CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027714	Pseudomonas chlororaphis strain ATCC 17415 chromosome, complete genome	2 crisprs	DinG,csa3,cas3,PD-DExK,DEDDh,WYL	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027714_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027714_1

416599-416710

Orphan

Consensus_repeat	Method
GCGCTGATTGCGCCGGGCCCGGTGTAAAGAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027714_1

>merge|CP027714|1|416599-416710|CRISPRCasFinder
GCGCTGATTGCGCCGGGCCCGGTGTAAAGAGGGGAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGAGGGCCGCGCTGATTGCGCTGGGCCCGGTGTAAAGAGGG

>CP027714|1|1|416599-416710|CRISPRCasFinder
GCGCTGATTGCGCCGGGCCCGGTGTAAAGAGGG	GAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGAGGGCC
GCGCTGATTGCGCTGGGCCCGGTGTAAAGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027714.1\|AZD13333.1\|417349_418786_-\|Nitrogen-regulation-protein-NtrC	unknown	unknown	gnl\|CDD\|273818
CP027714.1\|AZD13340.1\|426615_428070_+\|tRNA-4-thiouridine-synthase	unknown	unknown	gnl\|CDD\|234932
CP027714.1\|AZD13342.1\|430299_430740_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|308985
CP027714.1\|AZD13331.1\|415649_416105_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297
CP027714.1\|AZD13341.1\|428209_430030_+\|GTP-binding-protein-TypA/BipA	unknown	unknown	gnl\|CDD\|224138
CP027714.1\|AZD13323.1\|408852_409611_-\|Putative-periplasmic-protein-YibQ	unknown	unknown	gnl\|CDD\|377404
CP027714.1\|AZD13330.1\|415462_415585_-\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD13336.1\|421430_421946_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379230
CP027714.1\|AZD13324.1\|409777_411088_-\|Carboxyl-terminal-protease	unknown	unknown	gnl\|CDD\|223864
CP027714.1\|AZD13335.1\|420343_421459_+\|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|225080
CP027714.1\|AZD13339.1\|424878_426285_-\|Glutamine-synthetase-type-I	unknown	unknown	gnl\|CDD\|181884
CP027714.1\|AZD13338.1\|422663_424703_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225405
CP027714.1\|AZD13328.1\|414638_414893_+\|Glutaredoxin-3-(Grx3)	unknown	unknown	gnl\|CDD\|274017
CP027714.1\|AZD13329.1\|414949_415432_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	unknown	unknown	gnl\|CDD\|180234
CP027714.1\|AZD13327.1\|414223_414637_+\|Rhodanese-related-sulfurtransferase-YibN	unknown	unknown	gnl\|CDD\|238089
CP027714.1\|AZD13334.1\|418782_419868_-\|Nitrogen-regulation-protein-NtrB	unknown	unknown	gnl\|CDD\|226370
CP027714.1\|AZD13332.1\|416169_416544_+\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD13337.1\|422034_422577_-\|Periplasmic-chorismate-mutase-I-precursor	unknown	unknown	gnl\|CDD\|236441
CP027714.1\|AZD13326.1\|412542_414072_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
CP027714.1\|AZD13325.1\|411119_412406_-\|Murein-hydrolase-activator-EnvC	unknown	unknown	gnl\|CDD\|227278

Protein	Function_ID	Function_description	E-value
CP027714.1\|AZD13333.1\|417349_418786_-\|Nitrogen-regulation-protein-NtrC	gnl\|CDD\|273818	TIGR01818, Nitrogen_assimilation_regulatory_protein, nitrogen regulation protein NR(I). This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	0
CP027714.1\|AZD13340.1\|426615_428070_+\|tRNA-4-thiouridine-synthase	gnl\|CDD\|234932	PRK01269, PRK01269, tRNA s(4)U8 sulfurtransferase; Provisional.	0
CP027714.1\|AZD13342.1\|430299_430740_-\|hypothetical-protein	gnl\|CDD\|308985	pfam03692, CxxCxxCC, Putative zinc- or iron-chelating domain. This family of proteins contains 8 conserved cysteines. It has in the past been annotated as being one of the complex of proteins of the flagellar Fli complex. However this was due to a mis-annotation of the original Salmonella LT2 Genbank entry of 'fliB'. With all its conserved cysteines it is possibly a domain that chelates iron or zinc ions.	1.14075e-07
CP027714.1\|AZD13331.1\|415649_416105_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	1.05147e-88
CP027714.1\|AZD13341.1\|428209_430030_+\|GTP-binding-protein-TypA/BipA	gnl\|CDD\|224138	COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms].	0
CP027714.1\|AZD13323.1\|408852_409611_-\|Putative-periplasmic-protein-YibQ	gnl\|CDD\|377404	pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).	1.10915e-91
CP027714.1\|AZD13336.1\|421430_421946_-\|hypothetical-protein	gnl\|CDD\|379230	pfam13511, DUF4124, Domain of unknown function (DUF4124). This presumed domain is found in a variety of bacterial proteins. It is found associated at the N-terminus associated with other domains such as the SLT domain and glutaredoxin domains in some proteins. The function of this domain is unknown, but it may have an Ig-like fold.	4.22647e-12
CP027714.1\|AZD13324.1\|409777_411088_-\|Carboxyl-terminal-protease	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	7.50762e-144
CP027714.1\|AZD13335.1\|420343_421459_+\|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase	gnl\|CDD\|225080	COG2169, Ada, Adenosine deaminase [Nucleotide transport and metabolism].	1.09302e-81
CP027714.1\|AZD13339.1\|424878_426285_-\|Glutamine-synthetase-type-I	gnl\|CDD\|181884	PRK09469, glnA, glutamate--ammonia ligase.	0
CP027714.1\|AZD13338.1\|422663_424703_-\|hypothetical-protein	gnl\|CDD\|225405	COG2849, COG2849, Uncharacterized protein conserved in bacteria [Function unknown].	3.31133e-10
CP027714.1\|AZD13328.1\|414638_414893_+\|Glutaredoxin-3-(Grx3)	gnl\|CDD\|274017	TIGR02181, GRX_bact, Glutaredoxin, GrxC family. Glutaredoxins are thioltransferases (disulfide reductases) which utilize glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system. Glutaredoxins utilize the CXXC motif common to thioredoxins and are involved in multiple cellular processes including protection from redox stress, reduction of critical enzymes such as ribonucleotide reductase and the generation of reduced sulfur for iron sulfur cluster formation. Glutaredoxins are capable of reduction of mixed disulfides of glutathione as well as the formation of glutathione mixed disulfides. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides. [Energy metabolism, Electron transport].	1.3131e-49
CP027714.1\|AZD13329.1\|414949_415432_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	2.23502e-83
CP027714.1\|AZD13327.1\|414223_414637_+\|Rhodanese-related-sulfurtransferase-YibN	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	8.17501e-24
CP027714.1\|AZD13334.1\|418782_419868_-\|Nitrogen-regulation-protein-NtrB	gnl\|CDD\|226370	COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms].	1.32606e-164
CP027714.1\|AZD13337.1\|422034_422577_-\|Periplasmic-chorismate-mutase-I-precursor	gnl\|CDD\|236441	PRK09269, PRK09269, chorismate mutase; Provisional.	9.49224e-61
CP027714.1\|AZD13326.1\|412542_414072_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
CP027714.1\|AZD13325.1\|411119_412406_-\|Murein-hydrolase-activator-EnvC	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	3.144e-101

