLAEGDGEEQVVKAADKIAKMRIFEDEAGKTNLGIKDVGGQILSVSQFTLLADTKKGNRPSFVHAMRPPKSSQLWEEFNQELVKRGLTVETGEFGADMKVELENDGPFTIVLDL
>CP029250.1|AZA25185.1|961144_962431_+|histidine--tRNA-ligase
MRVQRPKGTVDILPETSGQWEKVEQTARDLFKRANYHEIRTPSFENYELFSRSSGETSDVVEKEMYDFEDKGGRHIALRPEGTAGVVRAYVENKIYGPDYVKPFNVYYIAAMYRYERPQAGRQREFHQIGVESFGSDGYLADVETILLGHDLLAELGVKNYELHINTLGDSEVRQAYHDALVDYFTPVKDQLSEDSQRRLGKNPLRILDSKAEEDQQFLPEAPKIRDYLDEESKENFNKILASLDKLGVKYVIDDDLVRGLDYYTGVIFEFMVDDPTLWASPSTVLGGGRYNHLVEEFSGPETPAVGFGIGEERLMLVLSKQNPEMFEDQGIDFFITNIGEGTDIKAVEVARQLRSLGFSAQYDVDQKKLKAQFRKADRVGARYVVTLGAKELAEGKLTVKRLSDGQQFSLEFTDLEDKANLLSKIEK
>CP029250.1|AZA25186.1|962446_964291_+|aspartate--tRNA-ligase
MMQMEKRTDYCGNITSQYLDQDVLLYGWVQRVRNLGQLIFIDLRDREGIVQVVVNHDSGQELMDVASSLGQEYVVEVKGHVNERSSKNPDMKTGDVEVIASEITVLNKAKTPPFEIKDDLVASEQTRLKYRYLDLRRPTLQNALIMRAQIMTATNAYLSGEGFINIETPDLGKSTPEGARDYLVPSRVYPGSFYALPQSPQIFKQLLMGAGFDKYYQIARCFRDEDLRGDRQPEFTQIDLETSFMDEEGVQEVTEGLLAKVMKDVKGIDLQLPLPRITWQESMDKYGCDKPDTRYEMLIHDLGNVFAKSGFKVFASALENGGFVRGIAVKGGAKFYSRKKIEAMQDYIKRYHAKGLAWVKYEDGDFSGPVSRFLSEDEKAGLVQEFSLEGGELLLFIADQWKVCCDSLDYLRRQTAKETGIIPKDTYKYLWVVDWPLFEYDEGDERWIAAHHPFTMPDDKGIELLETDPHKAHARSYDIVLNGYELGGGSIRIHKRDIQEKMFKALGFTKERAYEQFGFLMDALDMGFPPHAGLAIGLDRFAMLLAGKDNIRDVIAFPKNASASEPMMHAPAPVADQQLTDLGIKVAEAAKEGVEKYEASLEAEAAEDVKSHEE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029250_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029250_3

1163108-1164559

TypeIII

Consensus_repeat	Method
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CRISPRCasFinder
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CRT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	PILER-CR

19 spacers

cas2,cas1,csm5gr7,csm4gr5,csm3gr7,csm2gr11,cas10,cas6

The CRISPR arrays of CP029250_3

>merge|CP029250|3|1163108-1164559|CRISPRCasFinder,CRT,PILER-CR
GCTTTCGTCCCCTCGCGACGGGGATTATTTGTTAGCGCATAGTGCGGATTGTAAGTAGCGACAAGCTTTGTTGCACTTTTGCCTCCTTTTAGCGGAGATAAGTTCGTGTAATGTGCAAAGCAGAATGAGTCTCCGTAAGGAATAAAAGTTCCCGCCTCCTTCTAGCGGAGATAAGTTGTTAGCGAAAATAAAAAAAGTTGCAAGCGAAAGCTTGCTAGAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCGACGACCTGCCATTCTAGGGGGCAGAACAATGGAAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCTCAAAAAAATGTCGGAATTGTACAGAATTCCGGCCGATGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCCCAATTTTAGGACGAAAATATGTTTTCGTAAAGGAAAAATAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCATCGATCAATTAAGGAATATTTACAGGAAGTTGTAGATTAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCCTTTGCTAGACCTCAGCGCAAGGATTTCTCTCTAAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCTAAAGGCAGAGTTTTAAAACAATATGACAATAGACGTGGGCGCGGGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCAAAAAGCCGCAGAACGCACTGGCAACACACATTGACGAGGAAGGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCAAACAAAAAATGTTAGTTAAGGAAATTGTAAACAGTGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCACAAGAGATGCGATGAACAAACACGTTGATACCGAGGATAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCGTTATCAAGCAGTTTGGTAGGGAATATAATTGGTTTCGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCTTACTGAAATTGGCGGTAACGTTGTTAAAAATAACGGTGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCACTTAAAAATAAGGGCTATATCGAACTGACCTATGAAAGAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCTCTAAGTCTTGAATCAAGCGGTAACCGATCTTACCAGCGTATGGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCCGAAAAAGCGAAGATCGCAACTCACCTTTGGAAAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCAGATTACAAAAAATTTTTAAAGTAATTCTTCCCATAAGGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGCAGCAACCTTCAAAAGCTATGGTTTGTGGAGAAGGCTAAGTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC

>CP029250|3|3|1163108-1164559|CRISPRCasFinder
GCTTTCGTCCCCTCGCGACGGGGATTATTTGTTAGC	GCATAGTGCGGATTGTAAGTAGCGACAAGCTTTGTTGC
ACTTTTGCCTCCTTTTAGCGGAGATAAGTTCGTGTA	ATGTGCAAAGCAGAATGAGTCTCCGTAAGGAATAAAA
GTTCCCGCCTCCTTCTAGCGGAGATAAGTTGTTAGC	GAAAATAAAAAAAGTTGCAAGCGAAAGCTTGCTAGA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	GACGACCTGCCATTCTAGGGGGCAGAACAATGGAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TCAAAAAAATGTCGGAATTGTACAGAATTCCGGCCGAT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CCAATTTTAGGACGAAAATATGTTTTCGTAAAGGAAAAATA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ATCGATCAATTAAGGAATATTTACAGGAAGTTGTAGATTA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CTTTGCTAGACCTCAGCGCAAGGATTTCTCTCTAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TAAAGGCAGAGTTTTAAAACAATATGACAATAGACGTGGGCGCGG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AAAAAGCCGCAGAACGCACTGGCAACACACATTGACGAGGAAG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AAACAAAAAATGTTAGTTAAGGAAATTGTAAACAGT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ACAAGAGATGCGATGAACAAACACGTTGATACCGAGGATA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	GTTATCAAGCAGTTTGGTAGGGAATATAATTGGTTTC
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TTACTGAAATTGGCGGTAACGTTGTTAAAAATAACGGT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ACTTAAAAATAAGGGCTATATCGAACTGACCTATGAAAGA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TCTAAGTCTTGAATCAAGCGGTAACCGATCTTACCAGCGTATG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CGAAAAAGCGAAGATCGCAACTCACCTTTGGAAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AGATTACAAAAAATTTTTAAAGTAATTCTTCCCATAAG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AGCAACCTTCAAAAGCTATGGTTTGTGGAGAAGGCTAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC

>CP029250|3|2|1163182-1164559|CRT
ACTTTTGCCTCCTTTTAGCGGAGATAAGTTCGTGTA	ATGTGCAAAGCAGAATGAGTCTCCGTAAGGAATAAAA
GTTCCCGCCTCCTTCTAGCGGAGATAAGTTGTTAGC	GAAAATAAAAAAAGTTGCAAGCGAAAGCTTGCTAGA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	GACGACCTGCCATTCTAGGGGGCAGAACAATGGAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TCAAAAAAATGTCGGAATTGTACAGAATTCCGGCCGAT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CCAATTTTAGGACGAAAATATGTTTTCGTAAAGGAAAAATA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ATCGATCAATTAAGGAATATTTACAGGAAGTTGTAGATTA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CTTTGCTAGACCTCAGCGCAAGGATTTCTCTCTAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TAAAGGCAGAGTTTTAAAACAATATGACAATAGACGTGGGCGCGG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AAAAAGCCGCAGAACGCACTGGCAACACACATTGACGAGGAAG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AAACAAAAAATGTTAGTTAAGGAAATTGTAAACAGT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ACAAGAGATGCGATGAACAAACACGTTGATACCGAGGATA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	GTTATCAAGCAGTTTGGTAGGGAATATAATTGGTTTC
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TTACTGAAATTGGCGGTAACGTTGTTAAAAATAACGGT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ACTTAAAAATAAGGGCTATATCGAACTGACCTATGAAAGA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TCTAAGTCTTGAATCAAGCGGTAACCGATCTTACCAGCGTATG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CGAAAAAGCGAAGATCGCAACTCACCTTTGGAAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AGATTACAAAAAATTTTTAAAGTAATTCTTCCCATAAG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AGCAACCTTCAAAAGCTATGGTTTGTGGAGAAGGCTAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC

>CP029250|3|2|1163255-1164559|PILER-CR
GTTCCCGCCTCCTTCTAGCGGAGATAAGTTGTTAGC	GAAAATAAAAAAAGTTGCAAGCGAAAGCTTGCTAGA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	GACGACCTGCCATTCTAGGGGGCAGAACAATGGAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TCAAAAAAATGTCGGAATTGTACAGAATTCCGGCCGAT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CCAATTTTAGGACGAAAATATGTTTTCGTAAAGGAAAAATA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ATCGATCAATTAAGGAATATTTACAGGAAGTTGTAGATTA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CTTTGCTAGACCTCAGCGCAAGGATTTCTCTCTAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TAAAGGCAGAGTTTTAAAACAATATGACAATAGACGTGGGCGCGG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AAAAAGCCGCAGAACGCACTGGCAACACACATTGACGAGGAAG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AAACAAAAAATGTTAGTTAAGGAAATTGTAAACAGT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ACAAGAGATGCGATGAACAAACACGTTGATACCGAGGATA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	GTTATCAAGCAGTTTGGTAGGGAATATAATTGGTTTC
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TTACTGAAATTGGCGGTAACGTTGTTAAAAATAACGGT
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	ACTTAAAAATAAGGGCTATATCGAACTGACCTATGAAAGA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	TCTAAGTCTTGAATCAAGCGGTAACCGATCTTACCAGCGTATG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	CGAAAAAGCGAAGATCGCAACTCACCTTTGGAAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AGATTACAAAAAATTTTTAAAGTAATTCTTCCCATAAG
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC	AGCAACCTTCAAAAGCTATGGTTTGTGGAGAAGGCTAA
GTTCTCGTCTCCTTCTAGCGGAGATAAGTTGTTAGC

Protein	Signature genes	Signature genes Name	Protein_function
CP029250.1\|AZA25333.1\|1158433_1159135_-\|prismane-protein	unknown	unknown	gnl\|CDD\|223999
CP029250.1\|AZA25338.1\|1161616_1162126_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
CP029250.1\|AZA26237.1\|1156470_1157733_-\|IS3-like-element-ISL6-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP029250.1\|AZA25344.1\|1168560_1169052_-\|type-III-A-CRISPR-associated-protein-Csm2	csm2gr11	cd09647_csm2gr11_CAS-III-A	gnl\|CDD\|367635
CP029250.1\|AZA25335.1\|1159430_1160069_+\|NAD-dependent-dehydratase	unknown	unknown	gnl\|CDD\|187554
CP029250.1\|AZA25337.1\|1160509_1160800_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|213220
CP029250.1\|AZA25347.1\|1174419_1175886_-\|hypothetical-protein	unknown	unknown	unknown
CP029250.1\|AZA26239.1\|1177666_1177702_-\|hypothetical-protein	unknown	unknown	unknown
CP029250.1\|AZA25331.1\|1155498_1156140_-\|integrase	unknown	unknown	gnl\|CDD\|271192
CP029250.1\|AZA25342.1\|1165941_1166985_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	csm5gr7	cd09662_csm5gr7_CAS-III-A	gnl\|CDD\|187793
CP029250.1\|AZA25334.1\|1159159_1159336_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|176102
CP029250.1\|AZA25332.1\|1157911_1158421_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
CP029250.1\|AZA25345.1\|1169054_1171391_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	cas10	cd09680_cas10_CAS-III	gnl\|CDD\|187811
CP029250.1\|AZA25341.1\|1165023_1165938_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
CP029250.1\|AZA25340.1\|1164718_1165024_-\|CRISPR-associated-endonuclease-Cas2	cas2	cd09638_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|273699
CP029250.1\|AZA25336.1\|1160120_1160597_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|213221
CP029250.1\|AZA26238.1\|1166987_1167866_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	csm4gr5	cd09663_csm4gr5_CAS-III-A	gnl\|CDD\|380071
CP029250.1\|AZA25339.1\|1162149_1162830_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
CP029250.1\|AZA25343.1\|1167888_1168557_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	csm3gr7	cd09684_csm3gr7_CAS-III-A:CAS-III-D	gnl\|CDD\|187815
CP029250.1\|AZA25346.1\|1171383_1172136_-\|CRISPR-associated-endoribonuclease-Cas6	cas6	COG5551_cas6_CAS-III	gnl\|CDD\|227838

Protein	Function_ID	Function_description	E-value
CP029250.1\|AZA25333.1\|1158433_1159135_-\|prismane-protein	gnl\|CDD\|223999	COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only].	2.38717e-07
CP029250.1\|AZA25338.1\|1161616_1162126_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.82691e-09
CP029250.1\|AZA26237.1\|1156470_1157733_-\|IS3-like-element-ISL6-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.59616e-47
CP029250.1\|AZA25344.1\|1168560_1169052_-\|type-III-A-CRISPR-associated-protein-Csm2	gnl\|CDD\|367635	pfam03750, Csm2_III-A, Csm2 Type III-A. Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-associated) proteins. This entry represents Csm2 Type III-A, a family of Cas proteins also known as TM1810/Csm2.	2.09197e-16
CP029250.1\|AZA25335.1\|1159430_1160069_+\|NAD-dependent-dehydratase	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.80984e-40
CP029250.1\|AZA25337.1\|1160509_1160800_-\|hypothetical-protein	gnl\|CDD\|213220	cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C. ATM1 is an ABC transporter that is expressed in the mitochondria. Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	4.90449e-11
CP029250.1\|AZA25331.1\|1155498_1156140_-\|integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	1.61538e-43
CP029250.1\|AZA25342.1\|1165941_1166985_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm5	gnl\|CDD\|187793	cd09662, Csm5_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	3.07249e-21
CP029250.1\|AZA25334.1\|1159159_1159336_+\|transcriptional-regulator	gnl\|CDD\|176102	cd05466, PBP2_LTTR_substrate, The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily. This model and hierarchy represent the the substrate-binding domain of the LysR-type transcriptional regulators that form the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, oxidative stress responses, nodule formation of nitrogen-fixing bacteria, synthesis of virulence factors, toxin production, attachment and secretion, to name a few. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0.000255773
CP029250.1\|AZA25332.1\|1157911_1158421_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	3.89953e-42
CP029250.1\|AZA25345.1\|1169054_1171391_-\|type-III-A-CRISPR-associated-protein-Cas10/Csm1	gnl\|CDD\|187811	cd09680, Cas10_III, CRISPR/Cas system-associated protein Cas10. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Multidomain protein with permuted HD nuclease domain, palm domain and Zn-ribbon; signature gene for type III; also known as Csm1 family.	2.64339e-151
CP029250.1\|AZA25341.1\|1165023_1165938_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	5.40932e-81
CP029250.1\|AZA25340.1\|1164718_1165024_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|273699	TIGR01573, cas2, CRISPR-associated endonuclease Cas2. This model describes most members of the family of Cas2, one of the first four protein families found to mark prokaryotic genomes that contain multiple CRISPR elements. CRISPR systems protect against invasive nucleic acid sequences, including phage. Cas2 proteins have been characterized as either endoribonuclease (for ssRNA) or endodeoxyribonuclease (for dsDNA), depending on the system to which the Cas2 belongs. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats. The cas genes usually are found near the repeats. A distinct branch of the Cas2 family shows a very low level of sequence identity and is modeled by TIGR01873 instead of by this model (TIGR01573).	1.43934e-18
CP029250.1\|AZA25336.1\|1160120_1160597_-\|hypothetical-protein	gnl\|CDD\|213221	cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C. Glucan exporter ATP-binding protein. In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virulence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.09765e-29
CP029250.1\|AZA26238.1\|1166987_1167866_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm4	gnl\|CDD\|380071	pfam17953, Csm4_C, CRISPR Csm4 C-terminal domain. Clustered, regularly interspaced, short palindromic repeat (CRISPR) loci play a pivotal role in the prokaryotic host defense system against invading genetic materials. The CRISPR loci are transcribed to produce CRISPR RNAs (crRNAs), which form interference complexes with CRISPR-associated (Cas) proteins to target the invading nucleic acid for degradation. The interference complex of the type III-A CRISPR-Cas system is composed of five Cas proteins (Csm1-Csm5) and a crRNA, and targets invading DNA. This entry represents the C-terminal domain found in Csm4. Csm4 structurally resembles Cmr3, a component of the type III-B CRISPR-Cas interference complex. Studies indicate that Csm3-Csm4 complex binds single-stranded RNA in a non-sequence-specific manner. Structural analysis show, Csm3 and Csm4 have one and two ferredoxin-like folds (also known as an RRM-like fold), respectively. The long beta-hairpin inserted into the C-terminal ferredoxin-like fold of Csm4, is well-conserved in the Cmr3 structure. The corresponding beta-hairpin of Cmr3 binds the D1 domain of Cmr2, as observed in the Cmr2-Cmr3 complex structure. Furthermore, it is suggested that the hairpin of Csm4 is responsible for the interaction with Csm1 (ortholog of Cmr2).	2.73404e-31
CP029250.1\|AZA25339.1\|1162149_1162830_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	7.0294e-19
CP029250.1\|AZA25343.1\|1167888_1168557_-\|type-III-A-CRISPR-associated-RAMP-protein-Csm3	gnl\|CDD\|187815	cd09684, Csm3_III-A, CRISPR/Cas system-associated RAMP superfamily protein Csm3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein.	1.99427e-84
CP029250.1\|AZA25346.1\|1171383_1172136_-\|CRISPR-associated-endoribonuclease-Cas6	gnl\|CDD\|227838	COG5551, COG5551, CRISPR system related protein, RAMP superfamily [Defense mechanisms].	2.97314e-19

>CP029250.1|AZA25339.1|1162149_1162830_-|ABC-transporter-ATP-binding-protein
MVRSANSCGRYYFRLDLQYRHGRCAGPYFQGQLVQGLYDLLNHKILANRLIQLSLLYLVQVCRAIKRFSVRIFANHTSRRMRRLLYNALLHRQFGDDTGSLMTKAISDVDSCVEGMRKFTTEIFDTGVVMIAYLAMLLYYDVRLTILACMFTPLAYVIANVLKKKVVKANKAYKESESVLNTMTLDRIVHAKTYRITGREQALNDRYEKQLTMNKKVLSPISLKGP
>CP029250.1|AZA25338.1|1161616_1162126_-|ABC-transporter-ATP-binding-protein
MFGIVLIIYFGGRNVLHIGWKAWDLASFTTFLACFTKLATKVSHAAKLFNAVQKAQVSWVRIRPLMSDPIYDHYQKEEKVINDLTFDHVTTFYHSYPETAVKDINFTASANEIIGITGEVACRKSLQGHAILLMTHWVDCFSQLDQIIYIHDHQVSVGKHEDLLKAMPS
>CP029250.1|AZA25337.1|1160509_1160800_-|hypothetical-protein
MSRIQDFLNEADSKPDIYQGEGDYITFDHVTFGYLPDQPILKDYSFKVAKGEHVTFVGRTGKGFLNFSWASTSRKKGRSCWMAVRQTLIPRISATS
>CP029250.1|AZA25336.1|1160120_1160597_-|hypothetical-protein
MGLYQPQKGEILLDGSSPDAHPKNQRHFLAIYEQGVALVDGTVKDQITLYDDTITAEMIDKDLALVGLTDIVKNLLQGLNTPVSDINLLQGQLQLLMIALSVVCDPQILLLDEMTASLSLDRETEAKVLKAIDAASSGRTVLSISHRRGAHDGRIIKL
>CP029250.1|AZA25335.1|1159430_1160069_+|NAD-dependent-dehydratase
MKVFIAGGSGRVAAAVIQELVNQGQQVYAGSRHKDAIVKLPGVTPLSLDLHASPSELAKLLPGMDAVYFLAGSRGKDLLQTDAFGAVKLIQAAEMAGVKRYIQLSSIFAADPDKWQGKAEFASLTDYYIAKYFADEWLINNSKLDYTILAPATLEEKAGTGKVNFKPEKFAANPIPDVAAVLAQILDKKNTYGKVINMTGGETPISEAIAEV
>CP029250.1|AZA25334.1|1159159_1159336_+|transcriptional-regulator
MGYLLSFDKLVDTSPESGMVFCPLTPKLETNLYLVWKKYQTFSPIAERFLKQIKKSFG
>CP029250.1|AZA25333.1|1158433_1159135_-|prismane-protein
MVDQAKRAFQEDFQAAVDFLSVQDNVDPERIGIIGICGWGGIALQTAAIDTRIKATVTSTMYDLSRVTGNGYFDANDNEEPRHKMRVALNKQRTADFKAGSYAKAGGVVDPLLEDAPKFVKDYYAYYKTPRGYHKRSLNSNSGWNVTAATSLLNTRLFTYTNEIRNAVLVIQGDQAHSCYMSKDACTDMIKDSKYTDNKELLLIPGASHTDLYDQKNIIPFAKMGAFFDKYLK
>CP029250.1|AZA25332.1|1157911_1158421_-|acetyltransferase
MKLEDFLAHVNSGKRIVDPSEELEYCSYLTQEALKVTMELNNAYHTPEEVQDLFAKLTGSEVNRSLALVPPFYTDCGENIHVGDRALIGRNAMIATLNHKQDPAKRGELLSAAVHIGKRVWIGANVTVLPGVTISDGAIIAAGAVVTKDIPARTIAAGVPACVVKEITE
>CP029250.1|AZA26237.1|1156470_1157733_-|IS3-like-element-ISL6-family-transposase
MVDLIQKHGEDILDRPQQKYTANFKLAAIDRVLLGGEALSQVSLDLGLTNTGILANWLRSFKESGYTVITKKKGRPPKNAQKQGQTTDQRAGRAGKEAYSRACIHKKIGGLNSRTEEPRKEELARAITELRQELRLSVKYIIDVINANPGLPHISRSNYYYQTHKPDKDSGNQKLMDRIKEIFLEHSRRYGYRRIYGQLRREVYEINHKKVQRLMQKMGLFAISIRKKRKYSSYYGVQGKIKPDLIKRNFYAIIPDRHWFTDVTEFHLKDQKLYLSPIIDGCTQEIISYNISRHPDLKQVMTMLDDAFEKHPALNGLIFHSDRGWQYQHQAYQAALANRGIDQSMSRLGNSLDDGLMEGFFGILKREMFYGQEHKYKDLNELEQAIHKYIDYYNNVRIKTGRKNMTPIEYRNHFLTTLTA
>CP029250.1|AZA25331.1|1155498_1156140_-|integrase
MGRKVKKTESSRNIRPLKTAKEINAMKRALQFGTGTVTGQNRNGLRNAMIFVFGINTGLRISDIVKAKVSDIEDGEWYNLVETKTHKNRHAYIGNISQDLENYIDQMQLKPSDWLFPSRKGEGHIEGKSFYKDLKRAARQCEIDPNTVGTHTLRKTFGYHYIKSATTPTGDPDPRALYKLQKMLNHSSPTTTLRYIGLEDESMEEDLKSFRLG
>CP029250.1|AZA25340.1|1164718_1165024_-|CRISPR-associated-endonuclease-Cas2
MVLLLSFDLPRNTKEERKKAAEYRKRLVELGFDMKQYSLYEREVESDTTKDHLIGILKKEVPDDGMITLYLLPDEVNNKQINILGPDAPMKAVSVPKVIVV
>CP029250.1|AZA25341.1|1165023_1165938_-|type-II-CRISPR-associated-endonuclease-Cas1
MKNVLYVENVNFVGVSKFGVKATNLQDHTEKFFAYEDLDVIIFDNVKSYLTQHLIEKCAENNIMLLFCDSKHSPLVLLDNIYGQEHRLEMLQKQLALSAKAKSRIWHKIVVRKIQNQADCLELLERPAEDVGLLRSAVKNVTEGDKHNTEAYAAREYFQSLFGRDFKRGRYDDLVNASLNYGYAIIRALIRRNIVVHGLEPSYGVNHHSTENSFNLSDDLIECYRPLIDYSIVMHLRERDVEDVELTPEDKQAIVGIMLEKCVIGDKIFRIGDAVEETIKSYLACLQADSASSLKLPTFIQGGK
>CP029250.1|AZA25342.1|1165941_1166985_-|type-III-A-CRISPR-associated-RAMP-protein-Csm5
MKRYREFEFKLRTLAPVFIGSGETYKQREYIYENDAYYFPNFVTLYRKLSSNQRQQEAFENYLMSSRIQEKNMRLGEFLRKINFTDRDLGGYSIKATGVEVENNGDPDRLNEIAKFIKDPQGRPYIPGTSLKGAIRTILINTRFKGVEKIPWGGSDDIFHDIRVSDSEPLKLSSLVITKKWDYNTRKDGPNPLPLTRECLKPYTKVVFTITTVGDEAAEIISGLSKAADEFYKRYEERFLKDLDLKYRQSGYNHPIYLGGGSGLWTKANYDRINIEQIRSRTPRKMKMTGNGVFKLTKAKRQSYRLKIKGVIEERELVGKNGGAADTKDGIGFYEMGKCCFTIKEKK
>CP029250.1|AZA26238.1|1166987_1167866_-|type-III-A-CRISPR-associated-RAMP-protein-Csm4
MHLDKAHFGDGYLNTSIGHFEASRLFSALCLEALKNNCLEEFIEEASEEDFVLSDAFPYVGEPYLPKPVSYPRSKRFSFDNFQYDENYQKTANSLYAVPLSEFSDFINGKADVEMLAAKQAAFAVTTEVTKKGQDPYEVAVTSFSGDLYVIAKRSELLKKLMLSLQFSGLGGKRSAGYGGFRLSIIDLPTEMKRQINTDSYSDHKLLLTSSLPQNFELEQAMAYAAYEIKKDSGFAYSETEQELLRKQDLYKFAAGSVFKNTFKGSIVDVRPSNFAHPVYNFAKGLFYSFEV
>CP029250.1|AZA25343.1|1167888_1168557_-|type-III-A-CRISPR-associated-RAMP-protein-Csm3
MTNLAKIRFTGELVLESGLHIGASSAFAAIGAIDNPVIKDPLTHLPIIPGSSLKGKMRSLLAAALNEKTTMNPNQDCDKIIRLFGTSVGGGQDGKAPVQGRLLFRDSVLTNGKELMDMGINTYTEVKFENTIDRVKMIANPRQIERAVRGSKFNFELIYDVMDPAQVEEDLETILTGFKLLELDYLGGSGSRGYGKVKFTNMHADTIFGNYDVSEINSKLEA
>CP029250.1|AZA25344.1|1168560_1169052_-|type-III-A-CRISPR-associated-protein-Csm2
MYGSPRPHYNNPRYNNNLRYEEAKPNIKITFTDEHYVDEAEEVIKYCQKNHFKAPGSRGKDEVTYSQLRNLLGMTSAIFDATNIADLKTVYEKLTYFRIQLVYTAGRNEAMKSFIETSHLLEVVKEIDQKRADDEKEQRREIIRLCKYMEALVAYFKYYGGKD
>CP029250.1|AZA25345.1|1169054_1171391_-|type-III-A-CRISPR-associated-protein-Cas10/Csm1
MDKKMVETFYGSFLHDIGKAVQRQSASPMYNYNHQILGSDFIENYTDDKQIIDALYYHHNQRENKKTNLRQAEIPEDSVAYLTYIGDNIAAGTDRRYEEGGKGGWNHETPLADIFNRFGIKQGQRYLHPYEMRPELPSFMDPSNAKDPFSPEKYQDVVRLFKEGLNKVELTEEYIPSVLNLVEQTMGQVPSDTAVDGEPDISLYDHMKLSAAFACAIKQYLDEQNRHDYKATLLNGERSFYKKQVFLMVSYQLAGTEDFINTITSQGAYKQLRSRAFYVEMLIRWFLDSLLNEVGLTAANILYQNSHDGLLFIGNTTRNAEIVRKAQGRFNEFLLKNFGTKLYLAVGMEEFSAEDIKAVNKKDPNRKEGEYKRVAQNYAELFQRLDRDIEHGLQKRYDMGTLKRLNAFGKKSGRECAVCHSVMNLLPGENKCFLCDKLESFSQDIQVEKYFVVNEDKTGLPLDADHYLHTISVNELEAGDVSGKIYTKNTYATGKQQATHIWISDYSNAPHNNFSYFSDREWKAKFGEPTGIKRLASLMIDIDDLHAKFLTGFYPQEDGKYTTISRFAELFRRIDMFFKLYLNQYADDYHLSIIYSQGDNAFILGAWDDLLDFVQDVRDEFVSWTDNKITLSAAVGLFQESTPINIIARQTKELLRTAKFAGKDRIVLFSKENILTFDEYKNDIVMGKQRIIQEFFDGESERGKAFIYKLLSLIREREDRISFARLAYFLTRLEDASSNKEGFNKFKRNIMNWFNDDKEISQTELALTLYVYSIREEG
>CP029250.1|AZA25346.1|1171383_1172136_-|CRISPR-associated-endoribonuclease-Cas6
MQKISLVCQSKGKYNFNDGVYFHGWLMSQVSEEFADKMHQTGVNPVTIVVYGKKNEVIFSVALLTDEAVAEVAGMLMNDAFTSFSLKSTEQCDFKILRKVKENLESKDLAQVFYQQDQAERLFQVNVMTPLAFKSNGTYYNLPDIRLFFQSIMKKYNAIFENTEHIDLDLLDEICSKVNLVNFRINSRRFYIHKAYINGFCGRLVFYCKGAETLANYVAMLLRFAEFSSVGVKTSLGMGSIAVNREENNG
>CP029250.1|AZA25347.1|1174419_1175886_-|hypothetical-protein
MSRAVNLQYPAKALFEKYPEDYVVLDDRFFNKDNPFVDINGCYMEQPTHLIPGNNADRDRKQFEDEFIKGYLQLIYTCDGLINLGTPGFTYADSERLLTAYYQGYPLKREKNPFYQIQARDNAYTSQIDQTSGRMARTVVKPESMFVILDKEIASCLNRSQVDRKRTNAVMEAIMASDPGLRLLPNQTEEKELKLKKLMASNAMDYLVQVALQLVSMPDDMQQLWIKLRTFIAKHPQLDSLVEVEDGKLAKIVPNYYWDFGHPVSGYYYYVEGDYKRLVAIGEDRDDVKRQMAEAGIKPSFQPQYLDYEEYKQALERIWEQQPWLKRELEKAGYDLSFRPSRYLLTPSDFNNLYKGAIGEAIGGAVMKHLGFDYHNMSDLPNSEMERFDGYLKADDGRIVYVDWKNYNTDAPSGDNDQTVRWITRKLGMVEMGKSAIIINILKWFNKQMQAIQITGGLADKKVYLYLYLFDEKGELNQKLVRDFRKVF
>CP029250.1|AZA26239.1|1177666_1177702_-|hypothetical-protein
MYDPDRCLCHC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029250_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029250_5