>CP027714.1|AZD13332.1|416169_416544_+|hypothetical-protein
MLRVFGSLAIFGVMVGLMIGRLTTPDPTELQEVQVQPNALVVWFNNEPKVHGEHIDGAVALLFEAEGRAQKGQLKINDKDANWRVRAAEEGLLLNVVAARALHAEWSGSEVDGRWRLEIQLREE
>CP027714.1|AZD13331.1|415649_416105_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDASFAEGDAFLFGPESRGLPAEVLDALPAEQRLRLPMREGCRSLNLSNTVAVAVYEAWRQLGFK
>CP027714.1|AZD13330.1|415462_415585_-|hypothetical-protein
MLKTWRPPSEAIAAFGSGYRFGAGYRHQSRNLGPEHEKSA
>CP027714.1|AZD13329.1|414949_415432_+|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)
MTDQQNTAATEDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALEEGFHEVVLTLSVTVKNGDEVAFIAEVQQAGIFLIKNLDDASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQAAGEGTVQ
>CP027714.1|AZD13328.1|414638_414893_+|Glutaredoxin-3-(Grx3)
MATVVVYSSDYCPYCSRAKYLLENKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGSTHVGGCDDLFALERAGKLDALLAA
>CP027714.1|AZD13327.1|414223_414637_+|Rhodanese-related-sulfurtransferase-YibN
MVAHLIQFATEHYLLVGAFVILLALLIAHELSRGGRSLSTRELTALVNSEQGVVIDIRPTKDFAAGHIVGALNIPQDKLAARVGELEKHKAKTIILVDALGQHAGTHARELMKSGFTAAKLSGGVGSWKADNLPLVK
>CP027714.1|AZD13326.1|412542_414072_-|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MTTTPKPLVLMILDGFGHSESHESNAIYAAKKPVLDRLCASVPNGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVDKAVAADKAVHILGLLSDGGVHSHQDHLVAMAELAFKRGAEKIYLHAFLDGRDTPPKSATSSIELLDETFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGKGEFNAATAQEGLQAAYERGESDEFVKATTLGEPVKVEDGDAVVFMNFRADRARELSRVFVEDGFKEFERARQPKLAGFVMLTQYAASIPAPSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVDAIENQRYDVIVVNYANGDMVGHSGVFDAAVKAVECLDLCVGRIVDALEKVGGEALITADHGNVEQMSDASTGQAHTAHTSEPVPFIYVGKRDLKVREGGVLADVAPTMLKLLGLPQPAEMTGTSILV
>CP027714.1|AZD13325.1|411119_412406_-|Murein-hydrolase-activator-EnvC
MLRALITLALICLLQPAFADERAQTQQQLDATRQDIAELKKLLGKLQEEKSGVQKDLRGTETEMGKLEKQVDALQKELKKSESELQRLDEEKKKLQSARVEQQRLIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKNFNETLRQLANVEKEISLQQAQLLVQKSSLDTQREELDKVRKERQVALAKLNDDVKARGDKLKAREQDQADLGKVLKTIEETLARQAREAEEARQKALIAQQEAEKKRLREAQASADESPSKPPRATPGPLVSSAGASYGGPFASSRGKLPWPVDGRLLARFGESRGDDARTKWDGVMISASAGSQVHAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQTLLKEAGDIVKAGESISTVGSSGGQGAPALYFAIRQQGRPSDPAQWCRAQG
>CP027714.1|AZD13324.1|409777_411088_-|Carboxyl-terminal-protease
MLHLSRLTSLALTIALVIGAPLAFAAETAQSAAATTTKAPLPLEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEFGGLGIEVGAEDGIIKVVSPIDDTPASKAGIQAGDLIVKINGQPTRGQSMTEAVDKMRGKIGQKITLTLVRDGGAPFDVTLARATIQVKSVKSQLLESGYGYIRITQFQVKTGEEVSKALAKLRKDNGKKLNGIILDLRNNPGGVLQSAVEVVDHFITKGLIVYTKGRIANSELRFSATGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVLMGTTSFGKGSVQTVLPLNNDRALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITSEAQDNEYFKEADLQGHLGNGNGGADKPTASGSKPKPMPQDDDYQLAQALSLLKGLSITRSK
>CP027714.1|AZD13323.1|408852_409611_-|Putative-periplasmic-protein-YibQ
MIGLLCLLAFTSTQAAEPAPRKAYLSLIIDDLGQNLPRDRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKIVILHMPMDPATGPFAWHPELPIEELEKRLNAAFKAVPYTSGINNHMGSRMTSQPQAMAWLMGELQRHHKFFVDSRTSAKTVAAAEAQKIGLASVSRDVFLDDERTEAAIGTQLQTAINLARKQGSAVVIGHPYPQTLAVLERELPRLKAQGIDWIDIKLMISVRSNKAMAGHGKDGVYR
>CP027714.1|AZD13333.1|417349_418786_-|Nitrogen-regulation-protein-NtrC
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLARQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRANQHAQEQQGLEVIPALARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATHQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKLLKSETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNWEQALRQWADQALARGQSSLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTRKIKELGMKVDGGDDDDSDEG
>CP027714.1|AZD13334.1|418782_419868_-|Nitrogen-regulation-protein-NtrB
MTISDQLHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQRSHGQFISELFTESAEALSSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGDTLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELPDENLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMCNVHEVLERVSSLVEAESQGCITLVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRISLRTRTMRQFTIGHVRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECDSHPGHTTFSIFLPLEQGAPST
>CP027714.1|AZD13335.1|420343_421459_+|Methylphosphotriester-DNA--protein-cysteine-S-methyltransferase
MDNAPLLFQLPDDDTLYRALLERDPAYDGFAFVGVKSTGVFCRLTCAARKPKRENTVFFSSIKACVEAGFRACLRCRPLEQTGAQEPLVKQLLALLENNADKRWYEGDLIELGFDPSTVRRAFKRHFGVTFLEMARLRRIGEGMQQLAGGASVIDAQISASFDSDSGFRSAFTRLLGQPPSNLRGRELLKADWLQTPIGVMLAVADAQALHLLEFFDRPALATELKRLQEHTGSTIGFGRFAPIDQIESELRRFFAGESASFATPLALNASAFTRTVWQALRATPPGVTRSYAEVASGIGSASAVRAVARANGANQIAIVIACHRVIGSDGSLTGYGGGLWRKRWLLEHERRLYSQIQARQHLRVDEPVAG
>CP027714.1|AZD13336.1|421430_421946_-|hypothetical-protein
MRVHCLYLLLLAALPAAAQIYRYTDAHGNTAYSDQPPAGVSGQAVELAPLNRIEAPRPLTPPGVEPEQTPPSNAPTYTTLELSGVPNGGVIRANNGTFNIEVRLQPSLHNEHRLRLLLDDQPYGQPGNQPSLQLVNIDRGEHRLAVQVLDGERVIQQSPTLTFTLQRVHRP
>CP027714.1|AZD13337.1|422034_422577_-|Periplasmic-chorismate-mutase-I-precursor
MTSRFCLALLTLLLTGNACAAPATLGPLLASIEERLAIADQVALSKWDSHKPVEDRAREREVIAGAVAQAPAYKLDGAAVEQFFAAQIEANKLVQYAHLSEWTLQGQAPDAPRPDLVGQIRPQLDRLQKRLLQQLADFSPHRNDPQCPQWLAQATHEGDRAPLRQLALVRATAELCVFKG
>CP027714.1|AZD13338.1|422663_424703_-|hypothetical-protein
MQWTRSLGLIACLAFGSTQAAPFYADKSLAHPLITGLAESSATLAFIKQAGSVKGYYSVAPDESQPQLLDDFGDASIESVFNIALDNESLTRLVLFKQRGQYRLHAYRYDENDRLYRRLEKLQPALERIAKGHKKLDAPTVKQALRQLTPLNYSVFYEDSGFDEFNQIDHSAGILVGYFDQNGQPITANPPGTEQYSYKKTFAEKDGRFLTATYWRGEAPAPEGEPLLYSYRASRIAWETEPQRFTGSEDGPSVAYSNSGAVAAQGAYAKGRRTGEWGIAGPHNIWSQGRYIDGKRQGQWSLANESEGYFMTGEYRDDLREGRWAINLAESEIPENGGFVTYARDLRNGPSEVREGGVVVERGDYLDDLRQGPWLTREGTGNFDQGLRSGPWQLKAAEGHTHSVGFVADTMEGELRDTDAKGVLRVIEHYRGGILWGTQEGYNDAGQLMYSYNYENGQREGRSLIYSADGKVLLSDMSYHNGNKQGPYLTFLADGSPATVGRVEGSDFIGLMTQLDEHGQIFSATPRCRFESYRSEVQNCGMAREFRQGRVTSERDYLFGELQEYREYDAQTGRKTRERVIGADDKVSEITYYDNGQIDCQVNKVGFEWMIVNQQRLKNHGQAKLAGEQLCYHRNGAIKSRELIDNGLSACRIVYDESGKQLSSSPTGCGAPATAAAGQ
>CP027714.1|AZD13339.1|424878_426285_-|Glutamine-synthetase-type-I
MSKSVQLIKDHDVKWIDLRFTDTKGTQHHVTMPARDALDDDFFEIGKMFDGSSIAGWKGIEASDMILMPVDETAVLDPFTEEPTLILVCDIIEPSTMQGYDRDPRAIAKRAEEYLKSTGIGDTVFVGPEPEFFIFDEVKFKSDISGSMFKIFSEQGSWMSDQDVEGGNKGHRPGVKGGYFPVPPFDHDHEIRTSMCNAMEEMGLVIEVHHHEVATAGQNEIGVKFNTLVNKGDEVQTLKYCVHNVADAYGRTATFMPKPLYGDNGSGMHVHMSISKDGKNTFAGEGYAGLSDTALYFIGGIIKHGKALNGFTNPSTNSYKRLVPGFEAPVMLAYSARNRSASIRIPYVSSPKARRIEARFPDPAANPYLAFAALLMAGLDGIQNKIHPGDAADKNLYDLPPEEAKEIPQVCGSLKEALEELDKGRAFLTKGGVFSDDFIDAYIALKSEEEIKVRTFVHPLEYELYYSC
>CP027714.1|AZD13340.1|426615_428070_+|tRNA-4-thiouridine-synthase
MKLIVKVFPEITIKSRPVRTRFIRQLAKNIRAVLRDLDPAVVVNGVWDNLELETAVSEPKALKEMTERLSCMPGIAHFLQVDEYPLGDFDDIVAKCKQHFGEALAGKVFAVRCKRAGKHEFSSMDVEKYVGSQLRRQCGAAGISLKEPEIEVRMEIRDQRLFVIHSQHNSIGGYPLGALEQTLVLMSGGFDSTVAAYQIMRRGLMSHFCFFNLGGRAHELGVMEVAHYIWKKYGSSQRVLFVSVPFEEVLGEILGKVDNSHMGVILKRMMLRAASSIADRLHIDALVTGEAISQVSSQTLPNLSVIDCVTDKLVLRPLIASHKQDIIDLANEIGTADFAKHMPEYCGVISVNPKTHAKRHRVEHEEKEFDMAVLERAIERAKLVPIDRVIDELGQDLQIEEVSEALAGQIVIDIRHPDAQEDDPLTLSGIEIKALPFYALNARFKELDPTRQYLLYCDKGVMSRLHAHHLLSEGHANVRVYRPS
>CP027714.1|AZD13341.1|428209_430030_+|GTP-binding-protein-TypA/BipA
MIENLRNIAIIAHVDHGKTTLVDKLLRQSGTLERNELNDERVMDSNDQEKERGITILAKNTAINWNGYHINIVDTPGHADFGGEVERVMSMVDSVLLLVDAQDGPMPQTRFVTKKAFEAGLRPIVVINKVDRPGARPDWVLDQIFDLFDNLGATEEQLDFKVVYASALNGIAGLDHTDMAEDMTPLYQSIVDNVPAPAVDRDGPFQMQISALDYNSFLGVIGVGRIARGRVKPNTPVVAIDTEGKKRNGRILKLMGHHGLHRVDVEEAAAGDIVCISGFDELFISDTLCDPTAVEAMKPLTVDEPTVSMTFQVNDSPFCGKEGKFVTSRNIKERLDKELLYNVALRVEEGDSADKFKVSGRGELHLSVLIETMRREGFEMGVGRPEVIIREVDGVKQEPFENVTIDIPEESQGKVMEEMGLRKGDLSNMVPDGKGRVRLEYNIPARGLIGFRNQFLTLTNGAGILTSIFDRYAPMKSGHMSGRQNGVLVSVETGKALTYSLETLQARGKLFVEHGQEIYNGQIVGLNSRDNDLGVNPTKGKKLDNMRASGKDETIALVPPVRFTLEQALEFIQDDELCEVTPKSIRLRKKILDEGERTRAAKKAKN
>CP027714.1|AZD13342.1|430299_430740_-|hypothetical-protein
MKSNLIAAAEIDRLDTWAKYSAPMCGSCMSSCCTLPVEVKIKDLIRIGIVDEFERGEPAKNIAKRLQKEGIVERYNQKSEIFTLQRMSNNDCLYLDRKSRLCTIYDKRPDTCRNHPKIGPRPGYCAYKPKPVERPTNTSSRTLERF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP027714_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027714_2