2116750-2116841

TypeV

Consensus_repeat	Method
AGTGAGAACGATGAAGATCGATA	CRISPRCasFinder

1 spacers

cas14j

The CRISPR arrays of CP029250_5

>merge|CP029250|5|2116750-2116841|CRISPRCasFinder
AGTGAGAACGATGAAGATCGATAATTCTTCGATACCTCGACGACAGTGGTATAATAGTTGACGTAGGGGAGTGAGAACGATAAAGATCGATA

>CP029250|5|5|2116750-2116841|CRISPRCasFinder
AGTGAGAACGATGAAGATCGATA	ATTCTTCGATACCTCGACGACAGTGGTATAATAGTTGACGTAGGGG
AGTGAGAACGATAAAGATCGATA

Protein	Signature genes	Signature genes Name	Protein_function
CP029250.1\|AZA26052.1\|2109214_2110582_-\|ISL3-like-element-ISLdl1-family-transposase	unknown	unknown	gnl\|CDD\|376574
CP029250.1\|AZA26312.1\|2127819_2128485_+\|hypothetical-protein	unknown	unknown	unknown
CP029250.1\|AZA26051.1\|2107051_2107318_-\|hypothetical-protein	unknown	unknown	unknown
CP029250.1\|AZA26310.1\|2107688_2108951_-\|IS3-like-element-ISL6-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP029250.1\|AZA26063.1\|2122317_2123031_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|225109
CP029250.1\|AZA26059.1\|2115965_2116634_+\|cobalamin-biosynthesis-protein-CobQ	unknown	unknown	gnl\|CDD\|225974
CP029250.1\|AZA26057.1\|2113468_2114227_-\|protein-tyrosine-phosphatase	unknown	unknown	gnl\|CDD\|379135
CP029250.1\|AZA26062.1\|2121483_2122143_-\|IS607-family-transposase	unknown	unknown	gnl\|CDD\|239738
CP029250.1\|AZA26067.1\|2127549_2127747_+\|hypothetical-protein	unknown	unknown	unknown
CP029250.1\|AZA26065.1\|2124729_2125953_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
CP029250.1\|AZA26060.1\|2117188_2119279_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	unknown	unknown	gnl\|CDD\|223616
CP029250.1\|AZA26054.1\|2111738_2111978_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371212
CP029250.1\|AZA26055.1\|2112074_2112575_-\|O-acetyl-ADP-ribose-deacetylase	unknown	unknown	gnl\|CDD\|394878
CP029250.1\|AZA26066.1\|2126075_2127329_-\|transposase	unknown	unknown	gnl\|CDD\|379252
CP029250.1\|AZA26068.1\|2128688_2128886_+\|cold-shock-protein	unknown	unknown	gnl\|CDD\|224197
CP029250.1\|AZA26064.1\|2123582_2123984_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|283235
CP029250.1\|AZA26061.1\|2119808_2121515_-\|transposase	cas14j	-	gnl\|CDD\|284650
CP029250.1\|AZA26053.1\|2110765_2111680_+\|cytochrome-C5	unknown	unknown	unknown
CP029250.1\|AZA26056.1\|2112574_2113357_-\|protein-tyrosine-phosphatase	unknown	unknown	gnl\|CDD\|379135
CP029250.1\|AZA26058.1\|2114260_2115769_-\|glycerol-kinase	unknown	unknown	gnl\|CDD\|234594

Protein	Function_ID	Function_description	E-value
CP029250.1\|AZA26052.1\|2109214_2110582_-\|ISL3-like-element-ISLdl1-family-transposase	gnl\|CDD\|376574	pfam01610, DDE_Tnp_ISL3, Transposase. Transposase proteins are necessary for efficient DNA transposition. Contains transposases for IS204, IS1001, IS1096 and IS1165.	2.36071e-45
CP029250.1\|AZA26310.1\|2107688_2108951_-\|IS3-like-element-ISL6-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.1211e-46
CP029250.1\|AZA26063.1\|2122317_2123031_+\|GGDEF-domain-containing-protein	gnl\|CDD\|225109	COG2199, COG2199, c-di-GMP synthetase (diguanylate cyclase, GGDEF domain) [Signal transduction mechanisms].	1.70182e-17
CP029250.1\|AZA26062.1\|2121483_2122143_-\|IS607-family-transposase	gnl\|CDD\|239738	cd03769, SR_IS607_transposase_like, Serine Recombinase (SR) family, IS607-like transposase subfamily, catalytic domain; members contain a DNA binding domain with homology to MerR/SoxR located N-terminal to the catalytic domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subfamily is composed of proteins that catalyze the transposition of insertion sequence (IS) elements such as IS607 from Helicobacter and IS1535 from Mycobacterium, and similar proteins from other bacteria and several archaeal species. IS elements are DNA segments that move to new sites in prokaryotic and eukaryotic genomes causing insertion mutations and gene rearrangements.	9.31205e-55
CP029250.1\|AZA26057.1\|2113468_2114227_-\|protein-tyrosine-phosphatase	gnl\|CDD\|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	5.16529e-65
CP029250.1\|AZA26059.1\|2115965_2116634_+\|cobalamin-biosynthesis-protein-CobQ	gnl\|CDD\|225974	COG3442, COG3442, Predicted glutamine amidotransferase [General function prediction only].	1.46983e-73
CP029250.1\|AZA26065.1\|2124729_2125953_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	1.80263e-34
CP029250.1\|AZA26060.1\|2117188_2119279_+\|ATP-dependent-Clp-protease-ATP-binding-subunit	gnl\|CDD\|223616	COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones].	0
CP029250.1\|AZA26054.1\|2111738_2111978_-\|hypothetical-protein	gnl\|CDD\|371212	pfam10726, DUF2518, Protein of function (DUF2518). This family is conserved in Cyanobacteria. Several members are annotated as the protein Ycf51. The function is not known.	0.00889245
CP029250.1\|AZA26055.1\|2112074_2112575_-\|O-acetyl-ADP-ribose-deacetylase	gnl\|CDD\|394878	cd02908, Macro_OAADPr_deacetylase, macrodomain, O-acetyl-ADP-ribose (OAADPr) family. Macrodomains are found in a variety of proteins with diverse cellular functions, as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Macrodomains can recognize ADP-ribose (ADPr) in both its free and protein-linked forms, in related ligands, such as O-acyl-ADP-ribose (OAADPr), and even in ligands unrelated to ADPr. This family includes eukaryotic macrodomain proteins such as human MacroD1 and MacroD2, and bacterial proteins such as Escherichia coli YmdB; these have been shown to be O-acetyl-ADP-ribose (OAADPr) deacetylases that efficiently catalyze the hydrolysis of OAADPr to produce ADP-ribose and free acetate. OAADPr is a sirtuin reaction product generated from the NAD+-dependent protein deacetylation reactions and has been implicated as a signaling molecule. By acting on mono-ADP-ribosylated substrates, OAADPr deacteylases may reverse cellular ADP-ribosylation.	2.6244e-92
CP029250.1\|AZA26066.1\|2126075_2127329_-\|transposase	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.84099e-18
CP029250.1\|AZA26068.1\|2128688_2128886_+\|cold-shock-protein	gnl\|CDD\|224197	COG1278, CspC, Cold shock proteins [Transcription].	8.85016e-33
CP029250.1\|AZA26064.1\|2123582_2123984_-\|hypothetical-protein	gnl\|CDD\|283235	pfam05525, Branch_AA_trans, Branched-chain amino acid transport protein. This family consists of several bacterial branched-chain amino acid transport proteins which are responsible for the transport of leucine, isoleucine and valine via proton motive force.	1.35161e-16
CP029250.1\|AZA26061.1\|2119808_2121515_-\|transposase	gnl\|CDD\|284650	pfam07282, OrfB_Zn_ribbon, Putative transposase DNA-binding domain. This putative domain is found at the C-terminus of a large number of transposase proteins. This domain contains four conserved cysteines suggestive of a zinc binding domain. Given the need for transposases to bind DNA as well as the large number of DNA-binding zinc fingers we hypothesize this domain is DNA-binding.	9.96184e-13
CP029250.1\|AZA26056.1\|2112574_2113357_-\|protein-tyrosine-phosphatase	gnl\|CDD\|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	9.84427e-73
CP029250.1\|AZA26058.1\|2114260_2115769_-\|glycerol-kinase	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0

>CP029250.1|AZA26059.1|2115965_2116634_+|cobalamin-biosynthesis-protein-CobQ
MDDNLIRIAYLYEDLMNTYGDSGDVKILRYFLQKKGWQTQIDNISLGSQFNADDYDFVFFGGGQDYEQSIVAKDLQRFKETLNDYIQAGNPMLAICGGYELMGTYYNTISGAKIKGLGILPLHTEFDPEKRMIGDTKYETEWGPTIGFENHSGQTFLDDRKMLKPFAKVVEGYGNNHEEKEDGVRYKNFIGSWSHGPMLKNENVANALVDMILKRHAARVAQ
>CP029250.1|AZA26058.1|2114260_2115769_-|glycerol-kinase
MSEQYILAIDEGTTSTRAIIFNHAGQQVASVAREFTQYFPKPGWVEHHAEEIWNAVQITTSTALINSAIRPDQLAAIGITNQRETTVVWDKETGRPIYPAIVWQSRQTSDIAEKLVKDGYSEMIRQKTGLVIDPYFSATKICWILDNVEGAQERAEKGELLFGTIDTWLVWKLTRGKVHVTDCTNASRTMLFNIHDLTWDQEIMDLLKIPRAMLPEVKSNSEVYGETDPYQFFGGRVPIAGMAGDQQAALFGQLAVKPGMVKNTYGTGSFIVMNTGEEPIESKNNLLTTIGYKLGDQVNYALEGSVFVAGSAIQWLRDSVKLLNSAPESEQAALESKDDNEVYVVPAFTGLGAPYWDSEARGAIFGLTRGSSDKDLIKATLQSLGYQTRDVVDTMQKDSGIEIPVLRVDGGASNNNYLLQFQADLLGKKIERAADLETTGLGAAFLAGLAVGYWQDLDSLKDIAKTGAAFAPKMEEAERDRLYVGWQRAVLATRVFAHGKDF
>CP029250.1|AZA26057.1|2113468_2114227_-|protein-tyrosine-phosphatase
MPKRIVKLEAGYNCRDLGGYVSQDGRTVKWGRLYRSGSLSHLTKADQAELARRKIVVDCDLRSRHEQDNFPDKLWPGAKLVDAHFYSESGDEEEEAEAAWEKYSGKLPKLSYLAMVYQQNLVAPRTGLVMRKIFKEMLTLEDDEALIYHCSMGKDRTGMVSVIVLMALGLEDREILRDYLLSREYSRDWDEADENDRLGQQIAKMNQTQVSQTAFYGITETIRQTWGGFDRYFASLGFGQGDLDRLRDKFLE
>CP029250.1|AZA26056.1|2112574_2113357_-|protein-tyrosine-phosphatase
MEMQRVIELDMPVNFRDLGGYQGLDGRRVKWRKIYRSAALNEMSARDRVKLANLSITVDCDLRSSREQRDYPDLLWPGVRFVNIGLYAEGDRFNQAHPFLRLFHHLPEFDDYLPKIYQQVLLNEHSEEGIKRVFEELLKLPEDQALVYHCAAGKDRTGIISILILMALGVDDKTIAEDYLLTDELYDFSIEKQHPTNEKLSQVIAKMNVTRGEGPAVKGITETIRQGWGSFDKFFTRKLGFKQADLEKFREMYLEEEEED
>CP029250.1|AZA26055.1|2112074_2112575_-|O-acetyl-ADP-ribose-deacetylase
MNLEIWQGNITTLKVDAIVNAANRELRGGGGVDGAIHRVAGPKLNEACRALGSCETGEAKITPGFNLPAKYIIHTVGPIYSGSHSDPLLLAACYRNSLRVAKENGLHSVAFSAISTGVYGYPLDAASKVAFGEVRKWLREHKDYEMRVIMVAYDARTYALYQKLLG
>CP029250.1|AZA26054.1|2111738_2111978_-|hypothetical-protein
MLRKYYVTIVFTLLALLNLLSSWGTLQYRLVMLALNLVCGFSMEYLVNKKAPAEKYNLWKGCTAAVLLAVNLLWIFLTK
>CP029250.1|AZA26053.1|2110765_2111680_+|cytochrome-C5
MARMSRRQYQERQEQTAQKQTRQTNPNSVPRLDTDGASRSDQKVRLNFWQIFADRPYVTVIMISLALFCILAKWWIGLAIIIILTIAGIFVIGRSHHPNRVLSLEFKLKASRKLSMIKALQLLGSNIMFLAAYMRQIVSVDFSSAGATDSLTVIQNMLSNQGTFGQQGSYFLNLFNQLTGGSLWGIYRYATNSSQMMNSTAGTMIILWIFLLMIAPAFCVLSQFFREPYSRHVMTVASLISTISFALTPTLMNRWVISYAVENQMSQAAAENAVQVGGMVYPAIISAIFVFILAIYREIKKDEF
>CP029250.1|AZA26052.1|2109214_2110582_-|ISL3-like-element-ISLdl1-family-transposase
MNYTELSVATQDVMPNKGVLFFKSGLSDFIQVGEPIQNEDGLTFVGKLDECGDTFCLNCSRKLVKNGSLESTLKHVAIGGIHTNIRVSYARFRCLNIDCQFNTRSQSIPFKADGYRITKPLKEYTEKLLSYGLTLKAVAWLTGLDKMTVKSIHKSLLLSKFTTDGKTLIKPERQAKYLAIDEFKLHDGHKYATAIIDWETGYILYLAHGKKKAVVFEFMDHVGDEWMSKVEAVACDMNSDFEEAFKGRYPKLDIVYDRFHIIKNFNDKVVSEIRKDEQRRLAEEGSPEAAKLLKNSRYILMSKRSTLVQKDEDARKDKLVSTAGEIFNTPEIKAHGGNEVWYDELLEENKLFFTIDLVKDLLDQAYNSHDEVEMCVRLEEIIDICKATKNSHFIWFARLLYRHLRGIYTFAKYGISTGKLEGINNKIKTERRKGYGYPDDEYFFLRLMELSRKAS
>CP029250.1|AZA26310.1|2107688_2108951_-|IS3-like-element-ISL6-family-transposase
MVDLIQKHGEDILDRPQQKYTANFKLAAIDRVLLGGEALSQVSLDLGLTNTGILANWLRSFKESGYTVITKKKGRPPKNAQKQGQTTDQRAGRAGKEAYSRACIHKKIGGLNSRTEEPRKEELARAITELRQELRLSVKYIIDVINANPGLPHISRSNYYYQTHKPDKDSGNQKLMDRIKEIFLEHSRRYGYRRIYGQLRREVYEINHKKVQRLMQKMGLFAISIRKKRKYSSYYGVQGKIKPDLIKRNFYAIIPDRHWFTDVTEFHLKDQKLYLSPIIDGCTQEIISYNISRHPDLKQVMTMLDDAFEKHPALNGLIFHSDRGWQYQHQAYQAALANRGIDQSMSRLGNSLDDGLMEGFFGILKREMFYGQEHKYKDLNELEQAIHKYIDYYNNVRIKTGRKNMTPIEYRNHVLTTLTA
>CP029250.1|AZA26051.1|2107051_2107318_-|hypothetical-protein
MIAEEADLAEKKEALATATAKAAATLHALNLAKARLAASEATQPTDRSQRLQLNRLPSRPKNLLQNQPLKNILKNQLIRKKILTAVTL
>CP029250.1|AZA26060.1|2117188_2119279_+|ATP-dependent-Clp-protease-ATP-binding-subunit
MDYNNFNDMDDLFRELMNGLGGFNSENRRYLINGRQVTPEEFAEYQKTGQLPGQGQAKNFQGKQKKANGILEKLGRNLTAEAREGKLDPVIGRNKEIQETAEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVHGNVPEAIKNKEIISIDISSLEAGTQYRGSFEQNIQDLVKEVKDRGNVILFFDEIHQILGAGGMGDGNGSKGMSDILKPALSRGEITVIGATTQDEYRNTIMKDTALARRFNEVTVNAPSPAETFKILKGIRSLYEKHHNVELPDDVLRAAIDYSVQYIPQRSLPDKAIDLLDMTAAHLAAQHPVTDAKTIEKQIKEEKQAQEKAAEKEDYEAALDHKAKAEKLEKQLSENHKERKTVATPADVAAAVERLTGIPVSKMGASDIERLKGLSSRLKAKVIGQDEAVEAVAKAIRRNRAGFDEGNRPIGSFLFVGPTGVGKTELAKQLALDMFGSKDAIIRLDMSEYSDRTAVSKLIGTTAGYVGYDDNSNTLTEKVRRNPYSIILLDEIEKADPQVITLLLQVLDDGRLTDGQGNTVNFKNTIIIATSNAGFGNEQLMGDAKKDEKLMDRLAPYFRPEFLNRFNAVIEFKHLTKEDLKKIVNLMLADVNKTLAKKGISLTVSESAKDYLIEQGYDEAMGARPLRRVIEQEIRDKVTDYYLDHLDVKKLKADMVDGTLVISEDK
>CP029250.1|AZA26061.1|2119808_2121515_-|transposase
MTRRKLRTQIKTIRAYTVRLSDDELQELDKLFNNYGRCRDLLYGQLCGINHMTDVENWRGPRDRIRQHEGKIKQARKALRSWKKAYAENKTQNMKVPDSGTVRLARQKLLNEQFHIQGRHVTEAVKEVCMNLNSMWTNLGLKLKKIVQANESLAKEERQYLNYVFTASYYWQLILQGRENEAESSKESKYPVLRAALTKDQLRHCFGYIRRLTRKHKPYPHSSAARCMLYDEIMWKVIQKDGADHLDIMTAVSGKRKQLKLTGPFCYANKKKRGDVQLILDRDKKRLEVHRAIKAAVHDLHKSKKKKVGMDKGLATLLSCSSGHEYGFNFSQLVNAEAERINRRNTNRNKYIQAAKELRHELSALQAKLAIKHSAKTERRLRNRIGSLERRISRLEERHLGSKLYHRQHARKQCNMERIMNMSIRKMLLTEKPDVLVKEDLSFTKENLPKAANRYEAKVRRKLSSWSKGTLDDRIEYLCDCLGIRTVDVNPAYTSQFCPNCGARFSERKGTHHELTVCPNCGEMNANTAAAVNILRRADDKNITLYTPYKKVEKILEDRYANKQSVMA
>CP029250.1|AZA26062.1|2121483_2122143_-|IS607-family-transposase
MAEEYLGIKDAAKYLKVSISTLRRWEKKGLITPMRTAGNRRRYTVRQLDDMLGLNTQKELGAVARRGLVIGYCRVSSSSQKADLERQAEVVANYCEKQGYQFRIIKDIGSGMNYKKKGLQELLRLVCEGGCSKIVVNYKDRLVRFGYELIETVCEEHNVDIEIINQTDDISYEEELTEDVLAIITVFSAKLYGKRSHRNEQINRKLFSKDDKKETKDSN
>CP029250.1|AZA26063.1|2122317_2123031_+|GGDEF-domain-containing-protein
MQPENLWDAITHQIKLSVFWKDRQRNFPGANQHFLDYYGLTLPEVIGHNDDKLGLNVHPENFQESEMQLLEDGGPVKERGKTRSRGRIREIMILKAPVYDQDQIVGLIGFFMDITNTSKQINRLENEAARDDLTSLKNRHNFARDFNYLTGKPILAMMLDVDHFKKFNDNFGHRYGDEVLKKISQALLKIYGIGHCYTGTGATNSWCSATLLILTRLRKKTGSSGKNWNMPGSWTST
>CP029250.1|AZA26064.1|2123582_2123984_-|hypothetical-protein
MGATSSTQASADYLAAPLTNGFLQGYNTLDALAALDFGITVVTAIKGFKIKEGKETSLALAKTGAIGFAGIAIIYLILISWLPWAPAACTTSNCLKTAGLLLPKSSTTTWALSGKPSWRPWLPSPACPRPSAW
>CP029250.1|AZA26065.1|2124729_2125953_+|IS110-family-transposase
MDSLKTVFGIDVSSRKSNVCIMVNGQKVNDYAISNDMVGFNQLLDDLKQVTNPQIIFEATGVYSRRLQAFLDMHELRYVMMNPLEAKRKTKDDLHQNKTDKLDAMYLAKMQSEHPQRLAYVQSEEYQELMANNRIYEQASHDLITNKNRLHKAIQLTFPEIEHLMANPRGKNYWSIVLKFPHPNIVLETKEADIIDFLKSLSGIGEKRANDLAQRLIRLAKLACPAVKKSSAHIRGLEMAINNILSAEETCQTALKEMAKLAPKRDLEILKSIPGIAENTALRIISELGDIRRFNNPNQLNAFVGVDPQVYESGNLTAHLSISKRGTAIGRKVLYLAINQIQSAKKVGNPCHIADYYEKRKRSSETASHKKAAIASIHKLLRTIFALITNDQLYSYDIAKHNQRLLS
>CP029250.1|AZA26066.1|2126075_2127329_-|transposase
MSSLPLFDTKNEPKIARSVEKFFKDYKVMELLRRCGLRKSKGIPLWSILSYIFSNVFPDRSMYMQQKSGKCTSGFSKNTYYRFMQNPHINWLRLTILLAERIVNGHLKDLTSDQRADCFVFDDSPYSRTGYKKTELAAKVFDHVSMTYKKGFRMMTMGWTDGSSFVPIASSLLSSKNDQNVIGTTKKINKRTIAAKRRIMARSKGTDVVIQLLDQALKAGLTAKYVMFDTWFSNPHQIVQISQRGLNVIAMVKKSSKITYEFEGKRMNVKQIFNACKKRRGRSRYLLSVPVKVGDPAKDGAQIDARIVCVRNRSNRKDWIALICTDMTIDENEIIRIYGKRWDIEVFFKTCKSFLKLGTEYHGLSYDALTAHTAFVFLRYMFMSVEKRNDEDDRTIGELFSTLSQVLSTILGNFILK
>CP029250.1|AZA26067.1|2127549_2127747_+|hypothetical-protein
MKNKILGNKLFKSGKVLIAVAGVSVIMTNAVIPVISTASANTNKVTPVHTASNWRANDQKPLIIT
>CP029250.1|AZA26312.1|2127819_2128485_+|hypothetical-protein
MFIRRSNSNNSTSNTEQKQVVAVNHDYSVTANNNVTDKAAADKAAADKAAASSNSESATVDSSSSSETTNPTVDTPFADKAVHTIYTGTNTYLYTTKELTTIATTPLQGNTSVIAYPDGITTALTGKNAGDPAIPVTYKGQNLYFKGTFEGLTSNGLYPDGYYYALTDTVFYGVVKPTDPSVKLDAPFLNGSTWFYFFDGGFTIYSYKNNVWTGNTFLNAQ
>CP029250.1|AZA26068.1|2128688_2128886_+|cold-shock-protein
MQNGTVKWFNADKGFGFITGSDGDVFVHFSSIKTNGFKSLEEGQKVSYDVEQGNRGPQATNVVPQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP029250_2	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	CP029250.1	721867-721901	0	1.0
CP029250_2	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	CP029250.1	1304402-1304436	0	1.0

1. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to position: 721867-721901, mismatch: 0, identity: 1.0

gtcgcccacttgggtcacttggacaagcaccatgt	CRISPR spacer
gtcgcccacttgggtcacttggacaagcaccatgt	Protospacer
***********************************

2. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to position: 1304402-1304436, mismatch: 0, identity: 1.0

gtcgcccacttgggtcacttggacaagcaccatgt	CRISPR spacer
gtcgcccacttgggtcacttggacaagcaccatgt	Protospacer
***********************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029250_2	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	CP031025	Lactobacillus phage ViSo-2018b, partial genome	39700-39734	0	1.0
CP029250_3	3.4\|1163363\|35\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163363-1163397	35	NC_022775	Lactobacillus phage phiJB, complete genome	14470-14504	0	1.0
CP029250_3	3.6\|1163508\|41\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163508-1163548	41	CP031026	Lactobacillus phage ViSo-2018a, partial genome	31610-31650	0	1.0
CP029250_3	3.6\|1163508\|41\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163508-1163548	41	KM514685	Lactobacillus phage Ldl1, complete genome	886-926	0	1.0
CP029250_3	3.10\|1163813\|43\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163813-1163855	43	CP031026	Lactobacillus phage ViSo-2018a, partial genome	38021-38063	0	1.0
CP029250_3	3.13\|1164040\|37\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164040-1164076	37	CP031026	Lactobacillus phage ViSo-2018a, partial genome	61675-61711	0	1.0
CP029250_3	3.14\|1164113\|38\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164113-1164150	38	CP031026	Lactobacillus phage ViSo-2018a, partial genome	42799-42836	0	1.0
CP029250_3	3.16\|1164263\|43\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164263-1164305	43	KM514685	Lactobacillus phage Ldl1, complete genome	276-318	0	1.0
CP029250_3	3.16\|1164263\|43\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164263-1164305	43	CP031026	Lactobacillus phage ViSo-2018a, partial genome	32233-32275	0	1.0
CP029250_3	3.18\|1164412\|38\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164412-1164449	38	EU409559	Lactobacillus phage JCL1032, complete genome	31883-31920	0	1.0
CP029250_2	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	EU409559	Lactobacillus phage JCL1032, complete genome	24689-24723	1	0.971
CP029250_2	2.2\|950531\|37\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950531-950567	37	NC_022775	Lactobacillus phage phiJB, complete genome	7486-7522	1	0.973
CP029250_3	3.9\|1163732\|45\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163732-1163776	45	KM514685	Lactobacillus phage Ldl1, complete genome	44499-44543	1	0.978
CP029250_3	3.9\|1163732\|45\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163732-1163776	45	CP031026	Lactobacillus phage ViSo-2018a, partial genome	62125-62169	1	0.978
CP029250_3	3.13\|1164040\|37\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164040-1164076	37	KM514685	Lactobacillus phage Ldl1, complete genome	45041-45077	1	0.973
CP029250_3	3.14\|1164113\|38\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164113-1164150	38	KM514685	Lactobacillus phage Ldl1, complete genome	63736-63773	1	0.974
CP029250_3	3.17\|1164342\|34\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164342-1164375	34	NC_022989	Lactobacillus phage LL-Ku, complete genome	23501-23534	1	0.971
CP029250_3	3.17\|1164342\|34\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1164342-1164375	34	KJ564037	Lactobacillus phage Ld17, complete genome	25138-25171	2	0.941
CP029250_2	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	CP031025	Lactobacillus phage ViSo-2018b, partial genome	3390-3424	3	0.914
CP029250_3	3.8\|1163661\|35\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163661-1163695	35	CP031026	Lactobacillus phage ViSo-2018a, partial genome	35511-35545	4	0.886
CP029250_3	3.4\|1163363\|35\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163363-1163397	35	NC_022775	Lactobacillus phage phiJB, complete genome	11175-11209	5	0.857
CP029250_3	3.3\|1163291\|36\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163291-1163326	36	KY705270	Streptococcus phage P7573, complete genome	36507-36542	10	0.722
CP029250_3	3.3\|1163291\|36\|CP029250\|CRISPRCasFinder,CRT,PILER-CR	1163291-1163326	36	MH892361	Streptococcus phage SW12, complete genome	34797-34832	10	0.722

1. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to CP031025 (Lactobacillus phage ViSo-2018b, partial genome) position: , mismatch: 0, identity: 1.0

gtcgcccacttgggtcacttggacaagcaccatgt	CRISPR spacer
gtcgcccacttgggtcacttggacaagcaccatgt	Protospacer
***********************************

2. spacer 3.4|1163363|35|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to NC_022775 (Lactobacillus phage phiJB, complete genome) position: , mismatch: 0, identity: 1.0

gacgacctgccattctagggggcagaacaatggaa	CRISPR spacer
gacgacctgccattctagggggcagaacaatggaa	Protospacer
***********************************

3. spacer 3.6|1163508|41|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 0, identity: 1.0

ccaattttaggacgaaaatatgttttcgtaaaggaaaaata	CRISPR spacer
ccaattttaggacgaaaatatgttttcgtaaaggaaaaata	Protospacer
*****************************************

4. spacer 3.6|1163508|41|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KM514685 (Lactobacillus phage Ldl1, complete genome) position: , mismatch: 0, identity: 1.0

ccaattttaggacgaaaatatgttttcgtaaaggaaaaata	CRISPR spacer
ccaattttaggacgaaaatatgttttcgtaaaggaaaaata	Protospacer
*****************************************

5. spacer 3.10|1163813|43|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 0, identity: 1.0

aaaaagccgcagaacgcactggcaacacacattgacgaggaag	CRISPR spacer
aaaaagccgcagaacgcactggcaacacacattgacgaggaag	Protospacer
*******************************************

6. spacer 3.13|1164040|37|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 0, identity: 1.0

gttatcaagcagtttggtagggaatataattggtttc	CRISPR spacer
gttatcaagcagtttggtagggaatataattggtttc	Protospacer
*************************************

7. spacer 3.14|1164113|38|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 0, identity: 1.0

ttactgaaattggcggtaacgttgttaaaaataacggt	CRISPR spacer
ttactgaaattggcggtaacgttgttaaaaataacggt	Protospacer
**************************************

8. spacer 3.16|1164263|43|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KM514685 (Lactobacillus phage Ldl1, complete genome) position: , mismatch: 0, identity: 1.0

tctaagtcttgaatcaagcggtaaccgatcttaccagcgtatg	CRISPR spacer
tctaagtcttgaatcaagcggtaaccgatcttaccagcgtatg	Protospacer
*******************************************

9. spacer 3.16|1164263|43|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 0, identity: 1.0

tctaagtcttgaatcaagcggtaaccgatcttaccagcgtatg	CRISPR spacer
tctaagtcttgaatcaagcggtaaccgatcttaccagcgtatg	Protospacer
*******************************************

10. spacer 3.18|1164412|38|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to EU409559 (Lactobacillus phage JCL1032, complete genome) position: , mismatch: 0, identity: 1.0

agattacaaaaaatttttaaagtaattcttcccataag	CRISPR spacer
agattacaaaaaatttttaaagtaattcttcccataag	Protospacer
**************************************

11. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to EU409559 (Lactobacillus phage JCL1032, complete genome) position: , mismatch: 1, identity: 0.971

gtcgcccacttgggtcacttggacaagcaccatgt	CRISPR spacer
gtcgtccacttgggtcacttggacaagcaccatgt	Protospacer
****.******************************

12. spacer 2.2|950531|37|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to NC_022775 (Lactobacillus phage phiJB, complete genome) position: , mismatch: 1, identity: 0.973

tagttaatagatggcatcagcgtgatgatcgcttgcc	CRISPR spacer
tagttaatagatggcatcagcgtgataatcgcttgcc	Protospacer
**************************.**********

13. spacer 3.9|1163732|45|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KM514685 (Lactobacillus phage Ldl1, complete genome) position: , mismatch: 1, identity: 0.978

taaaggcagagttttaaaacaatatgacaatagacgtgggcgcgg	CRISPR spacer
taaaggcagagttttaaaacaatatgacaatagacgtgggcgtgg	Protospacer
******************************************.**

14. spacer 3.9|1163732|45|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 1, identity: 0.978

taaaggcagagttttaaaacaatatgacaatagacgtgggcgcgg-	CRISPR spacer
taaaggcagagttttaaaacaatatgacaatagacgt-ggcgcggt	Protospacer
************************************* *******

15. spacer 3.13|1164040|37|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KM514685 (Lactobacillus phage Ldl1, complete genome) position: , mismatch: 1, identity: 0.973

gttatcaagcagtttggtagggaatataattggtttc	CRISPR spacer
gttatcaagcagtttggtaaggaatataattggtttc	Protospacer
*******************.*****************

16. spacer 3.14|1164113|38|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KM514685 (Lactobacillus phage Ldl1, complete genome) position: , mismatch: 1, identity: 0.974

ttactgaaattggcggtaacgttgttaaaaataacggt	CRISPR spacer
ttactgaaattggcggtaacgttgttaaaaagaacggt	Protospacer
******************************* ******

17. spacer 3.17|1164342|34|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to NC_022989 (Lactobacillus phage LL-Ku, complete genome) position: , mismatch: 1, identity: 0.971

cgaaaaagcgaagatcgcaactcacctttggaaa	CRISPR spacer
cgaaaaagcgaagattgcaactcacctttggaaa	Protospacer
***************.******************

18. spacer 3.17|1164342|34|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KJ564037 (Lactobacillus phage Ld17, complete genome) position: , mismatch: 2, identity: 0.941

cgaaaaagcgaagatcgcaactcacctttggaaa	CRISPR spacer
cgaaaaaccaaagatcgcaactcacctttggaaa	Protospacer
******* *.************************

19. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to CP031025 (Lactobacillus phage ViSo-2018b, partial genome) position: , mismatch: 3, identity: 0.914

gtcgcccacttgggtcacttggacaagcaccatgt-	CRISPR spacer
atcgcccacttgggtcacttggacaaa-accatgtc	Protospacer
.*************************. *******

20. spacer 3.8|1163661|35|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to CP031026 (Lactobacillus phage ViSo-2018a, partial genome) position: , mismatch: 4, identity: 0.886

ctttgctagacctcagcgcaaggatttctctctaa	CRISPR spacer
ttctgctagacctcatggcaaggatttctctctaa	Protospacer
.*.************  ******************

21. spacer 3.4|1163363|35|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to NC_022775 (Lactobacillus phage phiJB, complete genome) position: , mismatch: 5, identity: 0.857

gacgacctgccattctagggggcagaacaatggaa--	CRISPR spacer
gacgacctgccattctagagggcaga--aatgaacct	Protospacer
******************.*******  ****.*

22. spacer 3.3|1163291|36|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to KY705270 (Streptococcus phage P7573, complete genome) position: , mismatch: 10, identity: 0.722

gaaaataaaaaaagttgcaagcgaaagcttgctaga	CRISPR spacer
gtaaataaaaaaagtcccaagcgaaagccgtggaac	Protospacer
* *************. ***********.    *.

23. spacer 3.3|1163291|36|CP029250|CRISPRCasFinder,CRT,PILER-CR matches to MH892361 (Streptococcus phage SW12, complete genome) position: , mismatch: 10, identity: 0.722

gaaaataaaaaaagttgcaagcgaaagcttgctaga	CRISPR spacer
gtaaataaaaaaagtcccaagcgaaagccgtggaac	Protospacer
* *************. ***********.    *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

14315 : 68666

unidentified_phage(25.0%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26144.1\|14315_15578_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24437.1\|15637_16795_-	hypothetical protein	NA	NA	NA	NA
AZA24438.1\|18733_19783_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24439.1\|20300_21005_-	methyltransferase	NA	NA	NA	NA
AZA24440.1\|22038_23217_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA24441.1\|24548_25583_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.8e-42	32.9
AZA24442.1\|25680_26619_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.1e-17	32.2
AZA24443.1\|27840_28479_+	spermidine/putrescine ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	1.0e-19	31.6
AZA24444.1\|28475_29243_+	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
AZA24445.1\|29245_29491_+	hypothetical protein	NA	NA	NA	NA
AZA24446.1\|29711_30866_-	lysin	Q38317	Lactobacillus_phage	2.3e-59	56.2
AZA24447.1\|31127_31649_+	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	2.3e-14	31.4
AZA26145.1\|31830_33093_-\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA24448.1\|33625_34459_+	pyridoxamine kinase	NA	NA	NA	NA
AZA24449.1\|34494_35052_+	hypothetical protein	NA	NA	NA	NA
AZA24450.1\|35078_37844_-	DUF3427 domain-containing protein	Q5YA94	Bacillus_phage	1.4e-30	31.2
AZA24451.1\|37992_38715_+	hypothetical protein	NA	NA	NA	NA
AZA24452.1\|38910_40236_+\|transposase	transposase	C1KFS0	Lactobacillus_virus	5.8e-46	33.1
AZA24453.1\|40366_40567_+	hypothetical protein	NA	NA	NA	NA
AZA24454.1\|40842_41322_+	hypothetical protein	NA	NA	NA	NA
AZA24455.1\|41412_41841_+	transcriptional regulator	NA	NA	NA	NA
AZA24456.1\|41965_42811_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZA24457.1\|42889_43078_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
AZA24458.1\|43544_44117_+	hypothetical protein	NA	NA	NA	NA
AZA24459.1\|44272_44452_-	hypothetical protein	NA	NA	NA	NA
AZA24460.1\|50007_51057_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-43	33.1
AZA24461.1\|51633_52596_+	mannose-6-phosphate isomerase, class I	NA	NA	NA	NA
AZA24462.1\|53731_54175_+\|transposase	IS200/IS605 family transposase	A0A1P8BMC0	Lactococcus_phage	1.1e-25	44.2
AZA24463.1\|54197_55376_+\|transposase	transposase	Q5ULQ4	Lactobacillus_virus	7.3e-109	53.3
AZA26146.1\|55337_55541_-	hypothetical protein	NA	NA	NA	NA
AZA24464.1\|56265_57030_+	hypothetical protein	NA	NA	NA	NA
AZA24465.1\|57026_57809_+	hypothetical protein	NA	NA	NA	NA
AZA26147.1\|57869_59132_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA24466.1\|59321_59807_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AZA24467.1\|60260_61310_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
AZA26148.1\|61793_62930_+\|transposase	transposase	G3MB42	Bacillus_virus	7.4e-50	35.1
AZA26149.1\|63348_64068_-	aquaporin family protein	NA	NA	NA	NA
AZA24468.1\|64233_65148_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZA24469.1\|65326_66769_+	sucrose phosphorylase	NA	NA	NA	NA
AZA24470.1\|67487_68666_-\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

84308 : 149909

Bacillus_phage(22.73%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26150.1\|84308_85571_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24484.1\|85782_86691_+	L-lactate dehydrogenase	NA	NA	NA	NA
AZA24485.1\|86809_87667_+	2,5-diketo-D-gluconic acid reductase	A0A2H4PQR8	Staphylococcus_phage	9.5e-50	40.7
AZA24486.1\|87935_89159_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.9e-98	49.0
AZA24487.1\|89624_91844_+	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	A0A068F3I8	Mycobacterium_phage	5.3e-84	34.2
AZA24488.1\|91950_93000_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24489.1\|93162_93690_+	hypothetical protein	NA	NA	NA	NA
AZA24490.1\|93691_94240_+	ECF transporter S component	NA	NA	NA	NA
AZA24491.1\|94232_94796_+	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
AZA26151.1\|94867_96130_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	6.1e-29	35.3
AZA24492.1\|96515_97517_-	D-2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	2.5e-49	35.2
AZA24493.1\|97806_99162_-	FAD-binding protein	NA	NA	NA	NA
AZA24494.1\|99570_100002_+	peptide deformylase	NA	NA	NA	NA
AZA24495.1\|100046_100577_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24496.1\|100566_101046_-	S-ribosylhomocysteinase	NA	NA	NA	NA
AZA26152.1\|101456_101579_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZA24497.1\|102040_103636_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZA24498.1\|103798_105376_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.2e-11	29.9
AZA24499.1\|105963_107331_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	1.2e-30	28.8
AZA24500.1\|107450_108359_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZA26153.1\|108542_109805_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24501.1\|110059_110761_+	hypothetical protein	NA	NA	NA	NA
AZA24502.1\|110841_112749_+	DNA mismatch repair protein MutS	F2QAG1	Chrysochromulina_ericina_virus	4.3e-18	30.1
AZA24503.1\|112899_113949_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24504.1\|115247_116615_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	1.2e-30	28.8
AZA24505.1\|116779_117904_+	5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase	A0A218MNE0	uncultured_virus	1.1e-66	38.9
AZA24506.1\|118070_119009_+	glucokinase	NA	NA	NA	NA
AZA24507.1\|119060_119984_-	L-lactate dehydrogenase	NA	NA	NA	NA
AZA24508.1\|120598_121825_-	MFS transporter	NA	NA	NA	NA
AZA24509.1\|122146_122302_+	fumarate reductase flavoprotein subunit	NA	NA	NA	NA
AZA24510.1\|122445_123366_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA24511.1\|123550_124036_+	shikimate dehydrogenase	NA	NA	NA	NA
AZA24512.1\|124673_125375_+	hypothetical protein	NA	NA	NA	NA
AZA24513.1\|125408_125588_+	hypothetical protein	NA	NA	NA	NA
AZA24514.1\|125669_127075_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-42	40.7
AZA24515.1\|127206_128139_+	quinate/shikimate dehydrogenase	NA	NA	NA	NA
AZA24516.1\|128183_129110_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	6.0e-58	40.7
AZA24517.1\|131179_131647_+	hypothetical protein	NA	NA	NA	NA
AZA24518.1\|131940_132990_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24519.1\|133016_133178_+	bacitracin ABC transporter	NA	NA	NA	NA
AZA24520.1\|133338_135462_+	hypothetical protein	NA	NA	NA	NA
AZA24521.1\|135495_136071_-	hypothetical protein	NA	NA	NA	NA
AZA24522.1\|136228_136528_+	hypothetical protein	NA	NA	NA	NA
AZA24523.1\|137801_138053_+	hypothetical protein	NA	NA	NA	NA
AZA24524.1\|138395_139724_+	HNH endonuclease	Q331Y3	Clostridium_botulinum_C_phage	7.3e-57	37.7
AZA24525.1\|140790_141615_-	glycosyl transferase	NA	NA	NA	NA
AZA24526.1\|141642_142419_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZA24527.1\|142679_143408_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.4e-40	38.5
AZA24528.1\|143454_145350_+	cell wall metabolism sensor histidine kinase WalK	A0A1V0SGX0	Hokovirus	7.1e-21	23.1
AZA24529.1\|145339_146914_+	hypothetical protein	NA	NA	NA	NA
AZA24530.1\|146914_147715_+	hypothetical protein	NA	NA	NA	NA
AZA24531.1\|147733_148531_+	MBL fold hydrolase	A0A2I7SDH3	Paenibacillus_phage	2.5e-28	32.0
AZA24532.1\|148625_149909_+\|protease	serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	2.0e-19	28.5