4942180-4942275

Orphan

Consensus_repeat	Method
TAGTACTGGGAATTTTTCCCAGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027714_2

>merge|CP027714|2|4942180-4942275|CRISPRCasFinder
TAGTACTGGGAATTTTTCCCAGTCATCACCCCCTCATTGTCCGGTTGCGTCCGGTTGTTTTGCTGAAATGGTGTAGTACTGGGATTTTTTCCCAGT

>CP027714|2|2|4942180-4942275|CRISPRCasFinder
TAGTACTGGGAATTTTTCCCAGT	CATCACCCCCTCATTGTCCGGTTGCGTCCGGTTGTTTTGCTGAAATGGTG
TAGTACTGGGATTTTTTCCCAGT

Protein	Signature genes	Signature genes Name	Protein_function
CP027714.1\|AZD17380.1\|4940471_4940969_-\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17389.1\|4948872_4949007_-\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17388.1\|4946518_4947751_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274955
CP027714.1\|AZD17392.1\|4949651_4950485_+\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17378.1\|4938826_4938994_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187712
CP027714.1\|AZD17384.1\|4942624_4943137_-\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17391.1\|4949442_4949655_+\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17377.1\|4936778_4937900_+\|Aminotransferase,-DegT/DnrJ/EryC1/StrS-family	unknown	unknown	gnl\|CDD\|99740
CP027714.1\|AZD17386.1\|4944046_4945525_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224117
CP027714.1\|AZD17393.1\|4950537_4950900_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236238
CP027714.1\|AZD17385.1\|4943133_4943436_-\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17390.1\|4949024_4949456_+\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17374.1\|4933808_4934741_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368580
CP027714.1\|AZD17381.1\|4941210_4941330_+\|excisionase,-putative	unknown	unknown	gnl\|CDD\|378935
CP027714.1\|AZD17382.1\|4941445_4941682_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379462
CP027714.1\|AZD17387.1\|4945801_4945975_-\|hypothetical-protein	unknown	unknown	unknown
CP027714.1\|AZD17379.1\|4939206_4940475_+\|site-specific-recombinase,-phage-integrase-family	unknown	unknown	gnl\|CDD\|271177
CP027714.1\|AZD17375.1\|4934818_4936387_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368006
CP027714.1\|AZD17376.1\|4936383_4936782_+\|dTDP-6-deoxy-3,4-keto-hexulose-isomerase	unknown	unknown	gnl\|CDD\|377522
CP027714.1\|AZD17383.1\|4941743_4942148_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP027714.1\|AZD17393.1\|4950537_4950900_+\|hypothetical-protein	gnl\|CDD\|236238	PRK08320, PRK08320, branched-chain amino acid aminotransferase; Reviewed.	0.00309907
CP027714.1\|AZD17377.1\|4936778_4937900_+\|Aminotransferase,-DegT/DnrJ/EryC1/StrS-family	gnl\|CDD\|99740	cd00616, AHBA_syn, 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The members of this CD are involved in various biosynthetic pathways for secondary metabolites. Some well studied proteins in this CD are AHBA_synthase, protein product of pleiotropic regulatory gene degT, Arnb aminotransferase and pilin glycosylation protein. The prototype of this family, the AHBA_synthase, is a dimeric PLP dependent enzyme. AHBA_syn is the terminal enzyme of 3-amino-5-hydroxybenzoic acid (AHBA) formation which is involved in the biosynthesis of ansamycin antibiotics, including rifamycin B. Some members of this CD are involved in 4-amino-6-deoxy-monosaccharide D-perosamine synthesis. Perosamine is an important element in the glycosylation of several cell products, such as antibiotics and lipopolysaccharides of gram-positive and gram-negative bacteria. The pilin glycosylation protein encoded by gene pglA, is a galactosyltransferase involved in pilin glycosylation. Additionally, this CD consists of ArnB (PmrH) aminotransferase, a 4-amino-4-deoxy-L-arabinose lipopolysaccharide-modifying enzyme. This CD also consists of several predicted pyridoxal phosphate-dependent enzymes apparently involved in regulation of cell wall biogenesis. The catalytic lysine which is present in all characterized PLP dependent enzymes is replaced by histidine in some members of this CD.	1.43826e-129
CP027714.1\|AZD17374.1\|4933808_4934741_+\|hypothetical-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	6.25646e-06
CP027714.1\|AZD17379.1\|4939206_4940475_+\|site-specific-recombinase,-phage-integrase-family	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	7.08208e-38
CP027714.1\|AZD17378.1\|4938826_4938994_-\|hypothetical-protein	gnl\|CDD\|187712	cd08369, FMT_core, Formyltransferase, catalytic core domain. Formyltransferase, catalytic core domain. The proteins of this superfamily contain a formyltransferase domain that hydrolyzes the removal of a formyl group from its substrate as part of a multistep transfer mechanism, and this alignment model represents the catalytic core of the formyltransferase domain. This family includes the following known members; Glycinamide Ribonucleotide Transformylase (GART), Formyl-FH4 Hydrolase, Methionyl-tRNA Formyltransferase, ArnA, and 10-Formyltetrahydrofolate Dehydrogenase (FDH). Glycinamide Ribonucleotide Transformylase (GART) catalyzes the third step in de novo purine biosynthesis, the transfer of a formyl group to 5'-phosphoribosylglycinamide. Formyl-FH4 Hydrolase catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to FH4 and formate. Methionyl-tRNA Formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA, which plays important role in translation initiation. ArnA is required for the modification of lipid A with 4-amino-4-deoxy-l-arabinose (Ara4N) that leads to resistance to cationic antimicrobial peptides (CAMPs) and clinical antimicrobials such as polymyxin. 10-formyltetrahydrofolate dehydrogenase (FDH) catalyzes the conversion of 10-formyltetrahydrofolate, a precursor for nucleotide biosynthesis, to tetrahydrofolate. Members of this family are multidomain proteins. The formyltransferase domain is located at the N-terminus of FDH, Methionyl-tRNA Formyltransferase and ArnA, and at the C-terminus of Formyl-FH4 Hydrolase. Prokaryotic Glycinamide Ribonucleotide Transformylase (GART) is a single domain protein while eukaryotic GART is a trifunctional protein that catalyzes the second, third and fifth steps in de novo purine biosynthesis.	0.0001833
CP027714.1\|AZD17375.1\|4934818_4936387_+\|hypothetical-protein	gnl\|CDD\|368006	pfam04577, DUF563, Protein of unknown function (DUF563). Family of uncharacterized proteins.	2.17489e-28
CP027714.1\|AZD17386.1\|4944046_4945525_+\|hypothetical-protein	gnl\|CDD\|224117	COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning].	1.00911e-05
CP027714.1\|AZD17381.1\|4941210_4941330_+\|excisionase,-putative	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	0.00517789
CP027714.1\|AZD17376.1\|4936383_4936782_+\|dTDP-6-deoxy-3,4-keto-hexulose-isomerase	gnl\|CDD\|377522	pfam05523, FdtA, WxcM-like, C-terminal. This family includes FdtA from Aneurinibacillus thermoaerophilus, which has been characterized as a dtdp-6-deoxy-3,4-keto-hexulose isomerase. It also includes WxcM from Xanthomonas campestris (pv. campestris).	4.054e-65
CP027714.1\|AZD17388.1\|4946518_4947751_+\|hypothetical-protein	gnl\|CDD\|274955	TIGR04064, rSAM_nif11, nif11-like peptide radical SAM maturase. Members of this family are radical SAM enzymes that occur co-clustered with nif11-related ribosomal natural product (RNP) precursors described by TIGRFAMs model TIGR03798. Homology within the bacteriocin family reflects largely constraints on the leader peptide, tied to processes such as cleavage and export, and members associate with various families of maturation enzyme. The gene symbol assigned is nlpM, for Nif11-class Leader Peptide family Radical SAM Maturase. [Cellular processes, Toxin production and resistance].	3.11945e-37
CP027714.1\|AZD17382.1\|4941445_4941682_+\|hypothetical-protein	gnl\|CDD\|379462	pfam14090, HTH_39, Helix-turn-helix domain. This helix-turn-helix domain is often found in phage proteins and is likely to be DNA-binding.	1.53537e-18