DBSCAN-SWA_3

153122 : 194963

unidentified_phage(20.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26154.1\|153122_154385_-\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA24537.1\|154596_155775_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA24538.1\|156530_156713_+	hypothetical protein	NA	NA	NA	NA
AZA24539.1\|156884_157226_+	hypothetical protein	NA	NA	NA	NA
AZA24540.1\|157290_157656_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
AZA24541.1\|157790_158459_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AZA24542.1\|158468_159824_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-09	24.2
AZA24543.1\|160123_161599_+	MFS transporter	NA	NA	NA	NA
AZA24544.1\|162562_163381_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZA24545.1\|163438_163651_-	hypothetical protein	NA	NA	NA	NA
AZA24546.1\|163664_164279_-	hypothetical protein	NA	NA	NA	NA
AZA24547.1\|164351_164705_+	hypothetical protein	NA	NA	NA	NA
AZA24548.1\|164841_165741_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
AZA24549.1\|165757_166312_-	LemA family protein	A0A1X9IGG1	Lactococcus_phage	7.8e-13	32.0
AZA24550.1\|166469_167627_-	cation transporter	NA	NA	NA	NA
AZA24551.1\|168219_168354_+	hypothetical protein	NA	NA	NA	NA
AZA24552.1\|168475_169387_+	HNH endonuclease	NA	NA	NA	NA
AZA24553.1\|169616_170744_+	LysM peptidoglycan-binding domain-containing protein	D2KRB9	Lactobacillus_phage	6.7e-19	44.0
AZA24554.1\|171449_172211_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-28	37.2
AZA24555.1\|172214_173798_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24556.1\|174267_175317_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24557.1\|175440_176067_-	3-methyladenine DNA glycosylase	NA	NA	NA	NA
AZA24558.1\|176149_176521_+	DUF488 domain-containing protein	NA	NA	NA	NA
AZA24559.1\|176507_177206_-	NAD-dependent protein deacylase	NA	NA	NA	NA
AZA24560.1\|177433_177913_+	hypothetical protein	NA	NA	NA	NA
AZA24561.1\|177964_179428_-	cardiolipin synthase	NA	NA	NA	NA
AZA24562.1\|179429_180374_-	alpha/beta hydrolase	NA	NA	NA	NA
AZA24563.1\|180446_181214_+	ribonuclease	A0A1L6Z550	Klebsiella_phage	1.1e-17	35.3
AZA24564.1\|181301_182258_-	DUF1002 domain-containing protein	NA	NA	NA	NA
AZA26155.1\|182605_183442_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZA24565.1\|183425_184085_+	alpha/beta hydrolase	NA	NA	NA	NA
AZA26156.1\|184187_185180_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	9.7e-38	31.9
AZA24566.1\|185310_186360_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-43	33.1
AZA24567.1\|186595_187276_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZA24568.1\|187286_188120_+	hypothetical protein	NA	NA	NA	NA
AZA24569.1\|188159_188810_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AZA24570.1\|189004_189625_-\|transposase	IS630 family transposase	NA	NA	NA	NA
AZA24571.1\|189630_190143_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZA24572.1\|191582_192926_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.2e-48	30.1
AZA24573.1\|192882_193116_-	hypothetical protein	NA	NA	NA	NA
AZA24574.1\|193566_193866_+	hypothetical protein	NA	NA	NA	NA
AZA24575.1\|193760_194963_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_4

233244 : 294765

Streptococcus_phage(26.67%)

tRNA,integrase,transposase

attL 232058:232117|attR 271124:273550

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
232058:232117	attL	NA	NA	NA	NA
AZA24606.1\|233244_234423_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA24607.1\|234956_236159_-\|transposase	transposase	NA	NA	NA	NA
AZA24608.1\|236053_236353_-	hypothetical protein	NA	NA	NA	NA
AZA24609.1\|236703_238725_-	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	3.4e-66	34.1
AZA26157.1\|238875_239250_-	hypothetical protein	NA	NA	NA	NA
AZA24610.1\|239405_240353_-	hypothetical protein	NA	NA	NA	NA
AZA24611.1\|240524_241772_-\|integrase	site-specific integrase	A0A1S5S7K9	Streptococcus_phage	4.3e-59	36.2
AZA24612.1\|241874_242855_-	hypothetical protein	A0A1W6JPS3	Staphylococcus_phage	1.6e-08	47.1
AZA24613.1\|243094_243289_+	DNA-binding protein	NA	NA	NA	NA
AZA24614.1\|243279_243570_+	DNA-binding protein	NA	NA	NA	NA
AZA24615.1\|243774_244089_+	hypothetical protein	NA	NA	NA	NA
AZA24616.1\|244088_244952_+	hypothetical protein	A0A2H4JEH3	uncultured_Caudovirales_phage	5.7e-10	24.8
AZA24617.1\|244948_246466_+	hypothetical protein	I1TLI2	Bacillus_phage	1.7e-54	35.0
AZA24618.1\|247037_251765_+	helicase	A0A2H4UTW8	Bodo_saltans_virus	8.1e-50	28.1
AZA26158.1\|251809_253072_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24619.1\|254706_255672_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZA24620.1\|255717_256467_-	hypothetical protein	NA	NA	NA	NA
AZA24621.1\|256630_257320_+	2,3-diphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AZA24622.1\|257571_258855_+	LytR family transcriptional regulator	NA	NA	NA	NA
AZA24623.1\|258857_259475_+	hypothetical protein	NA	NA	NA	NA
AZA24624.1\|259553_262556_+	glucan modification protein	NA	NA	NA	NA
AZA24625.1\|262876_263983_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	5.1e-88	46.0
AZA24626.1\|265494_266760_+\|tRNA	tyrosine--tRNA ligase	K4F5T3	Cronobacter_phage	5.1e-84	41.9
AZA24627.1\|268083_268797_+	hypothetical protein	NA	NA	NA	NA
AZA24628.1\|268817_269996_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA24629.1\|271370_272558_+	amidohydrolase	NA	NA	NA	NA
AZA24630.1\|272896_274301_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-42	40.7
271124:273550	attR	NA	NA	NA	NA
AZA24631.1\|274589_274772_+	cytochrome C551	NA	NA	NA	NA
AZA24632.1\|274978_276085_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	5.1e-88	46.0
AZA24633.1\|276500_277550_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA24634.1\|277748_278048_+	hypothetical protein	NA	NA	NA	NA
AZA24635.1\|277942_279145_+\|transposase	transposase	NA	NA	NA	NA
AZA24636.1\|279734_279905_-\|transposase	transposase	NA	NA	NA	NA
AZA24637.1\|280072_280723_+	HD domain-containing protein	S4W232	Pandoravirus	1.2e-07	25.7
AZA24638.1\|282390_283674_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.9e-58	33.3
AZA24639.1\|287030_288659_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24640.1\|288816_289866_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA24641.1\|290140_291769_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24642.1\|291942_292155_+	hypothetical protein	NA	NA	NA	NA
AZA24643.1\|293586_294765_+\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

322503 : 373940

Bacillus_phage(23.53%)

tRNA,bacteriocin,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26159.1\|322503_323766_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	1.0e-55	45.8
AZA24664.1\|323966_325439_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AZA24665.1\|325595_326438_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZA24666.1\|327338_328388_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24667.1\|329836_330208_-	toxin-antitoxin system HicB family antitoxin	A0A0K2CZV4	Paenibacillus_phage	8.9e-21	45.6
AZA24668.1\|331768_332581_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24669.1\|332632_333382_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	3.9e-31	38.4
AZA26160.1\|333378_334089_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZA24670.1\|334509_335274_+	phosphorylase	F5CA76	Streptococcus_phi-m46.1-like_phage	1.5e-43	52.2
AZA24671.1\|335353_336616_-	carboxylate--amine ligase	NA	NA	NA	NA
AZA26161.1\|336717_337980_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24672.1\|338170_339136_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AZA24673.1\|339296_340691_-	amino acid permease	NA	NA	NA	NA
AZA24674.1\|340768_341701_+	homocysteine S-methyltransferase	NA	NA	NA	NA
AZA24675.1\|341756_342218_+\|tRNA	prolyl-tRNA editing protein	NA	NA	NA	NA
AZA24676.1\|342578_343025_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZA24677.1\|343006_344029_+	asparaginase	NA	NA	NA	NA
AZA26162.1\|344212_344968_+	hydrolase Cof	NA	NA	NA	NA
AZA24678.1\|345053_345530_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZA24679.1\|345609_347043_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	1.5e-103	45.3
AZA24680.1\|347111_347666_-	isochorismatase	G3MA16	Bacillus_virus	8.9e-33	39.1
AZA24681.1\|347918_348776_+	hypothetical protein	NA	NA	NA	NA
AZA24682.1\|348768_349035_-	DUF1294 domain-containing protein	NA	NA	NA	NA
AZA24683.1\|349131_349902_-	NUDIX domain-containing protein	NA	NA	NA	NA
AZA24684.1\|350059_350251_+	hypothetical protein	NA	NA	NA	NA
AZA26163.1\|351713_353060_+	histidine kinase	NA	NA	NA	NA
AZA24685.1\|353052_353829_+	DNA-binding response regulator	NA	NA	NA	NA
AZA24686.1\|354199_355249_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24687.1\|355431_355719_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AZA24688.1\|355905_356157_+	hypothetical protein	NA	NA	NA	NA
AZA26164.1\|356226_357489_-\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA24689.1\|358310_359360_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA24690.1\|359660_360320_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	7.1e-45	48.3
AZA24691.1\|360291_361842_+\|transposase	transposase	NA	NA	NA	NA
AZA24692.1\|363088_363799_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.7e-16	26.7
AZA24693.1\|364217_364886_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZA24694.1\|365207_366233_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AZA26165.1\|366237_366717_+	competence protein ComE	A7KUY9	Bacillus_phage	5.3e-34	55.5
AZA24695.1\|366697_367312_+	methanol dehydrogenase	NA	NA	NA	NA
AZA24696.1\|367669_370360_+	magnesium-translocating P-type ATPase	M1HJQ2	Paramecium_bursaria_Chlorella_virus	4.3e-40	25.1
AZA26166.1\|370550_371813_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24697.1\|371957_373940_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.9e-93	37.0

DBSCAN-SWA_6

446439 : 571905

107

Bacillus_phage(26.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA24772.1\|446439_447228_+\|tRNA	tRNA pseudouridine synthase A	NA	NA	NA	NA
AZA24773.1\|447333_447777_+	50S ribosomal protein L13	NA	NA	NA	NA
AZA24774.1\|447789_448185_+	30S ribosomal protein S9	NA	NA	NA	NA
AZA24775.1\|448494_449673_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA24776.1\|449863_450058_+	hypothetical protein	NA	NA	NA	NA
AZA24777.1\|450273_450573_+	hypothetical protein	NA	NA	NA	NA
AZA24778.1\|452717_453341_+	ADP-ribose pyrophosphatase	NA	NA	NA	NA
AZA24779.1\|454671_455163_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
AZA26171.1\|455947_457129_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZA24780.1\|457115_458171_+	hypothetical protein	NA	NA	NA	NA
AZA24781.1\|458766_459816_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
AZA26172.1\|459937_461551_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24782.1\|461722_462835_+	hypothetical protein	NA	NA	NA	NA
AZA24783.1\|462849_463917_+	hypothetical protein	NA	NA	NA	NA
AZA26173.1\|463983_464685_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZA24784.1\|464847_465987_+	CDP-glycerol--glycerophosphate glycerophosphotransferase	NA	NA	NA	NA
AZA24785.1\|465990_467418_+	flippase	NA	NA	NA	NA
AZA24786.1\|467468_468203_+	glycosyltransferase	NA	NA	NA	NA
AZA24787.1\|468202_469303_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZA24788.1\|469299_470001_+	glycosyl transferase	A0A1V0SL98	Klosneuvirus	4.8e-07	29.2
AZA24789.1\|470105_470936_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	5.2e-69	52.9
AZA24790.1\|471141_473808_+	calcium-translocating P-type ATPase, PMCA-type	A0A1J0FA34	Only_Syngen_Nebraska_virus	9.2e-75	28.8
AZA24791.1\|473964_474162_+	hypothetical protein	NA	NA	NA	NA
AZA24792.1\|474363_474834_+	hypothetical protein	NA	NA	NA	NA
AZA24793.1\|474851_475370_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.3e-13	35.6
AZA26174.1\|475409_475871_+	SprT family protein	NA	NA	NA	NA
AZA24794.1\|476104_476728_+	ECF transporter S component	NA	NA	NA	NA
AZA24795.1\|476741_477395_+	N-acetylmuramidase	S5M633	Brevibacillus_phage	1.3e-27	48.0
AZA24796.1\|477580_478240_+\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	9.2e-45	47.7
AZA24797.1\|480144_482406_+	DNA helicase PcrA	A7KV33	Bacillus_phage	1.9e-126	41.3
AZA24798.1\|482416_484432_+	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.6e-100	36.7
AZA24799.1\|484428_485574_+	CamS family sex pheromone protein	NA	NA	NA	NA
AZA24800.1\|485585_485891_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
AZA24801.1\|485890_487333_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A	NA	NA	NA	NA
AZA24802.1\|487338_488769_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B	NA	NA	NA	NA
AZA24803.1\|488804_489731_+	diacylglycerol kinase	A0A1V0SBJ0	Catovirus	1.4e-14	25.9
AZA24804.1\|489791_490505_+	DUF1211 domain-containing protein	NA	NA	NA	NA
AZA24805.1\|490507_491863_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	F5CA72	Streptococcus_phi-m46.1-like_phage	4.4e-110	48.1
AZA24806.1\|492045_492903_+	Mrr restriction system protein	NA	NA	NA	NA
AZA24807.1\|493020_494070_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA24808.1\|494434_495070_+	carbonic anhydrase family protein	NA	NA	NA	NA
AZA24809.1\|496586_498512_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.4e-93	33.9
AZA24810.1\|498690_499740_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24811.1\|501107_501674_+	nodulation protein L	NA	NA	NA	NA
AZA24812.1\|501763_502024_+	DUF1304 domain-containing protein	NA	NA	NA	NA
AZA24813.1\|501980_502337_+	DUF1304 domain-containing protein	NA	NA	NA	NA
AZA24814.1\|502463_502949_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZA24815.1\|503157_504969_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	3.4e-89	37.2
AZA26175.1\|505187_506450_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26176.1\|506538_509268_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZA26177.1\|509433_510696_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24816.1\|511122_512745_+	ABC-F family ATPase	A0A2K9L3Z8	Tupanvirus	1.9e-46	25.5
AZA24817.1\|512804_512927_-	alpha-ketoglutarate permease	NA	NA	NA	NA
AZA24818.1\|513088_513454_-	hypothetical protein	NA	NA	NA	NA
AZA24819.1\|513696_514896_-	multidrug transporter subunit MdtG	NA	NA	NA	NA
AZA24820.1\|515034_515748_-	hypothetical protein	NA	NA	NA	NA
AZA24821.1\|516014_516800_+	glutamate racemase	NA	NA	NA	NA
AZA24822.1\|516877_518299_+	dipeptidase	NA	NA	NA	NA
AZA24823.1\|518312_519398_+	M42 family peptidase	NA	NA	NA	NA
AZA24824.1\|519605_520175_+	hypothetical protein	NA	NA	NA	NA
AZA24825.1\|520504_521131_-	uridine kinase	A0A1V0SAA3	Catovirus	7.2e-39	42.8
AZA24826.1\|521130_521787_-	uridine kinase	A0A1V0SAA3	Catovirus	9.9e-39	39.7
AZA24827.1\|522329_523070_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-33	41.7
AZA24828.1\|523091_523931_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24829.1\|523930_524572_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZA24830.1\|524583_525252_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZA24831.1\|525293_526139_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24832.1\|526344_527856_+	HD domain-containing protein	NA	NA	NA	NA
AZA24833.1\|527859_530025_+	RNA degradosome polyphosphate kinase	NA	NA	NA	NA
AZA24834.1\|530033_531431_+	DUF2252 domain-containing protein	NA	NA	NA	NA
AZA24835.1\|531427_532345_+	hypothetical protein	NA	NA	NA	NA
AZA26178.1\|532847_533117_+	hypothetical protein	NA	NA	NA	NA
AZA24836.1\|533133_533379_+	hypothetical protein	NA	NA	NA	NA
AZA24837.1\|533525_534023_+	hypothetical protein	NA	NA	NA	NA
AZA24838.1\|534089_535010_+	ribokinase	NA	NA	NA	NA
AZA24839.1\|535025_535676_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZA24840.1\|535688_536381_+	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
AZA26179.1\|536566_537829_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	1.7e-55	46.0
AZA24841.1\|537947_538883_+	purine nucleosidase	NA	NA	NA	NA
AZA24842.1\|538891_539614_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZA24843.1\|539995_542398_+	phosphoketolase family protein	NA	NA	NA	NA
AZA24844.1\|542535_542841_+	sortase	NA	NA	NA	NA
AZA24845.1\|542980_544327_+	hemolysin	NA	NA	NA	NA
AZA24846.1\|544435_545008_+	hypoxanthine phosphoribosyltransferase	A0A218MMB5	uncultured_virus	6.0e-08	29.3
AZA24847.1\|545088_546381_-	amino acid permease	NA	NA	NA	NA
AZA24848.1\|546487_547174_+	1,4-beta-N-acetylmuramidase	NA	NA	NA	NA
AZA24849.1\|547170_548415_+	ATP-dependent helicase	A0A1B1IS59	uncultured_Mediterranean_phage	5.6e-35	26.6
AZA24850.1\|548407_549727_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
AZA24851.1\|550888_552202_+\|transposase	IS4 family transposase	NA	NA	NA	NA
AZA26180.1\|552269_553532_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24852.1\|553743_554922_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA26181.1\|556072_557335_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	1.4e-54	45.2
AZA26182.1\|557525_557930_+	hypothetical protein	NA	NA	NA	NA
AZA26183.1\|557913_558180_-	hypothetical protein	NA	NA	NA	NA
AZA24853.1\|558161_559445_+	uracil permease	Q9KX94	Enterobacteria_phage	7.8e-64	35.6
AZA24854.1\|559557_560808_+	aluminum resistance protein	NA	NA	NA	NA
AZA24855.1\|560880_562968_-	putative ornithine decarboxylase	NA	NA	NA	NA
AZA24856.1\|563007_563250_-	hypothetical protein	NA	NA	NA	NA
AZA24857.1\|563709_565164_+	amino acid permease	NA	NA	NA	NA
AZA24858.1\|565246_565441_-	hypothetical protein	NA	NA	NA	NA
AZA24859.1\|565542_566685_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	2.3e-27	35.0
AZA24860.1\|566726_567206_-	GtrA family protein	NA	NA	NA	NA
AZA24861.1\|567198_567645_-	flavodoxin	NA	NA	NA	NA
AZA24862.1\|567791_568619_+	type I methionyl aminopeptidase	NA	NA	NA	NA
AZA24863.1\|568621_569536_+	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
AZA24864.1\|569659_570574_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	8.2e-76	49.2
AZA26184.1\|570642_571905_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6

DBSCAN-SWA_7

582328 : 640679

Bacillus_phage(23.53%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA24876.1\|582328_584524_-\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	7.4e-123	39.4
AZA24877.1\|584692_584893_+	hypothetical protein	NA	NA	NA	NA
AZA24878.1\|584999_585266_+	phosphocarrier protein HPr	NA	NA	NA	NA
AZA24879.1\|585265_586993_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AZA24880.1\|587259_588255_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-41	32.5
AZA24881.1\|588421_588826_+	transcriptional regulator Spx	NA	NA	NA	NA
AZA26185.1\|588928_589678_+	adaptor protein MecA	NA	NA	NA	NA
AZA26186.1\|591372_591447_+	hypothetical protein	NA	NA	NA	NA
AZA24882.1\|592300_592945_-	dithiol-disulfide isomerase	NA	NA	NA	NA
AZA24883.1\|593025_593628_-	CYTH domain-containing protein	NA	NA	NA	NA
AZA24884.1\|593731_594364_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
AZA24885.1\|594360_595158_+	NAD kinase	NA	NA	NA	NA
AZA24886.1\|595172_596066_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	7.7e-10	29.9
AZA26187.1\|596279_597542_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24887.1\|597613_597802_-	hypothetical protein	NA	NA	NA	NA
AZA24888.1\|597873_598701_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
AZA24889.1\|598859_599909_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA24890.1\|599978_600989_-	lactonase family protein	NA	NA	NA	NA
AZA24891.1\|601153_601534_+	PTS sorbitol transporter subunit IIA	NA	NA	NA	NA
AZA24892.1\|601543_602734_+	AI-2E family transporter	NA	NA	NA	NA
AZA24893.1\|602730_603288_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
AZA24894.1\|603318_603714_+	DUF1149 domain-containing protein	NA	NA	NA	NA
AZA24895.1\|603733_606100_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.1e-84	48.5
AZA24896.1\|606105_607329_+	insulinase family protein	NA	NA	NA	NA
AZA24897.1\|607325_608579_+	insulinase family protein	NA	NA	NA	NA
AZA24898.1\|608575_609304_+	KR domain-containing protein	NA	NA	NA	NA
AZA24899.1\|609371_610514_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZA24900.1\|610558_611122_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
AZA26188.1\|611187_612450_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24901.1\|612790_613900_+	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	5.6e-119	61.2
AZA26189.1\|613971_615234_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24902.1\|615510_617154_+	ribonuclease Y	NA	NA	NA	NA
AZA24903.1\|617257_618457_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
AZA24904.1\|618509_619169_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	2.0e-39	43.5
AZA24905.1\|619212_620490_+	DNA/RNA helicase	A0A1X9I5S6	Streptococcus_phage	5.3e-81	43.1
AZA24906.1\|620486_621173_+	ComF family protein	NA	NA	NA	NA
AZA24907.1\|621252_621810_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
AZA24908.1\|621969_624372_+	preprotein translocase subunit SecA	NA	NA	NA	NA
AZA24909.1\|624459_625575_+	peptide chain release factor 2	NA	NA	NA	NA
AZA24910.1\|625586_625889_+	hypothetical protein	NA	NA	NA	NA
AZA24911.1\|625863_626823_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZA24912.1\|626822_627656_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AZA24913.1\|627661_628678_+	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AZA24914.1\|628749_629682_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	5.4e-75	46.1
AZA24915.1\|629802_631845_+	excinuclease ABC subunit B	NA	NA	NA	NA
AZA24916.1\|631834_634693_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	1.3e-305	56.0
AZA24917.1\|634789_635332_+	hypothetical protein	NA	NA	NA	NA
AZA24918.1\|637179_638058_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	1.3e-09	29.9
AZA24919.1\|638067_639087_+	hypothetical protein	A1IMD5	Streptococcus_phage	8.3e-85	50.5
AZA24920.1\|639094_640027_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.8e-46	34.2
AZA24921.1\|640094_640679_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.2e-53	56.0