>CP027714.1|AZD17383.1|4941743_4942148_+|hypothetical-protein
MARKTKYKVDFGGGRVLALPYRLLISDAFDNLSTKAVTVLIKLARNYNGRNNGDLSCTASMMAKGKPMDAKTLASALAELMAAGLIVRTRESRKGGREQGMARCALYAITWAAIDECPGKDLEISPGPPRFRFI
>CP027714.1|AZD17382.1|4941445_4941682_+|hypothetical-protein
MTRHSSTEQDRKMIEALRNGPISSVEAAQTLDIVQPPSTIRRLRKKGYEIRTYWTHQSTEPGRPPHRVAKYILMREAS
>CP027714.1|AZD17381.1|4941210_4941330_+|excisionase,-putative
MYELIAKGEIKTFKLGRRRLILMTELKVWIERAAKEGAR
>CP027714.1|AZD17380.1|4940471_4940969_-|hypothetical-protein
MAKNKPSQGARKTETLTLRLDPKVKFMIEVISRIKRQSITGVVEAAIEDLVFDLDVPFHDGGNTEVWSVSNALTEVWSTDESERFINLCYHLPNLLTYEEQRIWETIKASPVFLDKGAAKIGTHWQIEGVGHLDRGYIRMFWSNLLEHVEANKESRTIVPFEPPF
>CP027714.1|AZD17379.1|4939206_4940475_+|site-specific-recombinase,-phage-integrase-family
MKTDRYSDFCCHPAVTVNPLKTKITQKLIGGLAAEAKAYRVHDTVQPGFFIRVLPSGHKSYMVTWGRNKNATLGRVGVLTLDQARTEAAQYLADAHAHGEPLAVTQGRKGSALPSLREFIDDTYMPWFETHHKGHQKTRHTLNNNFEAIMSQRLDAITGRDLDQIRTGWMQSGNKPSTVNRKMGSISGVFSRAVEWEYIDAHPLERLKALKVDSMGLVRYLDADETKRLREALDARQDEARAERETANKWRADRRKELMPSLLQVPFTDHLKPLVLVSLNTGMRRGELFDLKWSAVNFQTKTITAAGATTKTSDTRHIPMNKETVGVLEDWKKQAGKSRYVFPSQEGGRLEDVKSAWLKLLERANIEGFRWHDMRHDFASRLVMAGVPLNTVRDLLGHADIKMTLRYAHLAPGTKAAAVELI
>CP027714.1|AZD17378.1|4938826_4938994_-|hypothetical-protein
MIVIAGKNNILVFGLERALRQFSPDEIAVVCNRNDTGVDGWQRSLRAAAQKVWRA
>CP027714.1|AZD17377.1|4936778_4937900_+|Aminotransferase,-DegT/DnrJ/EryC1/StrS-family
MTQMMNIPFLDLKGINHEYADQLKAACSRVIDSGWYLMGRELEQFEAAFADYCGSRHAIGVANGLDALTLILRAWKEQGRLQAGDEVIVQSNTFIATISAILENDLAPILVDVDPATHNLEIEAVERAISEKTRVILPVHLYGQLSPMPQIMALAHKHGLLVLEDAAQAHGAELVGCKAGNWGDAAAFSFYPGKNLGALGDGGAITTNDAELATLVRALGNYGSRVKYQHDHQGVNSRLDEIQAAMLGVKLAHLDSDTARRRSIARYYGEHIRHPGITLPSVTTASAHVWHLYVITCPWRDQLKAHLAEHGIQCLVHYPLAITEQRAYRDLARTSQASRAPLHDSILSLPIYPTLGQEQQQHIVTAINQFTAH
>CP027714.1|AZD17376.1|4936383_4936782_+|dTDP-6-deoxy-3,4-keto-hexulose-isomerase
MKIHILPLQTHGDDRGSLIALEEGKNIPFPVKRVYYMFNTGEGVRRGYHAHKTLKQVAIAVRGSCRFLLDDGREKIDITLDNPCQGLLIESFIWREMYDFSPDCVLMVLADQLYEEGDYVRDYAQFMDMVGQ
>CP027714.1|AZD17375.1|4934818_4936387_+|hypothetical-protein
MSTGFGQKARVLIFGTGAGGINFYKYNRRRYRVIGFVDNNQQKQGQHLFGKLIHAPQQLSALVFDKIIIASDYYSEIYPQLTDKLAIDEQRIEVFHGAQISSQLSWFQHIGKRLEQRGYERMCKQPGLISDLLYRLFFRRQDTRRLALRWLDESAEHKVHVFRRSQPGSSQPPRFVHQSTPAITLELPEVALYHFRQGQVCSVSRSVILPNGQLVLERVPTAKSSQADYSAAHLLYHGQRLALVRTGKPIELEKGLLISGCNEQNYYHWTVEVLSQLQFVAELPPQYADYPLLISKNSQNIPSIKALIEAIGVDRPLVLLDNITSYQVADLLLISAPNNMIPNFKGVAQNSASSGFARPESINFLREKALRLAHGIPTGELPKRVFLARKGFLRHYNQAEILKLLEPYGFTCVYMEEQDISHQVAIMANAEVIVGPTGAAWTNLIFASKNARALCWMAEEYGQLSCFSNLAAIVGVEMDYIAYRVGSTDSRELYYRNYRVDAKRVENWLQQHLSKRLEGETR
>CP027714.1|AZD17374.1|4933808_4934741_+|hypothetical-protein
MQTCIQNLIDQGAHIFGEILDADRTQALYREMIAARAFGAGLFMDEAEYLAQENHLNANPNKTFNFLNGFESQLQFIEQDPRLTAVLDEVLGADYEVVIKKAVCGVPDSWLPDWVREKIRDVNVANLGPYIKKPFRDITYFRGIDFHQDIIDWPQGRVELDPSTFLTLYVYLHDVTENDSPLHLMPGTHRFGATLFPHRLEHQEHDRWTYADDHGQQMTCQDYRLTGGPGYVGLWHNCTLHGTRPVANESEQFRLSLRYLLGKSRGNTGKTAIDTINGAIQGELQPVRTRRDLNAKGIAQIKGNIINNNG
>CP027714.1|AZD17384.1|4942624_4943137_-|hypothetical-protein
MIRSYKEIADTGLDDLYEVQKAFDNVHAIFTLMLQHFPEDSTGNAFAQLGVLEVNDWSTKVFQWCERMENELDDVDAEMQKAVQLPHHQLDLRSNDVAEAISVERKHATRWWTHLNEMRRRKELPGWVAADIGTHDEHDLLLESRKAVNQALFGSLDLGGDQPNRVIQLG
>CP027714.1|AZD17385.1|4943133_4943436_-|hypothetical-protein
MQPHQRTSNTLKNQDKAGTTAGKLGEIAKEAMFQMACDKEHIQWLGALMRAIQDNAKHRGSGDVLKLATLGQYLADTQISLAEEREADLESKIADLETAQ
>CP027714.1|AZD17386.1|4944046_4945525_+|hypothetical-protein
MALLGVDQKAFDTLRSEVEQKLETLRQEIRTKATDSEETASKAAKNSKAIEEQILATKTNIDTALTELTACNNEAKAELAKTQKTRALIENDKALTEAIVTSNKAALTELLSTKEQAETQASEVTTSYAVIKAALTESQKLPEQVEAIKTLLADSKILSESMDSLLNHSMKRKTEIDELHKEILGSEIKGSDGTTARTDGLVDELKTSYDGIANQAVELNETIQNLVTSITEKHEIQLKKETNEFEELVLESKNRISAIDEQLTGLLPGAMAEGLSAAYEKKKDDEIVSQKKYETSFAIAIGLMVSVSLIPFFVDIYLLGWKGSDLVQVIKDTPSLIISILPLYFPVLWFAYSSNKKLNLSKRLIEEYTHKAVLGKTFSGLSNQIESLPRDNLVRDELRTRLLFNLLQVSSENPGKLITDYNKSDHPLMDALENSAKLSDSMEALSKIPGFSAISKKLGETAERILKAENQKVENGLAVQQAIEEPTAKAGV
>CP027714.1|AZD17387.1|4945801_4945975_-|hypothetical-protein
MLTHWIFVMFIGGQPVMTEQKASEADCNRTLVRVVTAARAQGKDAIGACYLRATSDA
>CP027714.1|AZD17388.1|4946518_4947751_+|hypothetical-protein
MPTFKSLGASKIYAGLNEHVEFVSQKTQTAALGLLVLHISEGCNLGCTYCFADRGHYGAESAKWMTAEIAERAIDFSYKQYGGLKAIKFFGGEPLLRTDVVISSSYYATKKSEQLGCAPPAFVAISNLTRYDESVRHWIKEFNPSITASIDGPQSIHDAFRIYPNGNGSFDIVDTNIKRMLEETGQPNALECVYSPLHFEQGYSMVDTHKLLINRYGIKNIILHPIQGNKGCEKLDPRSRERYREAIYDLSVEYGSYLMLEALKSSDRDNANQQLMKIISGGKVSDAHCGLGIHTITIKANGEVSPCYTLIGNDEFSMGHIESSSNPNFSKVEKTLIDNKKSTNPVCSKCSILETCHSCPGDMLISNGKINSPVELTCNYLTGVTEGRILGLDEFRANSGWSDLLSTLKQ
>CP027714.1|AZD17389.1|4948872_4949007_-|hypothetical-protein
MCSELLNGFLKFSDLDYPGDSSQTFNERLALIGRELTAGNGAHD
>CP027714.1|AZD17390.1|4949024_4949456_+|hypothetical-protein
MSIKSLKAELQRIAQKIGAADETVLLIVLAVIRANTREIQTEEDFPKTAGHQVDYRIQGRNVSLFFPFAGMDSDQGEQMAKAIILHTRQIERAGRTAQVGILDMRAAPDEGAWIVTWPPEGVTIEQHAAEQYQRIVEARNEHP
>CP027714.1|AZD17391.1|4949442_4949655_+|hypothetical-protein
MNIRNQIARLKQTAGSSQFSNDVRHISELMDELSAAAVGGGGVAREVSLLEIFEAPIAPNQYPHIPKEAQ
>CP027714.1|AZD17392.1|4949651_4950485_+|hypothetical-protein
MKIGKRSVLKVGLANLHYSEYEHSRIEAQTFSIQRPDGTKGTWQAGGLMKSARQLQLLALETFKDAGEDIASIRSNKDFNASAIERMSKEKIEGVTAALLPAMQSVAKDMLTLAETVTQGFSPVTPRANSDIAGFLADQELRSLVRGLSPEDRRNLMLEARQGGHPDIVEAVLRANPMLSGLNSESAASLARAGIAASRADDIEALRQMLAVYDDVLATTSQVGVALSGMVANSAGYAGRFEKWRSGCDGSEALRAWLDKIPTRVKPKAAAEESEAA
>CP027714.1|AZD17393.1|4950537_4950900_+|hypothetical-protein
MTTYQERFAEACKTNRFASHPLKQGPDSGYVVWDVQHVRDGQKVTIDGPFFTEEEARVSADLLRGTFRGARAYQGIYDRIWNYDPRHEQVTVDQAHMSRSLLAIRLGVEVPNNSAQGAKE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1311470 : 1400761