DBSCAN-SWA_8

651687 : 761263

118

Lactobacillus_phage(51.72%)

integrase,capsid,transposase,terminase,tRNA,holin

attL 678947:678964|attR 729048:729065

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26192.1\|651687_652950_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	8.5e-55	45.2
AZA24930.1\|653381_653948_+	N-acetyltransferase	NA	NA	NA	NA
AZA24931.1\|653904_654474_-	hypothetical protein	NA	NA	NA	NA
AZA24932.1\|654470_655355_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AZA24933.1\|655515_656199_+	uracil-DNA glycosylase	S4VYQ4	Pandoravirus	1.4e-43	43.7
AZA24934.1\|656219_657209_+	phosphate acetyltransferase	NA	NA	NA	NA
AZA24935.1\|657219_657705_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZA24936.1\|657780_658317_-	exonuclease	NA	NA	NA	NA
AZA24937.1\|658439_659333_+	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
AZA26193.1\|659373_660462_+	spermidine/putrescine import ATP-binding protein PotA	Q6GZ03	Mycoplasma_phage	5.1e-32	40.8
AZA24938.1\|660464_661277_+	spermidine/putrescine ABC transporter permease	Q6GZ02	Mycoplasma_phage	2.8e-11	25.0
AZA24939.1\|661273_662077_+	spermidine/putrescine ABC transporter permease PotC	NA	NA	NA	NA
AZA24940.1\|662073_663156_+	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24941.1\|663187_664027_+	TIGR00159 family protein	NA	NA	NA	NA
AZA24942.1\|664026_664977_+	hypothetical protein	NA	NA	NA	NA
AZA24943.1\|665000_666353_+	phosphoglucosamine mutase	NA	NA	NA	NA
AZA24944.1\|666485_667298_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AZA24945.1\|667349_668324_+	serine hydrolase	A0A1J0GRK9	Mycobacterium_phage	6.2e-05	26.0
AZA24946.1\|668402_668846_+	CopY/TcrY family copper transport repressor	NA	NA	NA	NA
AZA24947.1\|668839_669214_+	copper-binding protein	NA	NA	NA	NA
AZA24948.1\|669213_671130_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.0e-89	36.5
AZA26194.1\|673013_674276_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	8.5e-55	45.2
AZA24949.1\|674392_674851_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
AZA24950.1\|674947_675604_+	saccharopine dehydrogenase	NA	NA	NA	NA
AZA24951.1\|675690_677322_-	APC family permease	NA	NA	NA	NA
AZA24952.1\|677581_678109_+	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AZA24953.1\|678125_678974_+	patatin family protein	NA	NA	NA	NA
678947:678964	attL	NA	NA	NA	NA
AZA24954.1\|679059_679941_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA24955.1\|680047_680569_+	VanZ family protein	NA	NA	NA	NA
AZA24956.1\|680651_681383_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZA24957.1\|681542_682514_+	competence protein	NA	NA	NA	NA
AZA24958.1\|682485_683484_+	type II secretion system protein F	NA	NA	NA	NA
AZA26195.1\|683690_684953_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA24959.1\|684952_685291_+	prepilin-type cleavage/methylation domain-containing protein	NA	NA	NA	NA
AZA24960.1\|685287_685725_+	type II secretion system protein	NA	NA	NA	NA
AZA24961.1\|685714_685981_+	type II secretion system protein	NA	NA	NA	NA
AZA24962.1\|685949_686567_+	hypothetical protein	NA	NA	NA	NA
AZA24963.1\|686708_687707_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZA24964.1\|687740_688928_+	acetate kinase	NA	NA	NA	NA
AZA24965.1\|689422_690529_-\|integrase	site-specific integrase	U3PCM7	Lactobacillus_phage	7.1e-199	92.9
AZA24966.1\|690531_691065_-	hypothetical protein	Q37954	Lactococcus_phage	7.9e-63	93.9
AZA24967.1\|691079_691745_-	XRE family transcriptional regulator	U3PIS7	Lactobacillus_phage	1.8e-120	95.9
AZA24968.1\|691901_692096_+	XRE family transcriptional regulator	U3PDM7	Lactobacillus_phage	1.9e-27	96.9
AZA24969.1\|692130_692298_+	hypothetical protein	Q14T69	Lactococcus_phage	2.9e-19	80.0
AZA24970.1\|692512_692791_+	hypothetical protein	U3PCN4	Lactobacillus_phage	9.0e-26	64.1
AZA24971.1\|692754_694152_+	DEAD/DEAH box helicase	U3PFS7	Lactobacillus_phage	1.6e-248	93.1
AZA24972.1\|694151_694841_+	NTP-binding protein	U3PIS9	Lactobacillus_phage	4.7e-124	94.3
AZA24973.1\|694860_695430_+	hypothetical protein	U3PDN3	Lactobacillus_phage	4.9e-95	92.1
AZA24974.1\|695439_696234_+	DNA primase	U3PBE3	Lactobacillus_phage	3.0e-138	92.8
AZA24975.1\|696226_697546_+	hypothetical protein	U3PCP1	Lactobacillus_phage	1.3e-231	90.0
AZA24976.1\|697819_698239_+	hypothetical protein	Q8SDG8	Lactococcus_phage	1.1e-32	75.9
AZA24977.1\|698240_698879_+	methylase	A0A0D3MJX8	Leuconostoc_phage	1.9e-50	49.0
AZA24978.1\|698883_699216_+	hypothetical protein	U3PDN9	Lactobacillus_phage	1.1e-54	93.6
AZA24979.1\|699205_699469_+	hypothetical protein	U3PBE5	Lactobacillus_phage	1.1e-38	82.4
AZA24980.1\|699599_699839_+	hypothetical protein	NA	NA	NA	NA
AZA24981.1\|700132_700624_+	hypothetical protein	U3PIU0	Lactobacillus_phage	8.3e-75	84.2
AZA26197.1\|701191_701620_+\|terminase	terminase small subunit	Q37950	Lactococcus_phage	2.7e-69	95.1
AZA26196.1\|701609_702911_+\|terminase	PBSX family phage terminase large subunit	U3PBE8	Lactobacillus_phage	1.4e-254	95.8
AZA24982.1\|702921_704439_+\|capsid	capsid protein	Q38341	Lactococcus_phage	1.4e-282	95.4
AZA24983.1\|704441_705569_+\|capsid	minor capsid protein	U3PFU0	Lactobacillus_phage	1.4e-205	96.3
AZA24984.1\|705634_706171_+	hypothetical protein	U3PIU5	Lactobacillus_phage	1.4e-78	95.5
AZA24985.1\|706181_707045_+\|capsid	capsid protein	U3PDP8	Lactobacillus_phage	6.4e-155	97.6
AZA24986.1\|707044_707260_+	hypothetical protein	U3PBF1	Lactobacillus_phage	2.0e-25	78.9
AZA24987.1\|707234_707669_+	hypothetical protein	U3PCQ2	Lactobacillus_phage	2.5e-70	95.1
AZA24988.1\|707665_708022_+	hypothetical protein	U3PFU5	Lactobacillus_phage	1.2e-62	96.6
AZA24989.1\|708021_708363_+	hypothetical protein	U3PIU9	Lactobacillus_phage	8.4e-58	98.2
AZA26198.1\|708424_708766_+\|capsid	minor capsid protein	U3PDQ2	Lactobacillus_phage	1.6e-56	92.9
AZA24990.1\|708770_709262_+	hypothetical protein	U3PBF6	Lactobacillus_phage	1.2e-73	96.9
AZA24991.1\|709317_709761_+	hypothetical protein	U3PCQ6	Lactobacillus_phage	1.7e-66	92.5
AZA24992.1\|709735_710338_+	hypothetical protein	U3PFU8	Lactobacillus_phage	7.3e-105	91.0
AZA26199.1\|712633_713083_-	hypothetical protein	A4L7R4	Lactococcus_phage	6.6e-10	77.9
AZA26200.1\|713255_714338_+	hypothetical protein	U3PIV2	Lactobacillus_phage	1.8e-199	96.9
AZA24993.1\|714347_716237_+	hypothetical protein	Q38353	Lactococcus_phage	0.0e+00	94.6
AZA24994.1\|716236_718627_+	hypothetical protein	Q38354	Lactococcus_phage	0.0e+00	92.3
AZA26201.1\|720019_720319_+	hypothetical protein	U3PCL7	Lactobacillus_phage	1.5e-39	89.8
AZA24995.1\|720490_721666_+	hypothetical protein	F8J1C9	Lactobacillus_phage	6.7e-163	64.6
AZA24996.1\|721703_722009_+	hypothetical protein	F8J1D0	Lactobacillus_phage	2.3e-46	97.0
AZA26202.1\|722138_722867_+	hypothetical protein	U3PIR7	Lactobacillus_phage	1.9e-54	82.0
AZA24997.1\|722869_723187_+	hypothetical protein	Q38357	Lactococcus_phage	3.0e-33	80.6
AZA24998.1\|723173_723497_+\|holin	phage holin	U3PBD0	Lactobacillus_phage	1.8e-46	90.7
AZA24999.1\|723486_724380_+	lysin	Q38359	Lactococcus_phage	1.3e-137	88.3
AZA25000.1\|724430_724625_+	hypothetical protein	NA	NA	NA	NA
AZA25001.1\|724773_725103_+	hypothetical protein	Q37936	Lactococcus_phage	5.6e-51	93.6
AZA25002.1\|725877_726603_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.6e-34	33.6
AZA25003.1\|726599_728165_+	two-component sensor histidine kinase	Q6XLV6	Feldmannia_irregularis_virus	9.3e-11	25.1
AZA25004.1\|728212_730435_-	LTA synthase family protein	W6LM83	Streptococcus_phage	1.7e-146	43.2
729048:729065	attR	NA	NA	NA	NA
AZA25005.1\|730583_731210_+	VanZ family protein	NA	NA	NA	NA
AZA25006.1\|731286_732627_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
AZA25007.1\|734797_735802_+	penicillin-binding protein	X2KYU1	Mycobacterium_phage	9.9e-06	27.3
AZA25008.1\|735824_736076_+	hypothetical protein	NA	NA	NA	NA
AZA25009.1\|736137_737493_-	DUF1727 domain-containing protein	NA	NA	NA	NA
AZA25010.1\|737633_738236_+	thymidine kinase	C1KFH3	Lactobacillus_virus	2.2e-45	49.7
AZA25011.1\|738259_739345_+	peptide chain release factor 1	NA	NA	NA	NA
AZA25012.1\|739337_740180_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZA25013.1\|740179_741175_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	7.2e-49	38.0
AZA26203.1\|741370_742633_+\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25014.1\|742736_743366_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZA25015.1\|743475_744195_+	F0F1 ATP synthase subunit A	NA	NA	NA	NA
AZA25016.1\|744213_744438_+	F0F1 ATP synthase subunit C	NA	NA	NA	NA
AZA25017.1\|744491_744998_+	ATP synthase F0 subunit B	NA	NA	NA	NA
AZA25018.1\|744997_745540_+	F0F1 ATP synthase subunit delta	NA	NA	NA	NA
AZA25019.1\|745562_747074_+	F0F1 ATP synthase subunit alpha	NA	NA	NA	NA
AZA25020.1\|747084_748047_+	ATP synthase subunit gamma	NA	NA	NA	NA
AZA25021.1\|748066_749506_+	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
AZA25022.1\|749517_749958_+	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
AZA26204.1\|750006_750237_+	DUF1146 domain-containing protein	NA	NA	NA	NA
AZA25023.1\|750322_751312_+	rod shape-determining protein	NA	NA	NA	NA
AZA25024.1\|751314_751602_+	membrane protein insertion efficiency factor YidD	NA	NA	NA	NA
AZA25025.1\|751614_751842_+	DUF2969 domain-containing protein	NA	NA	NA	NA
AZA25026.1\|751866_753057_+	rod shape-determining protein RodA	NA	NA	NA	NA
AZA25027.1\|753128_753590_-	universal stress protein	NA	NA	NA	NA
AZA25028.1\|753647_753932_-	hypothetical protein	NA	NA	NA	NA
AZA25029.1\|754283_755588_-	recombinase RarA	A0A127AWE7	Bacillus_phage	5.8e-107	51.4
AZA25030.1\|755584_756049_-	DUF1694 domain-containing protein	NA	NA	NA	NA
AZA25031.1\|756173_756785_-	30S ribosomal protein S4	NA	NA	NA	NA
AZA25032.1\|757081_758800_+	septation ring formation regulator EzrA	NA	NA	NA	NA
AZA25033.1\|758885_760043_+	cysteine desulfurase	NA	NA	NA	NA
AZA25034.1\|760045_761263_+\|tRNA	tRNA 4-thiouridine(8) synthase ThiI	NA	NA	NA	NA

DBSCAN-SWA_9

783754 : 905846

Bacillus_phage(15.38%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA25055.1\|783754_786550_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.0e-80	26.3
AZA25056.1\|786549_786759_+	cold shock domain-containing protein	Q9AZD3	Lactococcus_phage	7.8e-06	37.5
AZA25057.1\|786774_787332_+	NUDIX hydrolase	NA	NA	NA	NA
AZA25058.1\|787335_787554_+	hypothetical protein	NA	NA	NA	NA
AZA25059.1\|787573_788272_+	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
AZA25060.1\|788271_789435_+	cysteine desulfurase	A0A1X6WFP1	Pacmanvirus	4.6e-31	29.0
AZA25061.1\|789489_789831_+	hypothetical protein	NA	NA	NA	NA
AZA25062.1\|789835_790963_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AZA25063.1\|791062_791722_+	histidine phosphatase family protein	NA	NA	NA	NA
AZA25064.1\|791721_792375_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AZA26207.1\|792388_794779_+	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	3.5e-57	29.6
AZA25065.1\|794947_796297_+	pyridine nucleotide-disulfide oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	7.0e-124	51.8
AZA25066.1\|796550_797774_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.8e-95	48.0
AZA25067.1\|798044_799724_-	ribonuclease J	NA	NA	NA	NA
AZA25068.1\|799713_799947_-	DUF1447 domain-containing protein	NA	NA	NA	NA
AZA25069.1\|800126_800681_-	peptide deformylase	NA	NA	NA	NA
AZA25070.1\|800902_802774_+	translational GTPase TypA	NA	NA	NA	NA
AZA25071.1\|802872_804075_+	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
AZA25072.1\|804064_804406_+	DUF2129 domain-containing protein	NA	NA	NA	NA
AZA25073.1\|804402_804954_+	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
AZA25074.1\|804954_805449_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	6.1e-25	40.5
AZA25075.1\|805438_806479_+	PDZ domain-containing protein	NA	NA	NA	NA
AZA25076.1\|806607_807366_+	competence protein	NA	NA	NA	NA
AZA26208.1\|807367_809578_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
AZA25077.1\|809608_810598_+	DNA polymerase III subunit delta	NA	NA	NA	NA
AZA25078.1\|810690_810942_-	30S ribosomal protein S20	NA	NA	NA	NA
AZA25079.1\|811145_811415_+	30S ribosomal protein S15	NA	NA	NA	NA
AZA25080.1\|811616_813458_+	RNase J family beta-CASP ribonuclease	NA	NA	NA	NA
AZA25081.1\|813444_814272_+	hypothetical protein	NA	NA	NA	NA
AZA25082.1\|814460_815651_+	elongation factor Tu	A0A1V0SGC3	Hokovirus	3.6e-31	28.9
AZA25083.1\|815833_817159_+	trigger factor	NA	NA	NA	NA
AZA25084.1\|817310_818564_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.1e-131	58.8
AZA25085.1\|818553_819156_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
AZA26209.1\|819204_820812_-	beta-carotene 15,15'-monooxygenase	NA	NA	NA	NA
AZA25086.1\|821058_822108_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	8.1e-43	32.8
AZA25087.1\|822465_823128_+	nitrobenzoate reductase	NA	NA	NA	NA
AZA25088.1\|823401_825051_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25089.1\|825109_825487_-	hypothetical protein	NA	NA	NA	NA
AZA25090.1\|825914_827465_-\|transposase	transposase	NA	NA	NA	NA
AZA25091.1\|828191_829559_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	3.2e-31	28.8
AZA25092.1\|829797_831021_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-95	48.0
AZA26210.1\|831354_832617_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25093.1\|832950_833250_+	hypothetical protein	NA	NA	NA	NA
AZA25094.1\|833144_834347_+\|transposase	transposase	NA	NA	NA	NA
AZA25095.1\|834630_835623_+	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	6.7e-39	34.7
AZA25096.1\|835796_836753_+	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.5e-112	59.6
AZA25097.1\|836766_837255_+	dihydrofolate reductase	G3MBI7	Bacillus_virus	1.2e-25	40.9
AZA25098.1\|837288_839697_+	ATPase P	A0A1J0FA34	Only_Syngen_Nebraska_virus	3.3e-39	25.0
AZA26211.1\|840095_840956_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25099.1\|840992_842048_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-27	35.0
AZA25100.1\|842044_842758_+	ABC transporter permease	NA	NA	NA	NA
AZA26212.1\|842947_844210_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25101.1\|844389_845787_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	6.7e-53	31.9
AZA26213.1\|845962_847225_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25102.1\|854513_855692_-\|transposase	IS256-like element ISLdl2 family transposase	NA	NA	NA	NA
AZA25103.1\|855903_857109_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZA25104.1\|857232_858147_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25105.1\|858380_860078_+\|tRNA	arginine--tRNA ligase	A0A2I2L3K1	Orpheovirus	2.0e-75	33.7
AZA26214.1\|860351_861614_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25106.1\|861700_863068_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
AZA25107.1\|863275_863749_+	arginine repressor	NA	NA	NA	NA
AZA25108.1\|863760_864960_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	1.1e-46	34.8
AZA26215.1\|865015_866278_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25109.1\|866550_867525_+	amidohydrolase	NA	NA	NA	NA
AZA25110.1\|867526_868477_+	dihydrofolate reductase	A0A1V0SBV6	Catovirus	8.4e-31	30.7
AZA25111.1\|868550_870320_+	DNA helicase RecQ	A0A1V0SBK0	Catovirus	4.3e-81	37.1
AZA25112.1\|870376_871315_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25113.1\|871587_873390_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
AZA25114.1\|873458_874781_+	GTPase ObgE	NA	NA	NA	NA
AZA25115.1\|874917_876096_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25116.1\|876208_878152_+	acetyltransferase	A0A1R3Y5Q6	Salmonella_virus	3.1e-24	28.6
AZA25117.1\|878188_879118_+	ribonuclease Z	NA	NA	NA	NA
AZA25118.1\|879128_879923_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZA25119.1\|880037_880229_+	50S ribosomal protein L32	NA	NA	NA	NA
AZA26216.1\|880411_881674_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25120.1\|881758_883324_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
AZA25121.1\|883409_885311_+	ATP-dependent helicase	D2J050	Enterococcus_phage	2.2e-107	46.8
AZA25122.1\|885307_885499_-	hypothetical protein	NA	NA	NA	NA
AZA25123.1\|885524_885776_-	hypothetical protein	NA	NA	NA	NA
AZA25124.1\|885923_886487_+	TIGR01440 family protein	NA	NA	NA	NA
AZA25125.1\|886582_886981_+	transcriptional regulator	NA	NA	NA	NA
AZA25126.1\|887056_887830_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	1.1e-76	56.4
AZA25127.1\|889113_890190_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	2.1e-126	66.1
AZA25128.1\|890307_890508_-	DUF2929 domain-containing protein	NA	NA	NA	NA
AZA25129.1\|890642_894122_+	DNA polymerase III subunit alpha	A0A0K1Y8F0	Streptomyces_phage	1.6e-103	29.9
AZA25130.1\|894330_895290_+	6-phosphofructokinase	NA	NA	NA	NA
AZA25131.1\|895329_897099_+	pyruvate kinase	A0A2H4PQU5	Staphylococcus_phage	2.1e-11	35.7
AZA25132.1\|897942_898365_-	acyltransferase	NA	NA	NA	NA
AZA25133.1\|898555_899434_+	RNA-binding protein	NA	NA	NA	NA
AZA25134.1\|899426_900323_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	1.5e-37	31.4
AZA25135.1\|900333_900687_+	reductase	NA	NA	NA	NA
AZA25136.1\|900676_901411_+	segregation and condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.7e-10	24.4
AZA25137.1\|901400_902003_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	6.3e-16	31.3
AZA25138.1\|902002_902722_+	rRNA pseudouridine synthase	NA	NA	NA	NA
AZA25139.1\|902943_903690_+	ECF transporter S component	NA	NA	NA	NA
AZA25140.1\|903734_903917_+	hypothetical protein	NA	NA	NA	NA
AZA25141.1\|903909_904257_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25142.1\|904312_904546_+	hypothetical protein	NA	NA	NA	NA
AZA25143.1\|904502_905846_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.2e-48	30.1

DBSCAN-SWA_10

911872 : 972063

unidentified_phage(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA25150.1\|911872_912922_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA25151.1\|913066_915928_+	hypothetical protein	NA	NA	NA	NA
AZA25152.1\|916005_916941_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25153.1\|917204_918383_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25154.1\|918682_919588_+	transcriptional regulator	NA	NA	NA	NA
AZA26217.1\|919619_919904_-	hypothetical protein	NA	NA	NA	NA
AZA25155.1\|919942_922369_+	hypothetical protein	NA	NA	NA	NA
AZA25156.1\|922404_922824_+	hypothetical protein	NA	NA	NA	NA
AZA25157.1\|923068_923974_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25158.1\|923992_924898_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA26218.1\|925292_926555_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25159.1\|926636_927815_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25160.1\|928301_929528_+	argininosuccinate synthase	NA	NA	NA	NA
AZA25161.1\|929563_930946_+	argininosuccinate lyase	NA	NA	NA	NA
AZA25162.1\|931198_931402_+	hypothetical protein	NA	NA	NA	NA
AZA25163.1\|931741_931966_-	hypothetical protein	NA	NA	NA	NA
AZA25164.1\|932419_932851_+	hypothetical protein	A0A2P0ZL82	Lactobacillus_phage	4.4e-11	33.6
AZA25165.1\|932784_934230_+	hypothetical protein	NA	NA	NA	NA
AZA25166.1\|934430_935039_+	GTP pyrophosphokinase	NA	NA	NA	NA
AZA25167.1\|935041_935710_+	DNA-binding response regulator	A0A1J0GWE0	Alteromonas_phage	7.8e-07	28.3
AZA25168.1\|935712_936972_+	sensor histidine kinase	NA	NA	NA	NA
AZA25169.1\|938825_939008_+	hypothetical protein	NA	NA	NA	NA
AZA25170.1\|939000_939348_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25171.1\|939403_939637_+	hypothetical protein	NA	NA	NA	NA
AZA25172.1\|941893_942628_+	type I-C CRISPR-associated protein Cas5	NA	NA	NA	NA
AZA25173.1\|942624_944499_+	type I-C CRISPR-associated protein Cas8c/Csd1	NA	NA	NA	NA
AZA26219.1\|944518_945373_+	type I-C CRISPR-associated protein Cas7/Csd2	NA	NA	NA	NA
AZA25174.1\|945377_945821_+	CRISPR-associated protein Cas4	NA	NA	NA	NA
AZA25175.1\|945960_946215_+	hypothetical protein	NA	NA	NA	NA
AZA25176.1\|946799_947849_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA26220.1\|948508_948799_+	CRISPR-associated endonuclease Cas2	NA	NA	NA	NA
AZA26221.1\|949094_950357_+\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25177.1\|951403_952504_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZA25178.1\|952506_953733_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
AZA25179.1\|953736_954900_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
AZA25180.1\|955063_956422_+	hypothetical protein	NA	NA	NA	NA
AZA25181.1\|956478_956985_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AZA25182.1\|957047_957992_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
AZA25183.1\|958132_960394_+	GTP pyrophosphokinase	A0A1X9SH80	Bradyrhizobium_phage	5.7e-09	34.9
AZA25184.1\|960422_960860_+\|tRNA	D-tyrosyl-tRNA(Tyr) deacylase	NA	NA	NA	NA
AZA25185.1\|961144_962431_+\|tRNA	histidine--tRNA ligase	A0A1V0SLE3	Klosneuvirus	1.1e-28	26.8
AZA25186.1\|962446_964291_+\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
AZA25187.1\|964363_964879_-	hypothetical protein	NA	NA	NA	NA
AZA25188.1\|965112_966888_+	DUF2207 domain-containing protein	NA	NA	NA	NA
AZA25189.1\|966963_968037_+	AI-2E family transporter	NA	NA	NA	NA
AZA26222.1\|969056_970319_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25190.1\|970860_972063_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_11

992138 : 1045058

unidentified_phage(15.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26225.1\|992138_993401_-\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25205.1\|993593_995186_-	asparagine synthase B	L7RC73	Acanthamoeba_polyphaga_moumouvirus	1.4e-99	39.4
AZA25206.1\|997140_998424_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.2e-58	33.3
AZA25207.1\|998903_1000523_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25208.1\|1000613_1000856_+	hypothetical protein	NA	NA	NA	NA
AZA25209.1\|1001872_1003240_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
AZA26226.1\|1003276_1003915_-	hypothetical protein	NA	NA	NA	NA
AZA25210.1\|1004043_1004247_+	hypothetical protein	NA	NA	NA	NA
AZA25211.1\|1004389_1005439_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25212.1\|1005681_1006566_+	phosphate ABC transporter substrate-binding protein	Q58MA7	Prochlorococcus_phage	1.8e-06	24.5
AZA25213.1\|1006585_1007494_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZA25214.1\|1007496_1008372_+	phosphate ABC transporter permease PtsA	NA	NA	NA	NA
AZA26227.1\|1008374_1009130_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-18	33.5
AZA25215.1\|1009148_1009787_+	phosphate transport system regulatory protein PhoU	NA	NA	NA	NA
AZA25216.1\|1009872_1010550_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	3.2e-32	38.2
AZA25217.1\|1010549_1012208_+	ATPase	W8CYF6	Bacillus_phage	8.6e-31	34.6
AZA25218.1\|1012956_1013613_-	NUDIX hydrolase	NA	NA	NA	NA
AZA25219.1\|1013922_1015345_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.8e-32	41.5
AZA25220.1\|1015467_1016517_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.2e-41	32.8
AZA25221.1\|1016678_1017230_-	NUDIX domain-containing protein	NA	NA	NA	NA
AZA26228.1\|1018987_1020250_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	8.5e-55	45.2
AZA25222.1\|1020275_1021019_-	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.4e-09	28.9
AZA25223.1\|1021008_1021827_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-12	31.3
AZA25224.1\|1021805_1022582_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AZA25225.1\|1022578_1023193_-	ECF transporter S component	NA	NA	NA	NA
AZA25226.1\|1023582_1024692_+	GGDEF domain-containing protein	NA	NA	NA	NA
AZA25227.1\|1024979_1026008_+	GGDEF domain-containing protein	NA	NA	NA	NA
AZA25228.1\|1026014_1026596_+	hypothetical protein	NA	NA	NA	NA
AZA25229.1\|1026851_1027901_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
AZA26229.1\|1027948_1028770_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AZA25230.1\|1029601_1030708_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.0e-88	46.0
AZA25231.1\|1031785_1032136_+	dihydroneopterin aldolase	NA	NA	NA	NA
AZA25232.1\|1032132_1033206_+	GTP cyclohydrolase I FolE	A0A2I7S8W4	Vibrio_phage	3.2e-34	40.7
AZA25233.1\|1033189_1034527_+	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
AZA25234.1\|1034516_1035608_+	dihydropteroate synthase	NA	NA	NA	NA
AZA25235.1\|1035619_1036156_+	NUDIX domain-containing protein	NA	NA	NA	NA
AZA25236.1\|1036577_1036859_-	hypothetical protein	NA	NA	NA	NA
AZA25237.1\|1037336_1037744_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZA25238.1\|1038118_1038778_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZA25239.1\|1038758_1039433_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZA26230.1\|1039442_1040183_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.8e-31	34.4
AZA25240.1\|1040194_1041055_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25241.1\|1041315_1042683_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	1.2e-30	28.8
AZA25242.1\|1042708_1042906_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZA25243.1\|1042946_1043129_+	hypothetical protein	NA	NA	NA	NA
AZA25244.1\|1043121_1043469_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25245.1\|1043524_1043758_+	hypothetical protein	NA	NA	NA	NA
AZA25246.1\|1043714_1045058_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	6.3e-48	30.1

DBSCAN-SWA_12

1053429 : 1126645

Bacillus_phage(31.25%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26231.1\|1053429_1054692_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25254.1\|1054899_1055925_-	type 2 isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
AZA25255.1\|1055935_1057018_-	phosphomevalonate kinase	NA	NA	NA	NA
AZA25256.1\|1057095_1058055_-	diphosphomevalonate decarboxylase	NA	NA	NA	NA
AZA25257.1\|1058110_1059022_-	mevalonate kinase	NA	NA	NA	NA
AZA25258.1\|1059155_1062695_+	ATP-dependent helicase	NA	NA	NA	NA
AZA25259.1\|1062721_1066405_+	helicase-exonuclease AddAB subunit AddA	A7KV33	Bacillus_phage	2.4e-25	26.2
AZA25260.1\|1066433_1069226_+	ATP-dependent DNA helicase	A0A1X9I5C8	Streptococcus_phage	7.1e-62	33.3
AZA25261.1\|1069285_1070548_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25262.1\|1070746_1070929_+	hypothetical protein	NA	NA	NA	NA
AZA25263.1\|1070921_1071269_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25264.1\|1071324_1071558_+	hypothetical protein	NA	NA	NA	NA
AZA25265.1\|1071514_1072858_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.2e-48	30.1
AZA25266.1\|1072991_1073459_+	hypothetical protein	NA	NA	NA	NA
AZA25267.1\|1073520_1074819_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	2.1e-53	28.6
AZA25268.1\|1074909_1075557_+	DnaD domain protein	NA	NA	NA	NA
AZA25269.1\|1075578_1076208_+	endonuclease III	NA	NA	NA	NA
AZA26232.1\|1076242_1077046_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
AZA26233.1\|1077224_1078487_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25270.1\|1078542_1079028_-	alpha/beta hydrolase	NA	NA	NA	NA
AZA26234.1\|1079021_1079444_-	hypothetical protein	NA	NA	NA	NA
AZA25271.1\|1079580_1080615_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.8e-42	32.9
AZA25272.1\|1080846_1081848_-	D-2-hydroxyacid dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	2.3e-39	33.8
AZA25273.1\|1081896_1083825_-	S9 family peptidase	NA	NA	NA	NA
AZA25274.1\|1083971_1086284_-	penicillin-binding protein	NA	NA	NA	NA
AZA25275.1\|1086270_1086903_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	9.5e-23	36.9
AZA25276.1\|1087700_1088165_+	cell division regulator GpsB	NA	NA	NA	NA
AZA25277.1\|1089817_1091050_+	serine/threonine protein phosphatase	NA	NA	NA	NA
AZA25278.1\|1091204_1091561_+	hypothetical protein	NA	NA	NA	NA
AZA25279.1\|1091553_1093233_+	formate--tetrahydrofolate ligase	NA	NA	NA	NA
AZA25280.1\|1093244_1093697_+	signal peptidase II	NA	NA	NA	NA
AZA25281.1\|1093698_1094613_+	RluA family pseudouridine synthase	NA	NA	NA	NA
AZA25282.1\|1094614_1095670_+	carbamoyl phosphate synthase small subunit	NA	NA	NA	NA
AZA25283.1\|1095669_1098861_+	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
AZA25284.1\|1098955_1099237_+	ACT domain-containing protein	NA	NA	NA	NA
AZA25285.1\|1099236_1100580_+	PFL family protein	NA	NA	NA	NA
AZA25286.1\|1100646_1102338_-	DUF814 domain-containing protein	Q84500	Paramecium_bursaria_Chlorella_virus	2.5e-09	40.2
AZA25287.1\|1102654_1103536_+	DegV family protein	NA	NA	NA	NA
AZA25288.1\|1103591_1104662_+	hypothetical protein	NA	NA	NA	NA
AZA25289.1\|1104810_1105860_+\|transposase	IS30 family transposase	NA	NA	NA	NA
AZA25290.1\|1105972_1106884_-	EamA family transporter	NA	NA	NA	NA
AZA25291.1\|1108278_1109361_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	4.2e-79	44.9
AZA25292.1\|1109704_1110328_+	fructose-2,6-bisphosphatase	NA	NA	NA	NA
AZA25293.1\|1110910_1111429_-	nitroreductase	NA	NA	NA	NA
AZA25294.1\|1112661_1113840_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25295.1\|1114293_1114611_+	DNA invertase Pin	NA	NA	NA	NA
AZA25296.1\|1114736_1115528_+	peptide transporter	E2ELL2	Clostridium_phage	1.0e-13	25.7
AZA25297.1\|1115599_1115839_+	hypothetical protein	NA	NA	NA	NA
AZA25298.1\|1115994_1117071_-	tyrosine recombinase XerS	A0A0E3XA96	Gordonia_phage	1.6e-06	29.6
AZA25299.1\|1117304_1118453_+	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-41	35.9
AZA25300.1\|1118594_1119764_+	DUF2325 domain-containing protein	NA	NA	NA	NA
AZA25301.1\|1119787_1120366_+	sel1 repeat family protein	NA	NA	NA	NA
AZA25302.1\|1121569_1122880_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25303.1\|1122857_1123511_-	DNA-binding response regulator	NA	NA	NA	NA
AZA26235.1\|1123930_1124638_+\|transposase	transposase	NA	NA	NA	NA
AZA25304.1\|1125000_1125321_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
AZA26236.1\|1125382_1126645_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6

DBSCAN-SWA_13

1155498 : 1279093

100

Bacillus_phage(20.0%)

protease,integrase,transposase,tRNA

attL 1146664:1146723|attR 1243400:1244863

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1146664:1146723	attL	NA	NA	NA	NA
AZA25331.1\|1155498_1156140_-\|integrase	integrase	A3F636	Streptococcus_phage	2.3e-24	34.9
1146664:1146723	attL	NA	NA	NA	NA
AZA26237.1\|1156470_1157733_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	1.0e-55	45.8
AZA25332.1\|1157911_1158421_-	acetyltransferase	NA	NA	NA	NA
AZA25333.1\|1158433_1159135_-	prismane protein	NA	NA	NA	NA
AZA25334.1\|1159159_1159336_+	transcriptional regulator	NA	NA	NA	NA
AZA25335.1\|1159430_1160069_+	NAD-dependent dehydratase	NA	NA	NA	NA
AZA25336.1\|1160120_1160597_-	hypothetical protein	NA	NA	NA	NA
AZA25337.1\|1160509_1160800_-	hypothetical protein	NA	NA	NA	NA
AZA25338.1\|1161616_1162126_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZA25339.1\|1162149_1162830_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZA25340.1\|1164718_1165024_-	CRISPR-associated endonuclease Cas2	NA	NA	NA	NA
AZA25341.1\|1165023_1165938_-	type II CRISPR-associated endonuclease Cas1	NA	NA	NA	NA
AZA25342.1\|1165941_1166985_-	type III-A CRISPR-associated RAMP protein Csm5	NA	NA	NA	NA
AZA26238.1\|1166987_1167866_-	type III-A CRISPR-associated RAMP protein Csm4	NA	NA	NA	NA
AZA25343.1\|1167888_1168557_-	type III-A CRISPR-associated RAMP protein Csm3	NA	NA	NA	NA
AZA25344.1\|1168560_1169052_-	type III-A CRISPR-associated protein Csm2	NA	NA	NA	NA
AZA25345.1\|1169054_1171391_-	type III-A CRISPR-associated protein Cas10/Csm1	NA	NA	NA	NA
AZA25346.1\|1171383_1172136_-	CRISPR-associated endoribonuclease Cas6	NA	NA	NA	NA
AZA25347.1\|1174419_1175886_-	hypothetical protein	NA	NA	NA	NA
1172932:1173105	attR	NA	NA	NA	NA
AZA26239.1\|1177666_1177702_-	hypothetical protein	NA	NA	NA	NA
1172932:1173105	attR	NA	NA	NA	NA
AZA25348.1\|1178485_1178761_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZA25349.1\|1178753_1179473_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZA25350.1\|1179554_1179761_-	hypothetical protein	NA	NA	NA	NA
AZA25351.1\|1179880_1180108_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25352.1\|1180103_1180772_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25353.1\|1181278_1182457_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25354.1\|1186842_1187361_-	hypothetical protein	NA	NA	NA	NA
AZA26240.1\|1187631_1187823_-	hypothetical protein	NA	NA	NA	NA
AZA25355.1\|1187872_1188721_-	LD-carboxypeptidase	NA	NA	NA	NA
AZA25356.1\|1188765_1190190_-	RNA methyltransferase	NA	NA	NA	NA
AZA25357.1\|1190182_1191157_-	hypothetical protein	NA	NA	NA	NA
AZA25358.1\|1191156_1191897_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZA25359.1\|1192006_1192204_-	hypothetical protein	NA	NA	NA	NA
AZA25360.1\|1192351_1192963_-	pyroglutamyl-peptidase I	NA	NA	NA	NA
AZA25361.1\|1193041_1193794_+\|protease	PrsW family intramembrane metalloprotease	NA	NA	NA	NA
AZA25362.1\|1194306_1195485_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25363.1\|1196310_1197741_-	NADP-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZA25364.1\|1197841_1199362_-	glycine/betaine ABC transporter permease	NA	NA	NA	NA
AZA25365.1\|1199365_1200289_-	glycine/betaine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-27	39.2
AZA26241.1\|1200902_1201322_+	3-beta hydroxysteroid dehydrogenase	NA	NA	NA	NA
AZA26242.1\|1201393_1202656_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26243.1\|1202845_1203976_-	hypothetical protein	NA	NA	NA	NA
AZA25366.1\|1204043_1204277_-	hypothetical protein	NA	NA	NA	NA
AZA25367.1\|1204631_1205885_+\|transposase	transposase	NA	NA	NA	NA
AZA25368.1\|1206007_1207231_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.9e-97	49.0
AZA25369.1\|1207899_1208949_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25370.1\|1209096_1214871_-	peptidase S8	A0A217EQY2	Bacillus_phage	2.9e-09	31.2
AZA25371.1\|1215322_1215826_-	N-acetyltransferase	NA	NA	NA	NA
AZA25372.1\|1215906_1216407_-	hypothetical protein	NA	NA	NA	NA
AZA25373.1\|1216840_1217455_+	DedA family protein	NA	NA	NA	NA
AZA25374.1\|1217822_1218839_+	aspartate--ammonia ligase	NA	NA	NA	NA
AZA25375.1\|1218914_1220213_+\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	6.3e-53	28.4
AZA25376.1\|1220278_1221286_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.6e-14	25.9
AZA25377.1\|1221328_1224352_-	DUF4981 domain-containing protein	L0N6M2	Herpes_simplex_virus	6.2e-136	32.5
AZA25378.1\|1224355_1226239_-	lactose permease	NA	NA	NA	NA
AZA25379.1\|1226596_1227646_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.9e-45	32.2
AZA25380.1\|1227849_1228686_+\|integrase	integrase	NA	NA	NA	NA
AZA25381.1\|1228729_1229296_+	signal peptidase I	NA	NA	NA	NA
AZA25382.1\|1229365_1229557_+	hypothetical protein	NA	NA	NA	NA
AZA25383.1\|1230121_1231360_-	peptidase T	NA	NA	NA	NA
AZA25384.1\|1231403_1232201_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZA25385.1\|1232193_1232886_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZA25386.1\|1233157_1234456_-\|transposase	transposase	C1KFS0	Lactobacillus_virus	2.8e-69	39.0
AZA25387.1\|1235174_1238060_-	hypothetical protein	NA	NA	NA	NA
AZA26244.1\|1238275_1239538_+\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25388.1\|1239540_1241766_-	hypothetical protein	NA	NA	NA	NA
AZA26245.1\|1242221_1243358_-\|transposase	transposase	G3MB42	Bacillus_virus	2.8e-49	35.1
AZA26246.1\|1243435_1244698_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25389.1\|1245968_1247379_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-42	40.7
AZA25390.1\|1247590_1247836_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25391.1\|1247842_1247977_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25392.1\|1248078_1249215_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.6e-36	33.8
AZA25393.1\|1249250_1250372_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	5.8e-39	37.4
AZA25394.1\|1250413_1251532_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.1e-37	35.7
AZA25395.1\|1251503_1253342_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	5.0e-56	35.2
AZA25396.1\|1253373_1255440_-\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZA25397.1\|1255432_1256344_-\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZA25398.1\|1256609_1257359_-	DNA repair protein RecO	NA	NA	NA	NA
AZA25399.1\|1257358_1258264_-	GTPase Era	NA	NA	NA	NA
AZA25400.1\|1258247_1258667_-	cytidine deaminase	NA	NA	NA	NA
AZA25401.1\|1258668_1259193_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
AZA25402.1\|1259192_1260140_-	phosphate starvation-inducible protein PhoH	H6X2N1	Pseudomonas_phage	5.2e-49	48.4
AZA25403.1\|1260294_1260471_-	30S ribosomal protein S21	NA	NA	NA	NA
AZA25404.1\|1260639_1261497_+	kinase/pyrophosphorylase	NA	NA	NA	NA
AZA25405.1\|1261754_1262804_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25406.1\|1262989_1263259_-	hypothetical protein	NA	NA	NA	NA
AZA25407.1\|1263324_1264209_-	YitT family protein	NA	NA	NA	NA
AZA25408.1\|1265240_1266419_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25409.1\|1266655_1267879_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	9.6e-96	48.0
AZA25410.1\|1268659_1269844_-	amino acid aminotransferase	NA	NA	NA	NA
AZA25411.1\|1270024_1271335_-	diaminopimelate decarboxylase	NA	NA	NA	NA
AZA25412.1\|1271693_1272401_-	hypothetical protein	NA	NA	NA	NA
AZA25413.1\|1272684_1272969_-	hypothetical protein	NA	NA	NA	NA
AZA25414.1\|1272992_1273301_-	hypothetical protein	NA	NA	NA	NA
AZA25415.1\|1273300_1273486_-	hypothetical protein	NA	NA	NA	NA
AZA25416.1\|1273865_1274762_-	aldose 1-epimerase family protein	NA	NA	NA	NA
AZA25417.1\|1274847_1276242_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A1B2IEP8	Erwinia_phage	4.0e-37	27.8
AZA25418.1\|1276244_1276778_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AZA25419.1\|1276886_1277774_-	tyrosine recombinase XerC	A0A1P8DJJ6	Virus_Rctr41k	2.5e-21	31.5
AZA25420.1\|1277773_1279093_-\|tRNA	methylenetetrahydrofolate--tRNA-(uracil(54)- C(5))-methyltransferase (FADH(2)-oxidizing) TrmFO	NA	NA	NA	NA

DBSCAN-SWA_14

1285357 : 1418799

114

Lactobacillus_phage(57.35%)

protease,tail,integrase,transposase,capsid,terminase,tRNA,holin,head

attL 1353272:1353331|attR 1377141:1377220

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA25427.1\|1285357_1286560_-\|transposase	transposase	NA	NA	NA	NA
AZA25428.1\|1286454_1286754_-	hypothetical protein	NA	NA	NA	NA
AZA25429.1\|1286967_1287630_+	hemolysin III	NA	NA	NA	NA
AZA26247.1\|1287668_1288931_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25430.1\|1289117_1290308_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	8.9e-46	33.6
AZA25431.1\|1290381_1291281_+	YitT family protein	M1Q1P6	Streptococcus_phage	1.3e-52	40.5
AZA25432.1\|1291315_1291561_-	hypothetical protein	NA	NA	NA	NA
AZA26248.1\|1291634_1291931_-	hypothetical protein	NA	NA	NA	NA
AZA25433.1\|1292029_1292221_-	hypothetical protein	NA	NA	NA	NA
AZA25434.1\|1292698_1294471_-	sugar ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.0e-49	27.4
AZA25435.1\|1294467_1296210_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.7e-37	26.2
AZA25436.1\|1296605_1297508_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25437.1\|1298248_1298788_-	hypothetical protein	F8J1D7	Lactobacillus_phage	2.9e-60	98.4
AZA25438.1\|1301499_1301850_-	hypothetical protein	F8J1D4	Lactobacillus_phage	6.6e-58	99.1
AZA25439.1\|1301851_1303033_-	lysin	A9UJV4	Lactobacillus_phage	1.6e-217	96.5
AZA25440.1\|1303013_1303367_-\|holin	holin	F8J1D3	Lactobacillus_phage	2.6e-54	100.0
AZA25441.1\|1303370_1303694_-	hypothetical protein	F8J1D2	Lactobacillus_phage	5.0e-52	100.0
AZA25442.1\|1303714_1304137_-	hypothetical protein	A9UJV1	Lactobacillus_phage	5.3e-78	100.0
AZA25443.1\|1304096_1304294_-	XkdX family protein	F8J1D1	Lactobacillus_phage	2.0e-27	98.5
AZA25444.1\|1304290_1304599_-	hypothetical protein	F8J1D0	Lactobacillus_phage	7.8e-47	96.1
AZA25445.1\|1304636_1304918_-	hypothetical protein	F8J1C9	Lactobacillus_phage	3.2e-39	81.7
AZA25446.1\|1306217_1306436_-	hypothetical protein	F8J1C7	Lactobacillus_phage	3.0e-32	100.0
AZA25447.1\|1306515_1307949_-	hypothetical protein	Q9AZD2	Lactobacillus_phage	1.6e-219	79.5
AZA25448.1\|1307951_1310390_-	hypothetical protein	F8J1C5	Lactobacillus_phage	0.0e+00	94.6
AZA25449.1\|1310404_1312585_-	hypothetical protein	F8J1C4	Lactobacillus_phage	0.0e+00	90.3
AZA25450.1\|1312652_1318259_-\|tail	phage tail tape measure protein	F8J1C3	Lactobacillus_phage	0.0e+00	94.5
AZA25451.1\|1318454_1318886_-	hypothetical protein	F8J1C1	Lactobacillus_phage	1.4e-70	97.2
AZA25452.1\|1319007_1319628_-\|tail	phage tail protein	F8J1C0	Lactobacillus_phage	1.7e-109	95.6
AZA25453.1\|1319628_1320033_-	hypothetical protein	F8J1B9	Lactobacillus_phage	6.4e-65	92.2
AZA25454.1\|1320613_1320967_-\|head,tail	head-tail adaptor protein	F8J1B7	Lactobacillus_phage	1.6e-64	100.0
AZA25455.1\|1320956_1321316_-	DNA-packaging protein	F8J1B6	Lactobacillus_phage	1.3e-61	100.0
AZA25456.1\|1321541_1322714_-\|capsid	phage major capsid protein	F8J1B4	Lactobacillus_phage	6.4e-214	99.7
AZA25457.1\|1322726_1323458_-\|protease	Clp protease ClpP	F8J1B3	Lactobacillus_phage	1.5e-125	96.3
AZA25458.1\|1324750_1326091_-\|terminase	terminase large subunit	F8J1B1	Lactobacillus_phage	2.6e-256	99.3
AZA26249.1\|1326296_1326731_-\|terminase	terminase	F8J1B1	Lactobacillus_phage	1.1e-75	94.3
AZA25459.1\|1326779_1327178_-	HNH endonuclease	F8J1B0	Lactobacillus_phage	3.5e-71	97.7
AZA25460.1\|1327155_1327662_-\|terminase	phage terminase small subunit P27 family	F8J1A9	Lactobacillus_phage	2.7e-84	98.8
AZA25461.1\|1327731_1327920_-	hypothetical protein	NA	NA	NA	NA
AZA25462.1\|1330206_1330653_-	transcriptional regulator	F8J1G8	Lactobacillus_phage	2.7e-80	98.6
AZA25463.1\|1330684_1330900_-	hypothetical protein	F8J1G7	Lactobacillus_phage	1.3e-35	100.0
AZA25464.1\|1330889_1331429_-	hypothetical protein	F8J1G6	Lactobacillus_phage	1.8e-102	98.9
AZA25465.1\|1331412_1331685_-	DUF1599 domain-containing protein	F8J1G5	Lactobacillus_phage	1.7e-45	100.0
AZA25466.1\|1331699_1331927_-	hypothetical protein	F8J1G4	Lactobacillus_phage	1.2e-39	100.0
AZA25467.1\|1332516_1332957_-	hypothetical protein	F8J1G1	Lactobacillus_phage	6.8e-76	95.2
AZA25468.1\|1333087_1333438_-	hypothetical protein	F8J1F9	Lactobacillus_phage	2.1e-56	100.0
AZA25469.1\|1333400_1333607_-	hypothetical protein	F8J1F8	Lactobacillus_phage	4.9e-29	100.0
AZA25470.1\|1334024_1334285_-	hypothetical protein	NA	NA	NA	NA
AZA25471.1\|1334301_1334520_-	hypothetical protein	NA	NA	NA	NA
AZA25472.1\|1334588_1334885_-	hypothetical protein	NA	NA	NA	NA
AZA25473.1\|1334881_1335670_-	phage antirepressor Ant	A0A075KJT3	Lactobacillus_phage	1.7e-90	65.7
AZA25474.1\|1335805_1336105_-	hypothetical protein	F8J1F5	Lactobacillus_phage	3.3e-50	100.0
AZA26250.1\|1336236_1336482_-	hypothetical protein	F8J1F3	Lactobacillus_phage	1.6e-42	100.0
AZA25475.1\|1336578_1336869_-	hypothetical protein	F8J1F2	Lactobacillus_phage	1.6e-49	99.0
AZA25476.1\|1337054_1339409_-	DNA primase	F8J1F0	Lactobacillus_phage	0.0e+00	99.9
AZA25477.1\|1339428_1339977_-	hypothetical protein	F8J1E9	Lactobacillus_phage	2.2e-84	99.3
AZA26251.1\|1341133_1341307_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZA25478.1\|1341510_1342140_+	XRE family transcriptional regulator	Q9G0C2	Lactococcus_phage	1.7e-35	44.1
AZA26252.1\|1342576_1343839_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25479.1\|1345926_1346514_+	phosphatase PAP2 family protein	NA	NA	NA	NA
AZA25480.1\|1346609_1347446_-	fatty acid-binding protein DegV	A0A1X9I5J4	Streptococcus_phage	2.5e-47	40.1
AZA25481.1\|1347753_1349031_+	enolase	W6LP63	Streptococcus_phage	9.3e-110	51.4
AZA25482.1\|1349286_1349895_-	DUF4230 domain-containing protein	NA	NA	NA	NA
AZA25483.1\|1352032_1353211_+\|transposase	IS256 family transposase	NA	NA	NA	NA
1353272:1353331	attL	NA	NA	NA	NA
AZA25484.1\|1354000_1355503_+	ABC transporter permease	NA	NA	NA	NA
AZA25485.1\|1355551_1356406_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZA25486.1\|1356583_1358842_+	proton-efflux P-type ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	1.3e-42	27.8
AZA25487.1\|1359119_1360253_-	AI-2E family transporter	NA	NA	NA	NA
AZA25488.1\|1360369_1361395_-	branched-chain amino acid aminotransferase	NA	NA	NA	NA
AZA25489.1\|1361596_1362484_-	cation transporter	NA	NA	NA	NA
AZA25490.1\|1362595_1362898_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AZA25491.1\|1362977_1363505_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	6.5e-25	41.8
AZA25492.1\|1363494_1365771_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.8e-72	32.6
AZA25493.1\|1365767_1366469_-	class A sortase	NA	NA	NA	NA
AZA25494.1\|1366449_1368288_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.5e-20	25.5
AZA25495.1\|1368409_1369549_-	molecular chaperone DnaJ	A0A0P0YNN4	Yellowstone_lake_phycodnavirus	3.1e-16	25.9
AZA25496.1\|1369631_1371476_-	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	6.0e-142	49.3
AZA25497.1\|1371535_1372135_-	nucleotide exchange factor GrpE	NA	NA	NA	NA
AZA25498.1\|1372146_1373190_-	heat-inducible transcriptional repressor HrcA	NA	NA	NA	NA
AZA25499.1\|1373325_1374267_-	riboflavin biosynthesis protein RibF	A0A1V0SJE1	Klosneuvirus	1.8e-09	35.1
AZA26253.1\|1374380_1374974_-\|integrase	site-specific integrase	Q9AZI0	Lactococcus_phage	2.9e-29	37.9
AZA25500.1\|1376481_1376898_-	hypothetical protein	A0A1B0T6A8	Bacillus_phage	4.1e-06	29.7
AZA26254.1\|1377154_1378417_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	2.5e-54	45.2
1377141:1377220	attR	NA	NA	NA	NA
AZA25501.1\|1379718_1380768_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25502.1\|1383569_1384937_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
AZA25503.1\|1385175_1386399_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.6e-95	48.0
AZA26255.1\|1386811_1388074_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	2.5e-54	45.2
AZA25504.1\|1388843_1389755_+	cysteine synthase family protein	A0A1W6JIM2	Lactococcus_phage	2.8e-60	41.8
AZA25505.1\|1389776_1390961_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
AZA25506.1\|1390926_1391499_+	serine acetyltransferase	NA	NA	NA	NA
AZA25507.1\|1391534_1392584_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA26256.1\|1393044_1393398_+	diacetyl reductase ((R)-acetoin forming) domain protein	NA	NA	NA	NA
AZA25508.1\|1393772_1394030_-	hypothetical protein	NA	NA	NA	NA
AZA25509.1\|1394272_1395169_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
AZA25510.1\|1395219_1395582_-	ribosome-binding factor A	NA	NA	NA	NA
AZA25511.1\|1395594_1398072_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.3e-19	23.9
AZA25512.1\|1398076_1398361_-	50S ribosomal protein L7	NA	NA	NA	NA
AZA26257.1\|1398387_1398666_-	DUF448 domain-containing protein	NA	NA	NA	NA
AZA25513.1\|1398696_1399848_-	transcription termination/antitermination protein NusA	NA	NA	NA	NA
AZA25514.1\|1399867_1400344_-	ribosome maturation factor RimP	NA	NA	NA	NA
AZA25515.1\|1400452_1404790_-	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	9.8e-18	31.6
AZA25516.1\|1404802_1406500_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
AZA25517.1\|1406539_1407787_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AZA25518.1\|1407796_1408594_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AZA25519.1\|1408599_1409331_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	2.4e-17	38.2
AZA25520.1\|1409333_1409891_-	ribosome recycling factor	NA	NA	NA	NA
AZA25521.1\|1409890_1410616_-	UMP kinase	NA	NA	NA	NA
AZA25522.1\|1410765_1411794_-	elongation factor Ts	NA	NA	NA	NA
AZA25523.1\|1411856_1412618_-	30S ribosomal protein S2	NA	NA	NA	NA
AZA25524.1\|1412781_1413792_-	methyltransferase	NA	NA	NA	NA
AZA25525.1\|1413862_1414477_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZA25526.1\|1414567_1415938_-\|transposase	transposase	NA	NA	NA	NA
AZA25527.1\|1416152_1417355_-\|transposase	transposase	NA	NA	NA	NA
AZA25528.1\|1417249_1417549_-	hypothetical protein	NA	NA	NA	NA
AZA25529.1\|1417749_1418799_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8

DBSCAN-SWA_15

1465725 : 1670655

162

Bacillus_phage(17.31%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA25567.1\|1465725_1466928_+\|transposase	transposase	NA	NA	NA	NA
AZA25568.1\|1467073_1467259_+	50S ribosomal protein L28	NA	NA	NA	NA
AZA25569.1\|1469729_1469972_-	hypothetical protein	NA	NA	NA	NA
AZA25570.1\|1470505_1471789_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	7.5e-59	33.3
AZA25571.1\|1472039_1472723_-	thiamine diphosphokinase	NA	NA	NA	NA
AZA25572.1\|1472752_1473646_-	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
AZA25573.1\|1473646_1475671_-	Stk1 family PASTA domain-containing Ser/Thr kinase	A0A1V0SD90	Indivirus	4.9e-20	26.3
AZA25574.1\|1475642_1476398_-	Stp1/IreP family PP2C-type Ser/Thr phosphatase	NA	NA	NA	NA
AZA25575.1\|1476403_1477720_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
AZA25576.1\|1477709_1478657_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	4.8e-10	32.1
AZA25577.1\|1478669_1481051_-	primosomal protein N'	NA	NA	NA	NA
AZA25578.1\|1481113_1481335_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
AZA25579.1\|1481336_1481951_-	guanylate kinase	A0A0M5KCK5	Mollivirus	3.9e-13	31.7
AZA25580.1\|1482124_1482430_+	hypothetical protein	NA	NA	NA	NA
AZA25581.1\|1482484_1484341_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	9.6e-55	45.6
AZA25582.1\|1484380_1484737_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25583.1\|1484947_1486636_-	DNA repair protein RecN	NA	NA	NA	NA
AZA25584.1\|1486657_1487473_-	TlyA family rRNA (cytidine-2'-O)-methyltransferase	NA	NA	NA	NA
AZA25585.1\|1487472_1488336_-	polyprenyl synthetase family protein	NA	NA	NA	NA
AZA25586.1\|1488340_1488580_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
AZA25587.1\|1488572_1489943_-	exodeoxyribonuclease VII large subunit	A0A2H4UVM9	Bodo_saltans_virus	5.3e-34	34.7
AZA25588.1\|1489929_1490781_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	7.2e-42	44.7
AZA25589.1\|1490840_1491239_-	transcription antitermination factor NusB	NA	NA	NA	NA
AZA25590.1\|1491238_1491673_-	Asp23/Gls24 family envelope stress response protein	NA	NA	NA	NA
AZA25591.1\|1491692_1492259_-	elongation factor P	NA	NA	NA	NA
AZA25592.1\|1492328_1493435_-	aminopeptidase P family protein	NA	NA	NA	NA
AZA26260.1\|1493579_1493873_-	50S ribosomal protein L27	NA	NA	NA	NA
AZA25593.1\|1493894_1494206_-	50S ribosomal protein L21	NA	NA	NA	NA
AZA25594.1\|1494446_1494803_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	6.3e-16	41.8
AZA25595.1\|1496099_1497365_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AZA25596.1\|1497380_1498922_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.2e-68	45.1
AZA25597.1\|1498922_1499504_-	phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
AZA26261.1\|1499503_1500547_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	8.3e-64	41.1
AZA25598.1\|1500549_1502028_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.8e-51	32.4
AZA25599.1\|1502003_1504226_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.5e-143	40.2
AZA25600.1\|1504225_1504900_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
AZA25601.1\|1504899_1505148_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
AZA25602.1\|1505152_1505875_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	3.2e-38	37.7
AZA25603.1\|1506198_1507494_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.4e-20	32.6
AZA26262.1\|1507537_1508662_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AZA25604.1\|1508651_1509119_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	5.2e-18	42.2
AZA25605.1\|1509302_1509551_-	DUF2087 domain-containing protein	NA	NA	NA	NA
AZA25606.1\|1509671_1511483_-	hypothetical protein	NA	NA	NA	NA
AZA25607.1\|1511667_1513806_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	9.5e-99	45.6
AZA25608.1\|1514293_1515343_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.6e-41	32.5
AZA25609.1\|1515560_1517939_+	Xaa-Pro dipeptidyl-peptidase	NA	NA	NA	NA
AZA25610.1\|1519532_1520315_+	homoserine O-succinyltransferase	NA	NA	NA	NA
AZA25611.1\|1520357_1521281_+	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	1.2e-109	65.3
AZA25612.1\|1523161_1524343_+	class I SAM-dependent methyltransferase	A0A2K9L4K8	Tupanvirus	6.7e-46	35.9
AZA25613.1\|1527019_1528012_-	adenosine deaminase	NA	NA	NA	NA
AZA25614.1\|1528116_1529319_-\|transposase	transposase	NA	NA	NA	NA
AZA25615.1\|1529213_1529513_-	hypothetical protein	NA	NA	NA	NA
AZA25616.1\|1529833_1530175_-	HIRAN domain-containing protein	NA	NA	NA	NA
AZA25617.1\|1530366_1531296_+	DegV family protein	NA	NA	NA	NA
AZA25618.1\|1531384_1532185_-	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A218MNE0	uncultured_virus	2.5e-60	45.1
AZA25619.1\|1532230_1532530_-	5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase	A0A218MNE0	uncultured_virus	5.0e-06	66.7
AZA25620.1\|1532970_1534020_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA25621.1\|1534175_1535438_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25622.1\|1535531_1536983_-	amino acid permease	NA	NA	NA	NA
AZA25623.1\|1537009_1537381_-	hypothetical protein	NA	NA	NA	NA
AZA25624.1\|1537481_1538702_-	MFS transporter	NA	NA	NA	NA
AZA25625.1\|1538952_1540290_-	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZA26263.1\|1540427_1541684_-	aluminum resistance protein	NA	NA	NA	NA
AZA25626.1\|1541689_1542607_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZA25627.1\|1542687_1543089_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZA25628.1\|1543151_1543379_-	DUF910 domain-containing protein	NA	NA	NA	NA
AZA25629.1\|1543378_1544050_-	DUF1751 domain-containing protein	NA	NA	NA	NA
AZA25630.1\|1544042_1544615_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AZA25631.1\|1544668_1544818_-	50S ribosomal protein L33	NA	NA	NA	NA
AZA25632.1\|1544904_1547019_-	penicillin-binding protein 2	NA	NA	NA	NA
AZA25633.1\|1547104_1549687_+	hypothetical protein	NA	NA	NA	NA
AZA25634.1\|1551402_1551891_-	transcription elongation factor GreA	NA	NA	NA	NA
AZA25635.1\|1551961_1554373_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZA25636.1\|1554372_1555422_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	1.1e-31	34.9
AZA25637.1\|1555701_1556052_-	transcriptional regulator	NA	NA	NA	NA
AZA25638.1\|1556234_1557413_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25639.1\|1557594_1557894_+	hypothetical protein	NA	NA	NA	NA
AZA25640.1\|1557788_1558991_+\|transposase	transposase	NA	NA	NA	NA
AZA25641.1\|1559112_1559877_-	RNA methyltransferase	NA	NA	NA	NA
AZA25642.1\|1559942_1560215_+	Acylphosphatase domain-containing protein	NA	NA	NA	NA
AZA25643.1\|1560248_1561211_+	membrane protein insertase YidC	NA	NA	NA	NA
AZA25644.1\|1561307_1562357_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA25645.1\|1562551_1564144_-	sensor histidine kinase	W8CYF6	Bacillus_phage	4.1e-22	29.1
AZA25646.1\|1564136_1564850_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.5e-27	30.8
AZA25647.1\|1565029_1565608_-	DUF177 domain-containing protein	NA	NA	NA	NA
AZA25648.1\|1565607_1566762_-	nucleotidyltransferase	NA	NA	NA	NA
AZA25649.1\|1566765_1567113_-	ribosome silencing factor	NA	NA	NA	NA
AZA25650.1\|1567154_1567748_-	HD domain-containing protein	NA	NA	NA	NA
AZA25651.1\|1567740_1568379_-	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
AZA26264.1\|1568389_1569499_-	ribosome biogenesis GTPase YqeH	NA	NA	NA	NA
AZA25652.1\|1569607_1569964_-	50S ribosomal protein L20	NA	NA	NA	NA
AZA25653.1\|1570008_1570209_-	50S ribosomal protein L35	NA	NA	NA	NA
AZA25654.1\|1570229_1570751_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.0e-14	39.4
AZA25655.1\|1571293_1572559_+	ATPase	NA	NA	NA	NA
AZA25656.1\|1572603_1572786_+	hypothetical protein	NA	NA	NA	NA
AZA25657.1\|1572778_1573126_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25658.1\|1573181_1573415_+	hypothetical protein	NA	NA	NA	NA
AZA25659.1\|1573371_1574715_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.3e-50	30.8
AZA25660.1\|1574927_1575164_-	hypothetical protein	NA	NA	NA	NA
AZA25661.1\|1575224_1576403_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25662.1\|1577362_1579294_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	7.5e-95	32.9
AZA25663.1\|1579593_1580517_-	primosomal protein DnaI	S5MU12	Brevibacillus_phage	8.7e-25	32.0
AZA25664.1\|1580527_1581862_-	helicase DnaB	NA	NA	NA	NA
AZA25665.1\|1581865_1582333_-	transcriptional regulator NrdR	NA	NA	NA	NA
AZA25666.1\|1582346_1582931_-	dephospho-CoA kinase	NA	NA	NA	NA
AZA25667.1\|1582939_1583761_-	DNA-formamidopyrimidine glycosylase	F8WPX6	Bacillus_phage	3.3e-23	28.9
AZA25668.1\|1583771_1586435_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	5.0e-57	29.8
AZA25669.1\|1586646_1587696_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.6e-43	33.1
AZA25670.1\|1587855_1588884_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-35	31.1
AZA25671.1\|1591202_1591424_-	hypothetical protein	NA	NA	NA	NA
AZA25672.1\|1591496_1592675_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25673.1\|1593058_1594108_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25674.1\|1594548_1596087_-	cell surface protein	NA	NA	NA	NA
AZA26265.1\|1596946_1598209_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25675.1\|1598239_1598815_-	hypothetical protein	NA	NA	NA	NA
AZA25676.1\|1599367_1599550_+	hypothetical protein	NA	NA	NA	NA
AZA25677.1\|1599542_1599890_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25678.1\|1599945_1600179_+	hypothetical protein	NA	NA	NA	NA
AZA25679.1\|1600135_1601479_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.3e-50	30.8
AZA25680.1\|1602307_1603486_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25681.1\|1607057_1608377_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AZA26266.1\|1608614_1609877_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25682.1\|1610116_1611340_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	7.9e-98	49.0
AZA25683.1\|1611614_1612262_-	DUF4479 domain-containing protein	NA	NA	NA	NA
AZA25684.1\|1612284_1612605_-	thioredoxin	NA	NA	NA	NA
AZA25685.1\|1612683_1613340_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
AZA25686.1\|1613416_1614634_-	ABC transporter permease	NA	NA	NA	NA
AZA26267.1\|1614626_1615367_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-19	28.9
AZA25687.1\|1615470_1615908_+	diadenosine tetraphosphate hydrolase	Q19XP5	Mycobacterium_phage	1.1e-06	33.3
AZA25688.1\|1615924_1616275_+	hypothetical protein	NA	NA	NA	NA
AZA25689.1\|1616344_1617283_-	dihydroorotate dehydrogenase	NA	NA	NA	NA
AZA25690.1\|1617546_1618269_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
AZA25691.1\|1618258_1618882_+	orotate phosphoribosyltransferase	Q58MW1	Prochlorococcus_phage	8.5e-08	26.0
AZA25692.1\|1619008_1619932_+	peptidylprolyl isomerase	NA	NA	NA	NA
AZA25693.1\|1621008_1622598_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	8.2e-55	45.6
AZA25694.1\|1623009_1624059_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.7e-43	33.1
AZA25695.1\|1624230_1625181_-	3'-5' exonuclease	NA	NA	NA	NA
AZA25696.1\|1625173_1627600_-	DNA repair protein	NA	NA	NA	NA
AZA25697.1\|1627596_1628802_-	DNA repair exonuclease	NA	NA	NA	NA
AZA25698.1\|1628804_1629158_-	YlbF family regulator	NA	NA	NA	NA
AZA26268.1\|1629199_1631287_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
AZA25699.1\|1631427_1632276_+	RluA family pseudouridine synthase	NA	NA	NA	NA
AZA25700.1\|1632370_1633282_-	ketose-bisphosphate aldolase	NA	NA	NA	NA
AZA25701.1\|1633407_1634112_-	L,D-transpeptidase	NA	NA	NA	NA
AZA25702.1\|1634286_1634670_-	sortase	NA	NA	NA	NA
AZA25703.1\|1638636_1639686_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.2e-43	33.1
AZA25704.1\|1640939_1641164_-	hypothetical protein	NA	NA	NA	NA
AZA25705.1\|1642756_1642990_-	hypothetical protein	NA	NA	NA	NA
AZA26269.1\|1643005_1643857_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZA25706.1\|1643858_1645145_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
AZA26270.1\|1645517_1646780_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25707.1\|1646994_1648845_-	pyruvate oxidase	NA	NA	NA	NA
AZA25708.1\|1649066_1650230_-	hypothetical protein	NA	NA	NA	NA
AZA25709.1\|1650392_1652807_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.0e-125	31.8
AZA25710.1\|1653118_1654738_-	polysaccharide biosynthesis protein	NA	NA	NA	NA
AZA25711.1\|1654832_1657247_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	66.7
AZA25712.1\|1657543_1658194_+	PAP2 family protein	NA	NA	NA	NA
AZA25713.1\|1658256_1659705_-	MFS transporter	NA	NA	NA	NA
AZA25714.1\|1659767_1660964_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.6e-141	67.1
AZA25715.1\|1667343_1668270_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K9L162	Tupanvirus	2.0e-08	21.9
AZA25716.1\|1668304_1668964_+	hypothetical protein	NA	NA	NA	NA
AZA26271.1\|1669605_1670655_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8

DBSCAN-SWA_16

1706185 : 1829013

120

Bacillus_phage(32.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA25750.1\|1706185_1706908_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
AZA25751.1\|1706925_1707456_-	folate family ECF transporter S component	NA	NA	NA	NA
AZA25752.1\|1707497_1708247_-	acyl-[acyl-carrier-protein] thioesterase	NA	NA	NA	NA
AZA25753.1\|1708243_1709107_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.3e-66	47.6
AZA25754.1\|1709106_1709439_-	DNA replication initiation control protein YabA	NA	NA	NA	NA
AZA25755.1\|1709453_1710326_-	DNA polymerase III subunit delta	M1NSC1	Streptococcus_phage	1.6e-15	26.8
AZA25756.1\|1710325_1710652_-	hypothetical protein	NA	NA	NA	NA
AZA25757.1\|1710663_1711302_-	dTMP kinase	M1PSC7	Streptococcus_phage	5.2e-53	51.4
AZA25758.1\|1711431_1711668_-	DUF2508 domain-containing protein	NA	NA	NA	NA
AZA25759.1\|1711669_1712269_-	recombination protein RecR	NA	NA	NA	NA
AZA25760.1\|1712270_1712600_-	nucleoid-associated protein, YbaB/EbfC family	NA	NA	NA	NA
AZA25761.1\|1712671_1714495_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	7.7e-49	42.6
AZA26273.1\|1714904_1716167_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25762.1\|1716253_1717621_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
AZA25763.1\|1717626_1718142_-\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
AZA25764.1\|1718141_1718744_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZA25765.1\|1718745_1719276_-	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
AZA25766.1\|1719367_1722235_-	hypothetical protein	NA	NA	NA	NA
AZA26274.1\|1722291_1722570_-	hypothetical protein	NA	NA	NA	NA
AZA25767.1\|1722841_1723084_+	hypothetical protein	NA	NA	NA	NA
AZA25768.1\|1723050_1723386_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
AZA25769.1\|1723703_1723895_-	hypothetical protein	NA	NA	NA	NA
AZA25770.1\|1724972_1726091_-	penicillin-binding protein	NA	NA	NA	NA
AZA25771.1\|1726190_1727318_-	penicillin-binding protein	NA	NA	NA	NA
AZA25772.1\|1727475_1727748_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.1e-25	70.0
AZA25773.1\|1728908_1729091_+	hypothetical protein	NA	NA	NA	NA
AZA25774.1\|1729083_1729431_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25775.1\|1729486_1729720_+	hypothetical protein	NA	NA	NA	NA
AZA25776.1\|1729676_1731020_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.2e-48	30.1
AZA25777.1\|1732057_1732423_-	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZA25778.1\|1732475_1732985_-	50S ribosomal protein L10	NA	NA	NA	NA
AZA25779.1\|1733245_1733647_+	hypothetical protein	NA	NA	NA	NA
AZA25780.1\|1735210_1736215_-	glycosyl transferase	NA	NA	NA	NA
AZA25781.1\|1736377_1737073_-	50S ribosomal protein L1	NA	NA	NA	NA
AZA26275.1\|1737156_1737582_-	50S ribosomal protein L11	NA	NA	NA	NA
AZA26276.1\|1737707_1738262_-	transcription termination/antitermination protein NusG	NA	NA	NA	NA
AZA25782.1\|1738353_1738524_-	preprotein translocase subunit SecE	NA	NA	NA	NA
AZA25783.1\|1738530_1738680_-	50S ribosomal protein L33	NA	NA	NA	NA
AZA25784.1\|1738855_1740607_+	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
AZA25785.1\|1740708_1741500_-	alpha/beta hydrolase	NA	NA	NA	NA
AZA25786.1\|1741628_1741844_-	hypothetical protein	NA	NA	NA	NA
AZA25787.1\|1741995_1743045_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25788.1\|1743166_1743736_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
AZA25789.1\|1743847_1744597_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
AZA25790.1\|1744583_1745027_-	hypothetical protein	NA	NA	NA	NA
AZA25791.1\|1745019_1746444_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	4.8e-46	30.1
AZA25792.1\|1746586_1747153_+	NUDIX hydrolase	NA	NA	NA	NA
AZA26277.1\|1747442_1748705_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25793.1\|1749929_1750805_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	1.4e-08	34.9
AZA25794.1\|1750923_1751949_+	putative sulfate exporter family transporter	NA	NA	NA	NA
AZA25795.1\|1752034_1753537_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AZA25796.1\|1753681_1754518_-	ABC transporter permease	NA	NA	NA	NA
AZA25797.1\|1754517_1755216_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	6.8e-14	27.1
AZA25798.1\|1755217_1755586_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZA25799.1\|1755960_1757580_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25800.1\|1757711_1758236_+	NUDIX hydrolase	A0A1S6L1P8	Vibrio_phage	3.9e-06	28.6
AZA25801.1\|1758276_1759497_-	carboxylate--amine ligase	NA	NA	NA	NA
AZA25802.1\|1759493_1760675_-	carboxylate--amine ligase	NA	NA	NA	NA
AZA26278.1\|1760689_1761757_-	hypothetical protein	NA	NA	NA	NA
AZA25803.1\|1762554_1763604_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
AZA25804.1\|1763846_1765781_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.0e-54	45.6
AZA25805.1\|1766075_1767197_-	peptidase M24 family protein	NA	NA	NA	NA
AZA25806.1\|1767460_1767892_+	hypothetical protein	NA	NA	NA	NA
AZA26279.1\|1769307_1769523_+	GGDEF domain-containing protein	NA	NA	NA	NA
AZA25807.1\|1769614_1770118_-	ECF transporter S component	NA	NA	NA	NA
AZA25808.1\|1770278_1771673_-	acetaldehyde dehydrogenase	NA	NA	NA	NA
AZA26280.1\|1771938_1773201_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25809.1\|1773564_1774392_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
AZA25810.1\|1775142_1776321_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25811.1\|1783167_1783374_-	hypothetical protein	NA	NA	NA	NA
AZA26281.1\|1783558_1784821_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25812.1\|1785039_1785378_-	cyclic diguanylate phosphodiesterase	NA	NA	NA	NA
AZA25813.1\|1785390_1785522_-	hypothetical protein	NA	NA	NA	NA
AZA25814.1\|1785487_1785709_-	hypothetical protein	NA	NA	NA	NA
AZA25815.1\|1786301_1787249_-	glycosyltransferase family 8 protein	NA	NA	NA	NA
AZA25816.1\|1787358_1788735_-	DNA repair protein RadA	NA	NA	NA	NA
AZA25817.1\|1788734_1789289_-	dUTP diphosphatase	J9PV85	Bacillus_phage	1.3e-39	49.2
AZA25818.1\|1789394_1789682_+	hypothetical protein	NA	NA	NA	NA
AZA25819.1\|1789766_1791116_+	cysteine aminopeptidase	R4TV59	Phaeocystis_globosa_virus	3.8e-69	35.2
AZA25820.1\|1791181_1791475_-	hypothetical protein	NA	NA	NA	NA
AZA25821.1\|1791468_1792404_-	2',3'-cyclic-nucleotide 2'-phosphodiesterase	I7CCW4	Staphylococcus_virus	7.8e-13	30.1
AZA25822.1\|1792515_1792977_-	3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ	NA	NA	NA	NA
AZA26282.1\|1793164_1794427_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25823.1\|1794611_1795289_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase	NA	NA	NA	NA
AZA25824.1\|1795302_1795488_-	hypothetical protein	NA	NA	NA	NA
AZA25825.1\|1795489_1795675_-	hypothetical protein	NA	NA	NA	NA
AZA25826.1\|1795695_1796376_-	histidine phosphatase family protein	NA	NA	NA	NA
AZA25827.1\|1796435_1797176_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
AZA25828.1\|1797394_1797976_+	DJ-1 family protein	NA	NA	NA	NA
AZA25829.1\|1797977_1798496_+	N-acetyltransferase	NA	NA	NA	NA
AZA25830.1\|1798571_1799630_+	dipeptide epimerase	NA	NA	NA	NA
AZA25831.1\|1799631_1800372_+	serine hydrolase	NA	NA	NA	NA
AZA25832.1\|1800454_1801210_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AZA25833.1\|1801355_1802768_+	dipeptidase PepV	NA	NA	NA	NA
AZA25834.1\|1803012_1804389_+	amino acid permease	NA	NA	NA	NA
AZA25835.1\|1804502_1805174_-	DUF4867 domain-containing protein	NA	NA	NA	NA
AZA25836.1\|1805166_1805742_-	galactose-6-phosphate isomerase subunit LacB	NA	NA	NA	NA
AZA25837.1\|1805761_1806190_-	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
AZA25838.1\|1806208_1806976_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
AZA25839.1\|1807219_1808092_-	aldose epimerase	NA	NA	NA	NA
AZA25840.1\|1808104_1809037_-	tagatose-6-phosphate kinase	NA	NA	NA	NA
AZA25841.1\|1809033_1809213_-	hypothetical protein	NA	NA	NA	NA
AZA25842.1\|1809404_1810397_-	tagatose 1,6-diphosphate aldolase	NA	NA	NA	NA
AZA26283.1\|1810433_1811696_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25843.1\|1811916_1812174_-	hypothetical protein	NA	NA	NA	NA
AZA25844.1\|1812218_1813640_-	PTS glucitol transporter subunit IIA	NA	NA	NA	NA
AZA25845.1\|1813692_1814007_-	PTS fructose transporter subunit IIB	NA	NA	NA	NA
AZA25846.1\|1814190_1815240_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25847.1\|1815247_1815769_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZA25848.1\|1816095_1816860_+	DUF1129 domain-containing protein	NA	NA	NA	NA
AZA25849.1\|1817056_1818502_-	6-phospho-beta-galactosidase	A0A0B5JD41	Pandoravirus	2.8e-54	31.7
AZA25850.1\|1818512_1820216_-	PTS lactose transporter subunit IIB	NA	NA	NA	NA
AZA25851.1\|1820350_1821262_-	PRD domain-containing protein	NA	NA	NA	NA
AZA25852.1\|1821473_1821827_-	PTS lactose transporter subunit IIA	NA	NA	NA	NA
AZA25853.1\|1822445_1823465_-	galactose-1-epimerase	NA	NA	NA	NA
AZA25854.1\|1823564_1824731_+	galactokinase	NA	NA	NA	NA
AZA25855.1\|1824755_1826222_+	galactose-1-phosphate uridylyltransferase	NA	NA	NA	NA
AZA25856.1\|1826294_1827662_-	aspartate ammonia-lyase	NA	NA	NA	NA
AZA25857.1\|1827855_1828056_-	hypothetical protein	NA	NA	NA	NA
AZA25858.1\|1828305_1829013_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_17

1834161 : 1920330

Bacillus_phage(31.58%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26284.1\|1834161_1835424_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25863.1\|1836163_1836694_+	N-acetyltransferase	NA	NA	NA	NA
AZA25864.1\|1836893_1837079_-	hypothetical protein	NA	NA	NA	NA
AZA25865.1\|1837199_1838186_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.5e-22	27.4
AZA25866.1\|1838208_1839666_-	sucrose-6-phosphate hydrolase	NA	NA	NA	NA
AZA25867.1\|1839950_1841897_+	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
AZA25868.1\|1842082_1843162_+	6-phosphofructokinase	NA	NA	NA	NA
AZA26285.1\|1843387_1844650_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25869.1\|1844705_1846427_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	3.6e-141	45.0
AZA25870.1\|1848381_1848909_-	hypothetical protein	NA	NA	NA	NA
AZA26286.1\|1849089_1850352_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25871.1\|1852698_1853934_+	MFS transporter	NA	NA	NA	NA
AZA25872.1\|1854042_1854459_+	XRE family transcriptional regulator	A0A2I7SC14	Paenibacillus_phage	3.5e-05	34.7
AZA26287.1\|1854647_1855910_+\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25873.1\|1855965_1856274_-	hypothetical protein	NA	NA	NA	NA
AZA25874.1\|1856411_1859552_+	NgoFVII family restriction endonuclease	A0A0A1ENT0	Lactobacillus_phage	5.1e-32	29.1
AZA25875.1\|1859631_1860621_+	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.9e-54	39.0
AZA25876.1\|1860813_1861656_-	dipeptidyl-peptidase	NA	NA	NA	NA
AZA25877.1\|1863163_1864342_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25878.1\|1864431_1865802_+	amino acid permease	NA	NA	NA	NA
AZA26288.1\|1865866_1867129_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25879.1\|1867900_1868269_-	DUF956 domain-containing protein	NA	NA	NA	NA
AZA25880.1\|1868278_1869193_-	PTS mannose family transporter subunit IID	NA	NA	NA	NA
AZA25881.1\|1869221_1870034_-	PTS mannose/fructose/sorbose transporter subunit IIC	NA	NA	NA	NA
AZA25882.1\|1870052_1871120_-	PTS mannose transporter subunit IIAB	NA	NA	NA	NA
AZA25883.1\|1872010_1873390_+	Na+/H+ antiporter NhaC	NA	NA	NA	NA
AZA25884.1\|1874337_1875705_+\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	1.2e-30	28.8
AZA25885.1\|1875875_1876337_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	7.9e-43	58.6
AZA25886.1\|1876359_1878729_-	ribonuclease R	Q0GXV6	Lactococcus_phage	3.0e-77	35.2
AZA25887.1\|1878795_1879029_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZA25888.1\|1879083_1881156_-	glycerol phosphate lipoteichoic acid synthase	W6LM83	Streptococcus_phage	1.8e-139	45.2
AZA25889.1\|1881174_1882188_-	hypothetical protein	NA	NA	NA	NA
AZA25890.1\|1882180_1883230_-	glycosyltransferase	NA	NA	NA	NA
AZA25891.1\|1883222_1884392_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZA26289.1\|1887247_1888510_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25892.1\|1888784_1890212_-	amino acid permease	NA	NA	NA	NA
AZA25893.1\|1890341_1891565_-	arginine deiminase	NA	NA	NA	NA
AZA25894.1\|1891743_1892673_-	carbamate kinase	NA	NA	NA	NA
AZA25895.1\|1892691_1893693_-	ornithine carbamoyltransferase	NA	NA	NA	NA
AZA25896.1\|1893991_1894861_+	response regulator receiver protein	NA	NA	NA	NA
AZA25897.1\|1894943_1895663_+	hypothetical protein	NA	NA	NA	NA
AZA25898.1\|1895697_1897269_-	amidohydrolase	NA	NA	NA	NA
AZA25899.1\|1904382_1904946_-	RNA polymerase sigma factor	NA	NA	NA	NA
AZA25900.1\|1905103_1906411_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.0e-91	49.0
AZA25901.1\|1906654_1907149_-	N-acetyltransferase	A0A2K9L4B7	Tupanvirus	8.8e-08	34.1
AZA25902.1\|1907148_1907742_-	TVP38/TMEM64 family protein	M1Q152	Streptococcus_phage	5.6e-33	39.3
AZA25903.1\|1907948_1908752_+	esterase	NA	NA	NA	NA
AZA25904.1\|1908754_1909639_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZA25905.1\|1909656_1910154_-	nucleoside 2-deoxyribosyltransferase	NA	NA	NA	NA
AZA25906.1\|1910162_1910834_-	type 1 glutamine amidotransferase	NA	NA	NA	NA
AZA25907.1\|1911092_1912478_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZA25908.1\|1912806_1913889_-	hypothetical protein	NA	NA	NA	NA
AZA25909.1\|1914001_1917895_-	hypothetical protein	NA	NA	NA	NA
AZA25910.1\|1917938_1918511_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZA26290.1\|1919067_1920330_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6

DBSCAN-SWA_18

1930956 : 2055637

104

Bacillus_phage(30.56%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26292.1\|1930956_1932219_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25921.1\|1932309_1933377_+	hypothetical protein	NA	NA	NA	NA
AZA25922.1\|1933428_1934343_+	prolyl aminopeptidase	NA	NA	NA	NA
AZA25923.1\|1934490_1935285_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZA25924.1\|1935340_1935898_-	elongation factor P	NA	NA	NA	NA
AZA25925.1\|1935951_1936866_-	type I pantothenate kinase	NA	NA	NA	NA
AZA25926.1\|1936968_1937538_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
AZA25927.1\|1937666_1938110_+	LytTR family transcriptional regulator	NA	NA	NA	NA
AZA25928.1\|1938115_1938865_+	hypothetical protein	NA	NA	NA	NA
AZA25929.1\|1938926_1939757_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA25930.1\|1941471_1942125_-	polar amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-26	36.3
AZA25931.1\|1942136_1942778_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZA25932.1\|1943141_1945421_-	ATP-dependent DNA helicase	NA	NA	NA	NA
AZA25933.1\|1945414_1945639_-	hypothetical protein	NA	NA	NA	NA
AZA25934.1\|1945616_1946279_+	metalloendopeptidase	NA	NA	NA	NA
AZA25935.1\|1946293_1946947_+	phosphoglycerate mutase family protein	NA	NA	NA	NA
AZA25936.1\|1947052_1947745_+	glycerophosphodiester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	4.4e-13	23.6
AZA26293.1\|1949467_1950730_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25937.1\|1951751_1951991_-	hypothetical protein	NA	NA	NA	NA
AZA25938.1\|1954304_1955828_-	ATP-dependent endonuclease	NA	NA	NA	NA
AZA25939.1\|1955838_1956546_-	VanZ family protein	NA	NA	NA	NA
AZA25940.1\|1956805_1957228_+	GtrA family protein	NA	NA	NA	NA
AZA25941.1\|1957234_1957408_+	hypothetical protein	NA	NA	NA	NA
AZA25942.1\|1957474_1957924_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.0e-19	40.6
AZA26294.1\|1958022_1959285_-\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25943.1\|1959541_1960969_-	flippase	NA	NA	NA	NA
AZA25944.1\|1960971_1962195_-	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.7e-156	71.2
AZA25945.1\|1962474_1962657_+	hypothetical protein	NA	NA	NA	NA
AZA25946.1\|1962649_1962997_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25947.1\|1963052_1963286_+	hypothetical protein	NA	NA	NA	NA
AZA25948.1\|1963242_1964586_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.2e-48	30.1
AZA25949.1\|1964808_1965789_-	LytR family transcriptional regulator	NA	NA	NA	NA
AZA25950.1\|1966041_1967091_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
AZA26295.1\|1967280_1968510_-	LytR family transcriptional regulator	NA	NA	NA	NA
AZA26296.1\|1970782_1972045_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25951.1\|1973733_1974621_+	DNA-entry nuclease	NA	NA	NA	NA
AZA26297.1\|1974939_1975236_-	hypothetical protein	NA	NA	NA	NA
AZA25952.1\|1975491_1975860_-	transcriptional regulator	A0A1B0Y3N1	Lactobacillus_phage	5.2e-05	26.9
AZA26298.1\|1975995_1977258_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25953.1\|1977458_1978472_-	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
AZA25954.1\|1979031_1979388_+	hypothetical protein	NA	NA	NA	NA
AZA25955.1\|1979474_1980653_+\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA25956.1\|1982063_1982297_-	hypothetical protein	NA	NA	NA	NA
AZA25957.1\|1982352_1982700_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25958.1\|1982692_1982875_-	hypothetical protein	NA	NA	NA	NA
AZA25959.1\|1982959_1983154_-	hypothetical protein	NA	NA	NA	NA
AZA25960.1\|1983157_1984606_-	flippase	NA	NA	NA	NA
AZA25961.1\|1985414_1986413_-	hypothetical protein	A0A1V0SAH6	Catovirus	1.5e-14	33.8
AZA25962.1\|1987612_1988680_-	hypothetical protein	A0A1V0SAH6	Catovirus	3.0e-08	32.0
AZA25963.1\|1990153_1991203_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	32.8
AZA25964.1\|1992301_1993351_+\|transposase	IS30-like element ISL7 family transposase	H7BWC8	unidentified_phage	8.1e-43	33.1
AZA26299.1\|1993475_1993700_-	hypothetical protein	NA	NA	NA	NA
AZA25965.1\|1993671_1995423_-\|transposase	transposase	NA	NA	NA	NA
AZA25966.1\|1995660_1995987_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
AZA25967.1\|1995979_1996162_-	hypothetical protein	NA	NA	NA	NA
AZA25968.1\|1997666_1998611_-	glycosyltransferase	A0A1V0SAH6	Catovirus	3.6e-10	43.5
AZA26300.1\|1999662_2000772_-	polysaccharide polymerase	Q6EVM4	Oenoccocus_phage	6.3e-62	43.4
AZA25969.1\|2001891_2002614_-	glycosyl transferase	A0A1V0SL98	Klosneuvirus	7.6e-08	29.0
AZA25970.1\|2002625_2003120_-	glycosyltransferase	NA	NA	NA	NA
AZA25971.1\|2003128_2003593_-	UDP-N-acetylglucosamine--LPS N-acetylglucosamine transferase	NA	NA	NA	NA
AZA25972.1\|2003641_2004310_-	multidrug MFS transporter	NA	NA	NA	NA
AZA25973.1\|2004343_2005120_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AZA25974.1\|2005123_2005903_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AZA25975.1\|2005912_2006800_-	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
AZA25976.1\|2006799_2007843_-	transcriptional regulator	NA	NA	NA	NA
AZA25977.1\|2008171_2009452_+	GTPase HflX	NA	NA	NA	NA
AZA25978.1\|2009500_2010280_-	hydrolase	NA	NA	NA	NA
AZA25979.1\|2010325_2011084_-	hydrolase	A0A0K2SUC1	Clostridium_phage	2.0e-14	40.2
AZA25980.1\|2011380_2012094_-	hydrolase	A0A0A7DMV4	Lactobacillus_phage	1.0e-17	52.9
AZA26301.1\|2012211_2013474_-\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA25981.1\|2013650_2014697_-	lactate dehydrogenase	NA	NA	NA	NA
AZA25982.1\|2014981_2015467_-	NlpC/P60 family protein	A0A2L1IW19	Streptomyces_phage	4.3e-15	40.4
AZA25983.1\|2015591_2016134_-	guanylate kinase	A0A2R2ZH49	Clostridioides_phage	3.0e-09	28.0
AZA25984.1\|2016223_2016553_+	DUF2187 domain-containing protein	NA	NA	NA	NA
AZA25985.1\|2016616_2018155_+	hypothetical protein	NA	NA	NA	NA
AZA25986.1\|2018205_2018832_-	hypothetical protein	NA	NA	NA	NA
AZA25987.1\|2018834_2019350_-	hypothetical protein	NA	NA	NA	NA
AZA25988.1\|2019516_2019705_+	hypothetical protein	NA	NA	NA	NA
AZA26302.1\|2020922_2022185_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA25989.1\|2023919_2024369_+	hypothetical protein	NA	NA	NA	NA
AZA25990.1\|2024424_2024556_-	prevent-host-death family antitoxin	NA	NA	NA	NA
AZA25991.1\|2024831_2025323_-	threonine/serine exporter	NA	NA	NA	NA
AZA25992.1\|2025325_2026081_-	threonine/serine exporter	NA	NA	NA	NA
AZA25993.1\|2026134_2027679_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	8.8e-46	27.4
AZA25994.1\|2027693_2028071_-	hypothetical protein	NA	NA	NA	NA
AZA25995.1\|2028189_2029329_-	LytR family transcriptional regulator	NA	NA	NA	NA
AZA25996.1\|2029669_2030968_+\|transposase	transposase	C1KFS0	Lactobacillus_virus	6.9e-68	38.3
AZA25997.1\|2031289_2033092_+	oligoendopeptidase F	NA	NA	NA	NA
AZA25998.1\|2033161_2034388_-	lactate oxidase	NA	NA	NA	NA
AZA25999.1\|2034517_2036056_-	lactate permease	NA	NA	NA	NA
AZA26000.1\|2036636_2037008_-	hypothetical protein	NA	NA	NA	NA
AZA26001.1\|2037110_2037908_-	metal ABC transporter permease	NA	NA	NA	NA
AZA26002.1\|2037907_2038561_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-16	30.0
AZA26003.1\|2041845_2042760_-	1-phosphofructokinase	NA	NA	NA	NA
AZA26004.1\|2042759_2043509_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.6e-24	32.4
AZA26005.1\|2043656_2044706_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-42	33.1
AZA26303.1\|2045072_2046335_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26006.1\|2046385_2047135_-	amino acid racemase	NA	NA	NA	NA
AZA26007.1\|2047148_2048699_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AZA26008.1\|2048735_2049944_-	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-26	31.8
AZA26009.1\|2049933_2050620_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.9e-37	37.6
AZA26010.1\|2050748_2052593_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.9e-42	26.8
AZA26011.1\|2052603_2054331_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.2e-44	27.5
AZA26304.1\|2054374_2055637_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6

DBSCAN-SWA_19

2071007 : 2131330

Streptococcus_phage(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26029.1\|2071007_2072186_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA26030.1\|2072265_2072751_-	PTS glucose transporter subunit IIA	NA	NA	NA	NA
AZA26031.1\|2072857_2073664_-	DNA-binding response regulator	A0A2H4J4Z6	uncultured_Caudovirales_phage	1.4e-07	24.0
AZA26032.1\|2073672_2074716_-	hypothetical protein	NA	NA	NA	NA
AZA26306.1\|2074902_2076165_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26033.1\|2076195_2077227_-	hypothetical protein	NA	NA	NA	NA
AZA26034.1\|2077229_2077841_-	hypothetical protein	NA	NA	NA	NA
AZA26035.1\|2077979_2078279_+	hypothetical protein	NA	NA	NA	NA
AZA26036.1\|2078173_2079376_+\|transposase	transposase	NA	NA	NA	NA
AZA26037.1\|2079554_2080229_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-35	41.4
AZA26038.1\|2080230_2081289_-	ABC transporter permease	NA	NA	NA	NA
AZA26039.1\|2081331_2081838_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZA26040.1\|2082158_2083562_-	FAD-binding oxidoreductase	NA	NA	NA	NA
AZA26041.1\|2083740_2084478_-	peroxide stress protein YaaA	A0A1X9I5I0	Streptococcus_phage	9.4e-22	32.1
AZA26042.1\|2084542_2085178_+	hypothetical protein	NA	NA	NA	NA
AZA26307.1\|2086557_2087820_-\|transposase	IS3-like element ISL6 family transposase	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7
AZA26308.1\|2088714_2090961_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.8e-61	30.4
AZA26309.1\|2092736_2093999_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	8.5e-55	45.2
AZA26043.1\|2094175_2095399_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	5.1e-97	48.7
AZA26044.1\|2095952_2096585_-	nitroreductase family protein	NA	NA	NA	NA
AZA26045.1\|2096710_2099242_-	peptidase	A0A0P0IY26	Acinetobacter_phage	9.0e-72	25.1
AZA26046.1\|2099704_2100574_+	peptidoglycan-binding protein LysM	A0A0E3XCL7	Enterococcus_phage	8.8e-19	67.6
AZA26047.1\|2100744_2101692_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
AZA26048.1\|2103450_2104869_-	anion permease	NA	NA	NA	NA
AZA26049.1\|2104894_2106298_-	class II fumarate hydratase	NA	NA	NA	NA
AZA26050.1\|2106815_2107055_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
AZA26051.1\|2107051_2107318_-	hypothetical protein	NA	NA	NA	NA
AZA26310.1\|2107688_2108951_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26052.1\|2109214_2110582_-\|transposase	ISL3-like element ISLdl1 family transposase	A4PE56	Ralstonia_virus	4.2e-31	29.1
AZA26053.1\|2110765_2111680_+	cytochrome C5	NA	NA	NA	NA
AZA26054.1\|2111738_2111978_-	hypothetical protein	NA	NA	NA	NA
AZA26055.1\|2112074_2112575_-	O-acetyl-ADP-ribose deacetylase	F1SVT2	Red_sea_bream_iridovirus	2.0e-36	47.0
AZA26056.1\|2112574_2113357_-	protein-tyrosine-phosphatase	NA	NA	NA	NA
AZA26057.1\|2113468_2114227_-	protein-tyrosine-phosphatase	NA	NA	NA	NA
AZA26058.1\|2114260_2115769_-	glycerol kinase	NA	NA	NA	NA
AZA26059.1\|2115965_2116634_+	cobalamin biosynthesis protein CobQ	NA	NA	NA	NA
AZA26311.1\|2116828_2117065_+	transcriptional regulator	NA	NA	NA	NA
AZA26060.1\|2117188_2119279_+\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	1.1e-123	39.2
AZA26061.1\|2119808_2121515_-\|transposase	transposase	NA	NA	NA	NA
AZA26062.1\|2121483_2122143_-\|transposase	IS607 family transposase	A0A7Q0	Microcystis_virus	4.7e-49	50.2
AZA26063.1\|2122317_2123031_+	GGDEF domain-containing protein	NA	NA	NA	NA
AZA26064.1\|2123582_2123984_-	hypothetical protein	NA	NA	NA	NA
AZA26065.1\|2124729_2125953_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	3.9e-97	49.0
AZA26066.1\|2126075_2127329_-\|transposase	transposase	NA	NA	NA	NA
AZA26067.1\|2127549_2127747_+	hypothetical protein	NA	NA	NA	NA
AZA26312.1\|2127819_2128485_+	hypothetical protein	NA	NA	NA	NA
AZA26068.1\|2128688_2128886_+	cold-shock protein	Q9AZD3	Lactococcus_phage	9.8e-19	69.8
AZA26313.1\|2130067_2131330_+\|transposase	IS3 family transposase ISL6	A0A0C5AEA5	Paenibacillus_phage	9.4e-30	35.7

DBSCAN-SWA_20

2137203 : 2205844

Streptococcus_phage(31.58%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZA26072.1\|2137203_2138427_+\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.3e-97	49.2
AZA26073.1\|2144032_2145211_-\|transposase	IS256 family transposase	NA	NA	NA	NA
AZA26314.1\|2145422_2146685_+\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26074.1\|2146857_2147127_-	anion transporter	NA	NA	NA	NA
AZA26075.1\|2148371_2148836_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.4e-25	44.3
AZA26076.1\|2148850_2150029_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.8e-98	47.1
AZA26077.1\|2150048_2150663_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.6e-30	40.9
AZA26078.1\|2152158_2153442_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.2e-58	33.3
AZA26315.1\|2159737_2161000_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26079.1\|2161186_2161813_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZA26080.1\|2161816_2163817_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-29	33.9
AZA26081.1\|2163952_2164342_-	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
AZA26082.1\|2164501_2164726_+	hypothetical protein	NA	NA	NA	NA
AZA26083.1\|2166404_2167691_-	D-alanyl-lipoteichoic acid biosynthesis protein DltD	NA	NA	NA	NA
AZA26084.1\|2167680_2167923_-	D-alanine--poly(phosphoribitol) ligase subunit 2	NA	NA	NA	NA
AZA26085.1\|2167992_2169225_-	D-alanyl-lipoteichoic acid biosynthesis protein DltB	A0A125RNP0	Pseudomonas_phage	5.4e-22	27.0
AZA26086.1\|2169221_2170724_-	D-alanine--poly(phosphoribitol) ligase subunit 1	A0A2K9KZV5	Tupanvirus	1.7e-41	28.3
AZA26316.1\|2170739_2170889_-	teichoic acid D-Ala incorporation-associated protein DltX	NA	NA	NA	NA
AZA26087.1\|2171159_2171462_-	hypothetical protein	NA	NA	NA	NA
AZA26088.1\|2171642_2172866_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.3e-97	49.2
AZA26089.1\|2173156_2174365_-	hypothetical protein	NA	NA	NA	NA
AZA26090.1\|2174422_2174617_-	hypothetical protein	NA	NA	NA	NA
AZA26317.1\|2174886_2176149_-\|transposase	IS3-like element ISL6 family transposase	A0A1B1P773	Bacillus_phage	6.5e-55	45.6
AZA26091.1\|2176424_2176895_+	CBS domain-containing protein	NA	NA	NA	NA
AZA26318.1\|2179031_2180192_+	cation:proton antiporter	NA	NA	NA	NA
AZA26092.1\|2180277_2180934_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZA26093.1\|2181026_2182127_+	YdcF family protein	NA	NA	NA	NA
AZA26094.1\|2182332_2183418_+	BMP family ABC transporter substrate-binding protein	A0A0A7DN02	Lactobacillus_phage	3.3e-79	48.0
AZA26095.1\|2184864_2186148_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.2e-58	33.3
AZA26096.1\|2186405_2187629_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	2.3e-97	49.2
AZA26097.1\|2187970_2188402_-	hypothetical protein	NA	NA	NA	NA
AZA26098.1\|2190562_2190973_-	hypothetical protein	NA	NA	NA	NA
AZA26099.1\|2191015_2192056_+	protein kinase	A0A2I2L4J2	Orpheovirus	1.3e-08	32.1
AZA26100.1\|2192150_2192747_+	DUF4352 domain-containing protein	A0A0P0IXE0	Lactobacillus_phage	1.4e-44	70.0
AZA26319.1\|2194127_2194619_+	hypothetical protein	NA	NA	NA	NA
AZA26320.1\|2194836_2195061_-	hypothetical protein	NA	NA	NA	NA
AZA26101.1\|2195032_2196784_-\|transposase	transposase	NA	NA	NA	NA
AZA26102.1\|2197308_2198139_+	ABC transporter permease	NA	NA	NA	NA
AZA26103.1\|2198131_2198920_+	ABC transporter permease	NA	NA	NA	NA
AZA26104.1\|2198929_2199964_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-29	37.7
AZA26105.1\|2199996_2201058_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA26106.1\|2201198_2202260_+	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZA26107.1\|2202321_2204019_+	adenosine deaminase	NA	NA	NA	NA
AZA26108.1\|2204560_2205844_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.2e-58	33.3

Anti-CRISPR protein detection

Acr_ID: CP029250.1|AZA25432.1|1291315_1291561_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: CP029250.1|AZA25508.1|1393772_1394030_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

CP029250.1|AZA25432.1|1291315_1291561_-|hypothetical-protein

1291315_1291561_-

81 aa aa

1285357-1418799

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP029250_2	TypeI	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	1304402-1304436	0

1. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to CP029250 position: 1304402-1304436, mismatch: 0

gtcgcccacttgggtcacttggacaagcaccatgt	CRISPR spacer
gtcgcccacttgggtcacttggacaagcaccatgt	Protospacer
***********************************

CP029250.1|AZA25508.1|1393772_1394030_-|hypothetical-protein

1393772_1394030_-

85 aa aa

1285357-1418799

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
CP029250_2	TypeI	2.1\|950463\|35\|CP029250\|PILER-CR,CRISPRCasFinder,CRT	950463-950497	35	1304402-1304436	0

1. spacer 2.1|950463|35|CP029250|PILER-CR,CRISPRCasFinder,CRT matches to CP029250 position: 1304402-1304436, mismatch: 0

gtcgcccacttgggtcacttggacaagcaccatgt	CRISPR spacer
gtcgcccacttgggtcacttggacaagcaccatgt	Protospacer
***********************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP029250

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information