Pseudomonas_phage(43.14%)

protease,tail,plate,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD14126.1\|1311470_1312823_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD14127.1\|1312897_1315285_+	Outer membrane protein assembly factor YaeT	NA	NA	NA	NA
AZD14128.1\|1315330_1315834_+	Outer membrane chaperone Skp, precursor	NA	NA	NA	NA
AZD14129.1\|1315837_1316893_+	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	NA	NA	NA	NA
AZD14130.1\|1317002_1317443_+	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZD14131.1\|1317439_1318216_+	Acyl-ADP--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZD14132.1\|1318218_1319349_+	Lipid-A-disaccharide synthase	NA	NA	NA	NA
AZD14133.1\|1319360_1319993_+	Ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.7e-27	38.9
AZD14134.1\|1320063_1323588_+	DNA polymerase III alpha subunit	A0A2L1IZ23	Streptomyces_phage	1.8e-195	38.1
AZD14135.1\|1323728_1324676_+	Acetyl-coenzyme A carboxyl transferase alpha chain	NA	NA	NA	NA
AZD14136.1\|1324795_1326124_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZD14137.1\|1326169_1326313_+	hypothetical protein	NA	NA	NA	NA
AZD14138.1\|1326398_1328030_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.9e-158	53.5
AZD14139.1\|1328035_1328881_+	2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-49	42.8
AZD14140.1\|1329038_1330328_+	Enolase	A0A1X9I5Z8	Streptococcus_phage	9.0e-137	59.2
AZD14141.1\|1330500_1330779_+	Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage	NA	NA	NA	NA
AZD14142.1\|1330775_1331483_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZD14143.1\|1331642_1332539_-	Transcriptional regulator, LysR family, in formaldehyde detoxification operon	NA	NA	NA	NA
AZD14144.1\|1332645_1333758_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	8.3e-30	27.2
AZD14145.1\|1333847_1334693_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AZD14146.1\|1334745_1335219_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AZD14147.1\|1335215_1336274_+\|tRNA	tRNA pseudouridine(13) synthase	NA	NA	NA	NA
AZD14148.1\|1336261_1337011_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.2e-68	52.2
AZD14149.1\|1337010_1337688_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.8e-43	52.0
AZD14150.1\|1337897_1338731_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	6.3e-06	33.3
AZD14151.1\|1338837_1339842_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZD14152.1\|1340342_1340666_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZD14153.1\|1340808_1343388_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	3.1e-27	23.5
AZD14154.1\|1343584_1344310_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	2.0e-125	91.4
AZD14155.1\|1344840_1345188_+	Holin	B5TK61	Pseudomonas_phage	7.7e-51	87.7
AZD14156.1\|1345371_1346136_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	8.9e-07	26.3
AZD14157.1\|1346370_1346895_+	hypothetical protein	NA	NA	NA	NA
AZD14158.1\|1346898_1347507_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	6.3e-48	60.4
AZD14159.1\|1347520_1347853_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	4.7e-37	68.2
AZD14160.1\|1347849_1348845_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	1.8e-108	63.2
AZD14161.1\|1348841_1349477_+	Tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	2.1e-46	53.3
AZD14162.1\|1349477_1351958_+\|tail	Prophage long tail fiber protein	A0A077K818	Ralstonia_phage	1.1e-85	38.1
AZD14163.1\|1352493_1352715_+	hypothetical protein	NA	NA	NA	NA
AZD14164.1\|1352717_1353884_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	5.0e-126	57.7
AZD14165.1\|1353883_1354390_+	hypothetical protein	Q6R4W3	Vibrio_virus	4.8e-25	36.3
AZD14166.1\|1354517_1355099_+	hypothetical protein	B0ZSH0	Halomonas_phage	9.1e-28	39.4
AZD14167.1\|1355095_1355221_+	hypothetical protein	NA	NA	NA	NA
AZD14168.1\|1355227_1357489_+	Phage protein	A0A2H4JAA5	uncultured_Caudovirales_phage	4.8e-08	40.5
AZD14169.1\|1357488_1357872_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	4.7e-33	53.5
AZD14170.1\|1357864_1358077_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	2.3e-21	70.0
AZD14171.1\|1358086_1359106_+\|tail	Phage tail protein D	A0A2H4JH05	uncultured_Caudovirales_phage	4.2e-105	57.1
AZD14172.1\|1359284_1359869_+	hypothetical protein	B5TK65	Pseudomonas_phage	4.5e-75	71.5
AZD14173.1\|1359865_1360048_+	Mu-like prophage FluMu protein GP38	B5TK66	Pseudomonas_phage	1.4e-24	91.7
AZD14174.1\|1360047_1361544_+\|tail	Bacteriophage tail sheath protein	B5TK67	Pseudomonas_phage	2.5e-255	90.2
AZD14175.1\|1361610_1361958_+\|tail	Phage tail tube protein	B5TK68	Pseudomonas_phage	2.9e-58	93.9
AZD14176.1\|1361954_1362251_+\|tail	Phage small tail protein E	B5TK69	Pseudomonas_phage	2.3e-43	94.9
AZD14177.1\|1362381_1364211_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	2.1e-46	54.0
AZD14178.1\|1364197_1365436_+\|tail	Phage tail/DNA circulation protein	B5TK71	Pseudomonas_phage	5.7e-181	75.7
AZD14179.1\|1365439_1366480_+\|tail	Prophage tail protein	B5TK72	Pseudomonas_phage	1.5e-161	82.6
AZD14180.1\|1366591_1367101_+\|plate	Prophage baseplate assembly protein V	B5TK73	Pseudomonas_phage	2.9e-78	88.2
AZD14181.1\|1367100_1367499_+	Bacteriophage protein GP46	B5TK74	Pseudomonas_phage	1.7e-65	89.4
AZD14182.1\|1367488_1368529_+	Phage FluMu protein gp47	B5TK75	Pseudomonas_phage	2.3e-167	87.3
AZD14183.1\|1368516_1369116_+\|tail	Prophage tail protein	B5TK76	Pseudomonas_phage	1.5e-105	92.0
AZD14184.1\|1369127_1369982_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	1.5e-23	76.4
AZD14185.1\|1369986_1370628_+\|tail	putative tail fiber assembly-like protein	B5TK78	Pseudomonas_phage	8.2e-38	58.4
AZD14186.1\|1370737_1371658_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	1.3e-23	78.3
AZD14187.1\|1371657_1372149_+	hypothetical protein	NA	NA	NA	NA
AZD14188.1\|1372315_1373236_+\|tail	Prophage tail fiber protein	B5TK81	Pseudomonas_phage	3.4e-37	38.7
AZD14189.1\|1373238_1373724_+	Phage protein	Q9ZXK5	Pseudomonas_virus	1.3e-19	45.5
AZD14190.1\|1373796_1374537_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	3.3e-22	67.1
AZD14191.1\|1374539_1374971_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	9.4e-22	37.0
AZD14192.1\|1375016_1375580_+	Lytic enzyme	B5TK83	Pseudomonas_phage	3.2e-86	82.8
AZD14193.1\|1375561_1376098_+	hypothetical protein	B5TK84	Pseudomonas_phage	4.0e-62	73.0
AZD14194.1\|1376180_1376681_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	4.7e-73	86.7
AZD14195.1\|1376764_1377817_+	RecA protein	A0A0S2MVG1	Bacillus_phage	4.4e-113	60.9
AZD14196.1\|1377825_1378293_+	Regulatory protein RecX	NA	NA	NA	NA
AZD14197.1\|1378338_1379454_-	Decarboxylase family protein	NA	NA	NA	NA
AZD14198.1\|1379849_1379978_-	hypothetical protein	NA	NA	NA	NA
AZD14199.1\|1379987_1380128_-	hypothetical protein	NA	NA	NA	NA
AZD14200.1\|1380132_1380555_-	Putative NADPH-quinone reductase (modulator of drug activity B)	NA	NA	NA	NA
AZD14201.1\|1380744_1381455_+	putative conserved protein YfiP, contains DTW domain	NA	NA	NA	NA
AZD14202.1\|1381787_1382438_+	Transcriptional regulator, LuxR family	NA	NA	NA	NA
AZD14203.1\|1382513_1382876_+	Diacylglycerol kinase	NA	NA	NA	NA
AZD14204.1\|1382872_1383799_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZD14205.1\|1383934_1384714_+	Ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZD14206.1\|1384786_1385482_-	S-adenosylmethionine-dependent methyltransferase YaeB	NA	NA	NA	NA
AZD14207.1\|1385544_1386006_-	Uncharacterized protein YehS	Q9EYF4	Enterobacteria_phage	2.5e-36	50.7
AZD14208.1\|1386073_1386784_-	Ribosomal large subunit pseudouridine synthase F	NA	NA	NA	NA
AZD14209.1\|1386866_1387340_-	Acetyltransferase	NA	NA	NA	NA
AZD14210.1\|1387446_1388784_-	Ribosomal protein S12p Asp88 methylthiotransferase	NA	NA	NA	NA
AZD14211.1\|1388884_1389154_-	hypothetical protein	NA	NA	NA	NA
AZD14212.1\|1389175_1391017_+	Kup system potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.4e-77	35.0
AZD14213.1\|1391218_1391494_-	hypothetical protein	NA	NA	NA	NA
AZD14214.1\|1392069_1393365_-	Alanylphosphatidylglycerol hydrolase, periplasmic	NA	NA	NA	NA
AZD14215.1\|1393364_1396013_-	Alanylphosphatidylglycerol synthase	NA	NA	NA	NA
AZD14216.1\|1396932_1397994_+	DNA polymerase IV	NA	NA	NA	NA
AZD14217.1\|1398074_1399028_-	putative lipoprotein	NA	NA	NA	NA
AZD14218.1\|1399045_1400761_-\|tRNA	Prolyl-tRNA synthetase, bacterial type	NA	NA	NA	NA

DBSCAN-SWA_2

4139226 : 4145455

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD16692.1\|4139226_4139619_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	8.7e-59	84.6
AZD16693.1\|4139622_4139985_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.1e-43	72.5
AZD16694.1\|4139984_4140284_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.2e-30	69.7
AZD16695.1\|4140280_4140616_+\|tRNA	tRNA 2-thiouridine synthesis protein TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	4.2e-46	81.1
AZD16696.1\|4140612_4141614_+	Anthranilate phosphoribosyltransferase like	A0A2H4JBY5	uncultured_Caudovirales_phage	2.7e-165	84.7
AZD16697.1\|4141702_4142704_+	Glutathione S-transferase, omega	NA	NA	NA	NA
AZD16698.1\|4142779_4144174_-	Precorrin-2 oxidase	NA	NA	NA	NA
AZD16699.1\|4144174_4145455_-\|tRNA	Seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.1e-101	55.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP027714

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection