CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027745	Pseudomonas chlororaphis subsp. aurantiaca strain K27 chromosome, complete genome	1 crisprs	DEDDh,DinG,csa3,cas3,PD-DExK,WYL	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027745_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027745_1

3048789-3048871

Orphan

Consensus_repeat	Method
ACCGCAGCAACGGATATGTACAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027745_1

>merge|CP027745|1|3048789-3048871|CRISPRCasFinder
ACCGCAGCAACGGATATGTACACCCACTTCGCCGTACGAACAAAACCGTCAACGGCCATGACCGCAGCAACGGATATGCACAC

>CP027745|1|1|3048789-3048871|CRISPRCasFinder
ACCGCAGCAACGGATATGTACAC	CCACTTCGCCGTACGAACAAAACCGTCAACGGCCATG
ACCGCAGCAACGGATATGCACAC

Protein	Signature genes	Signature genes Name	Protein_function
CP027745.1\|AZD60686.1\|3042709_3043693_+\|General-secretion-pathway-protein-K	unknown	unknown	gnl\|CDD\|377165
CP027745.1\|AZD60683.1\|3041220_3041511_+\|General-secretion-pathway-protein-C	unknown	unknown	gnl\|CDD\|378647
CP027745.1\|AZD60695.1\|3064263_3065907_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|372178
CP027745.1\|AZD60697.1\|3066413_3067049_+\|hypothetical-protein	unknown	unknown	unknown
CP027745.1\|AZD60690.1\|3052143_3053310_+\|Phosphate-ABC-transporter,-periplasmic-phosphate-binding-protein-PstS	unknown	unknown	gnl\|CDD\|270283
CP027745.1\|AZD60691.1\|3053522_3053927_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	unknown	unknown	unknown
CP027745.1\|AZD60694.1\|3062723_3064079_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	unknown	unknown	unknown
CP027745.1\|AZD60682.1\|3040510_3040972_-\|General-secretion-pathway-protein-H	unknown	unknown	gnl\|CDD\|130769
CP027745.1\|AZD60696.1\|3065900_3066206_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	unknown	unknown	unknown
CP027745.1\|AZD60684.1\|3041645_3041993_-\|General-secretion-pathway-protein-I	unknown	unknown	gnl\|CDD\|376798
CP027745.1\|AZD60689.1\|3050319_3051531_+\|General-secretion-pathway-protein-F	unknown	unknown	gnl\|CDD\|273980
CP027745.1\|AZD60687.1\|3043689_3044883_+\|General-secretion-pathway-protein-L	unknown	unknown	gnl\|CDD\|273768
CP027745.1\|AZD60688.1\|3044875_3045442_+\|General-secretion-pathway-protein-M	unknown	unknown	gnl\|CDD\|377391
CP027745.1\|AZD60679.1\|3038072_3038618_+\|Extracytoplasmic-function-(ECF)-sigma-factor-VreI	unknown	unknown	gnl\|CDD\|224511
CP027745.1\|AZD60693.1\|3054183_3062727_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273865
CP027745.1\|AZD60692.1\|3053929_3054184_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	unknown	unknown	gnl\|CDD\|273865
CP027745.1\|AZD60685.1\|3042222_3042672_+\|General-secretion-pathway-protein-G	unknown	unknown	gnl\|CDD\|130771
CP027745.1\|AZD60698.1\|3067235_3067553_-\|hypothetical-protein	unknown	unknown	unknown
CP027745.1\|AZD60681.1\|3039890_3040514_-\|General-secretion-pathway-protein-J	unknown	unknown	gnl\|CDD\|227132
CP027745.1\|AZD60680.1\|3038657_3039608_+\|Sigma-factor-regulator-VreR-(cytoplasmic-membrane-localized)-of-trans-envelope-signaling-system	unknown	unknown	gnl\|CDD\|226235

Protein	Function_ID	Function_description	E-value
CP027745.1\|AZD60686.1\|3042709_3043693_+\|General-secretion-pathway-protein-K	gnl\|CDD\|377165	pfam03934, T2SSK, Type II secretion system (T2SS), protein K. Members of this family are involved in the Type II protein secretion system. The T2SK family includes proteins such as ExeK, PulK, OutX and XcpX.	3.08782e-61
CP027745.1\|AZD60683.1\|3041220_3041511_+\|General-secretion-pathway-protein-C	gnl\|CDD\|378647	pfam11356, T2SSC, Type II secretion system protein C. This is the greater N-terminal region of GspC-type proteins. GspC proteins form part of the sophisticated transport mechanism of Gram-negative pathogens for injecting divers proteins into their hosts, a type-II secretion system - T2SS. The region is made up of a short N-terminal cytoplasmic domain that is followed by the single transmembrane helix, a Pro-rich linker, and the so-called homology region domain in the periplasm. This inner membrane GspC interacts with the outer membrane secretin GspD via periplasmic domains, an interaction which is critical for the effectiveness of type II secretion.	1.16587e-07
CP027745.1\|AZD60695.1\|3064263_3065907_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	gnl\|CDD\|372178	pfam12545, DUF3739, Filamentous haemagglutinin family outer membrane protein. This domain family is found in bacteria, and is approximately 110 amino acids in length. The family is found in association with pfam05860.	8.78168e-14
CP027745.1\|AZD60690.1\|3052143_3053310_+\|Phosphate-ABC-transporter,-periplasmic-phosphate-binding-protein-PstS	gnl\|CDD\|270283	cd13565, PBP2_PstS, Substrate binding domain of ABC-type phosphate transporter, a member of the type 2 periplasmic-binding fold superfamily. This subfamily contians phosphate binding domain found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBPII superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.13942e-49
CP027745.1\|AZD60682.1\|3040510_3040972_-\|General-secretion-pathway-protein-H	gnl\|CDD\|130769	TIGR01708, Type_II_secretion_system_protein_H, type II secretion system protein H. This model represents GspH, protein H of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	1.0698e-25
CP027745.1\|AZD60684.1\|3041645_3041993_-\|General-secretion-pathway-protein-I	gnl\|CDD\|376798	pfam02501, T2SSI, Type II secretion system (T2SS), protein I. The Type II secretion system, also called Secretion-dependent pathway (SDP), is responsible for the transport of proteins across the outer membrane first exported to the periplasm by the Sec or Tat translocon in Gram-negative (diderm) bacteria. As members of the T2SJ family, members of the T2SI family are pseudopilins containing prepilin signal sequences.	1.21574e-17
CP027745.1\|AZD60689.1\|3050319_3051531_+\|General-secretion-pathway-protein-F	gnl\|CDD\|273980	TIGR02120, Putative_general_secretion_pathway_protein_F, type II secretion system protein F. This membrane protein is a component of the terminal branch complex of the general secretion pathway (GSP), also known as the"Type II" secretion pathway. The GSP transports proteins (generally virulence-associated cell wall hydrolases) across the outer membrase of the bacterial cell. Transport across the inner membrane is often, but not exclusively handled by the Sec system. This model was constructed from the broader subfamily model, pfam00482 which includes components of pilin complexes (PilC) as well as other related genes. GspF is nearly always gene clustered with other GSP subunits. Some genes from Xylella and Xanthomonas strains score below the trusted cutoff due to excessive divergence from the family such that a sequence from Deinococcus which does not appear to be GspF scores higher. [Protein fate, Protein and peptide secretion and trafficking].	3.17418e-179
CP027745.1\|AZD60687.1\|3043689_3044883_+\|General-secretion-pathway-protein-L	gnl\|CDD\|273768	TIGR01709, Type_II_secretion_system_protein_L, type II secretion system protein L. This model represents GspL, protein L of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking].	5.8513e-35
CP027745.1\|AZD60688.1\|3044875_3045442_+\|General-secretion-pathway-protein-M	gnl\|CDD\|377391	pfam04612, T2SSM, Type II secretion system (T2SS), protein M. This family of membrane proteins consists of Type II secretion system protein M sequences from several Gram-negative (diderm) bacteria. The precise function of these proteins is unknown, though in Vibrio cholerae, the T2SM (EpsM) protein interacts with the T2SL (EpsL) protein, and also forms homodimers.	4.28698e-21
CP027745.1\|AZD60679.1\|3038072_3038618_+\|Extracytoplasmic-function-(ECF)-sigma-factor-VreI	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	1.41067e-20
CP027745.1\|AZD60693.1\|3054183_3062727_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	gnl\|CDD\|273865	TIGR01901, Heme/hemopexin-binding_protein, filamentous hemagglutinin family N-terminal domain. This model represents a conserved domain found near the N-terminus of a number of large, repetitive bacterial proteins, including many proteins of over 2500 amino acids. Members generally have a signal sequence, then an intervening region, then the region described by this model. Following this region, proteins typically have regions rich in repeats but may show no homology between the repeats of one member and the repeats of another. A number of the members of this family have been designated adhesins, filamentous haemagglutinins, heme/hemopexin-binding protein, etc.	0.00365823
CP027745.1\|AZD60692.1\|3053929_3054184_+\|Filamentous-hemagglutinin-family-outer-membrane-protein	gnl\|CDD\|273865	TIGR01901, Heme/hemopexin-binding_protein, filamentous hemagglutinin family N-terminal domain. This model represents a conserved domain found near the N-terminus of a number of large, repetitive bacterial proteins, including many proteins of over 2500 amino acids. Members generally have a signal sequence, then an intervening region, then the region described by this model. Following this region, proteins typically have regions rich in repeats but may show no homology between the repeats of one member and the repeats of another. A number of the members of this family have been designated adhesins, filamentous haemagglutinins, heme/hemopexin-binding protein, etc.	2.22694e-07
CP027745.1\|AZD60685.1\|3042222_3042672_+\|General-secretion-pathway-protein-G	gnl\|CDD\|130771	TIGR01710, Type_II_secretion_system_protein_G, type II secretion system protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	4.08852e-41
CP027745.1\|AZD60681.1\|3039890_3040514_-\|General-secretion-pathway-protein-J	gnl\|CDD\|227132	COG4795, PulJ, Type II secretory pathway, component PulJ [Intracellular trafficking and secretion].	4.09685e-25
CP027745.1\|AZD60680.1\|3038657_3039608_+\|Sigma-factor-regulator-VreR-(cytoplasmic-membrane-localized)-of-trans-envelope-signaling-system	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	8.59914e-68

>CP027745.1|AZD60688.1|3044875_3045442_+|General-secretion-pathway-protein-M
MNKLSLSHYRQRWQRQAAQAQLYWNGLALREKRLLAGAAAVLGGLLVWLVLIEPALKKIDYWQAEIPKLRSQSEALELVLHQAGGPRGGEPGQSLEQSLRQTLDAAGLQGLYQLQLAGEGESQAWHLSFQEAPADAVVGWLLGNPRQFSLEVVEARLQRAGPADIDGTAGKLSGTVRMDQALGAKEAS
>CP027745.1|AZD60687.1|3043689_3044883_+|General-secretion-pathway-protein-L
MSRLRVSLPPLHSLTAESRVSFARLQVKEGQVKEAGEASLMQLGQVPKAPAVECFLHPEDSLLASIELPALAPAKVSAAVACAAQALILGHSDSLYVAHSPRDSDGQVHISWLPREALARLGQVLEQAGLKLRGLYPAPYALPVPAAGQLTACLQDQHLLLRHSPQQGSVQPLPEDALQALLANGAGLQWIGEGAPQGALEQLPDSCRWTGQTPAWGLHGGVQNNGARQQGWGRAAALCAAALVVWTLGLNLYAARQAAQGQQLKAQMSQRVQQVFPELPVILNPLQQARQQLAARQSGASGDAPQSFNSLVQQASNAMPFVIGGVEQLNYQNGELQLSLLSDTRVPAPDSGWQGLLTQAGLEASPGDQGWTLRAATGMATGAVPMEADDSEEDEDE
>CP027745.1|AZD60686.1|3042709_3043693_+|General-secretion-pathway-protein-K
MTARSPTAAKQRGMAIISALLIAAVVAVIAGGMLTRQTLFTRGLESEQLRVQGSWQLQGGMEVSRQRLWEDRQRDVLTRLDQNWARPIQLAALGPGAGPFEGRLEDEQSKFNLRNLLANDRLDPLQIENFQRLCELLGVNATLGQRISQRVIASYPRLLSPEGTAAPVKSGFHSGRDTSPEAARKPLLAKQPMLRSLDDLLGVNGVDEKLLARLEPFVTILPANTWVNGNTASAEVLAATVPGLALPRAKALIAERDSGQWFINQGDFINRLRMPQVPADAVRVGITSEWFRLQGQARGERRRVRLLALLHRSEDNMPRVIWSRVGV
>CP027745.1|AZD60685.1|3042222_3042672_+|General-secretion-pathway-protein-G
MDVVRFTSHPQPHLQPRRQPRRPRGQGGFTLIEIMVVVVILGILAAMVVPKVLDRPDQARATAAKQDIGGLMQALKLYRLDHGTYPSMNQGLKVLVARPADAKNSNWRSYLERLPNDPWGRPYHYLNPGPTAKWMCSPWGPTASQTVTA
>CP027745.1|AZD60684.1|3041645_3041993_-|General-secretion-pathway-protein-I
MLVALAIIAVAMSAAIRVAGLMTQSNGLLRDRSIALLAAQSRLAELRLEGRLPPGTKNIECDQGRLKLRCEQNIAPSPDPRLSRVSVLVLDRSREAPPLARLDTLVARVPKNSNR
>CP027745.1|AZD60683.1|3041220_3041511_+|General-secretion-pathway-protein-C
MAAQAQSPAQQWFSNQPLALDIKVTGLMASPRGAVAILSLNDAPPRSFLVGERLAQGVQLVAIEGDGVVIERGGERSRLDVSKLPESPALPVLTRQ
>CP027745.1|AZD60682.1|3040510_3040972_-|General-secretion-pathway-protein-H
MTPSRQQGFTLIELMVVLVIIGIASAAISLSIRPDPLQGLRKDAERLAQLLQVAQAEARVDGRPISWRADAKGFAFSRPSDDGRSLDQFKDDPQLRPRPWESSSIKVRIEPGPRLVLNAEWIDAPLQVQLSDGQNSLTVQRTATGVVRVVALP
>CP027745.1|AZD60681.1|3039890_3040514_-|General-secretion-pathway-protein-J
MKARINQRQGGFTLIEVMVAILLMAVVSVIAWRGLDSVSRADSHLQASSEQTEELLRTLHQLERDVALRASVELMEPVPAGSDAETSDVPAALTVRSADSGTFRLDVIRTAATPGDGLQRVRWWLKGDTLYRAAAPARDRYPLPAPKNAVAVLEHVSDLQLRVWDRDKGWRQLSGNRKENPPGLEIRLVRQTPQGEERYRQVLGPLE
>CP027745.1|AZD60680.1|3038657_3039608_+|Sigma-factor-regulator-VreR-(cytoplasmic-membrane-localized)-of-trans-envelope-signaling-system
MNIFSISTSRATPDHRLRNEAQDWLLLLTSGRATAADARALQQWCAQSPQHAEAFEQAKLLWHSLKPAAEQCQQQTQPRRFGRRAFLGGALAASVALVAVRVSVPGGFAGLSADYRTEVGEQRRVELEDGLSLELNTQTRISRRELAQGGQGIELLEGEVEVSSQGALPVRVQAGNGWLSASQARFNVRNINHSVCVTCIDGALQVEVAGRLIRLDSGRQLTYDSRQVGEPKAVDPTAVIAWREQVLVFDNATLNTVIDEINRYRPGMLVLLNAELGKRKVQARFNLNQLAGVALLIRDAYGAKCTELPGGVVLLS
>CP027745.1|AZD60679.1|3038072_3038618_+|Extracytoplasmic-function-(ECF)-sigma-factor-VreI
MKNTGHSAMVRLFLTSYDDFKVRLRRRLGSEDLANDVLHETYLRVDRMEEPPNLAQPNAYLYRMALNIAADRRQADARLLTGSEVEELLQISDEALDPSRVVGGQKEIQSLLKALYELPARRRKIFIAARLEEAPHLEISQRFGISTRMVEKEIKAALGHCASRLERKVIQRFGPGAGKPS
>CP027745.1|AZD60689.1|3050319_3051531_+|General-secretion-pathway-protein-F
MNRYRYEAADALGKIESGHLEADSQSAAFGVLRSRGLTALMVQVESNTPKAGGGGLFSAKLSDNDLAWATRQLASLLGASLPLEAALSATVEQAERKHIAHTLSAVRADVRSGMRLAEALAARPRDFPDIYRALIAAGEESGDLAQVMERLADYIEERNTLRGKILTAFIYPGVVGLVSVGIVIFLLSYVVPQVVSAFSQARQDLPGLTLAMLNASDFIRAWGWLCFGVLAGGFWSWRLYLRNPQARLNWHSRVLRLPLIGRFVLGLNTARFASTLAILGGAGVPLLRALEAARQTLSNDRLSQSVSDATAKVREGVNLAAALRVEKVFPPVLIHLIASGEKTGALPPMLERAAQTLSRDIERRAMGMTALLEPLMIVVMGGVVLVIVMAVLLPIIEINQLVQ
>CP027745.1|AZD60690.1|3052143_3053310_+|Phosphate-ABC-transporter,-periplasmic-phosphate-binding-protein-PstS
MFKRTMIAASLAVAALASAQSMAAVVGGGATLPQNLYGTTAGTGILASSTPGFNAYIGVGSGAGKQAFFNNDSTKFNLASGINVDYAGSDSIVSVAERDAYNSSANKGRATFGPLIQIPAEATSVTVPYNVAGKTSLNLTSAQLADIFSGKITNWNQIVFSGVAGPNLPITVVYRTDGSGTTEIFTTHLKAVKPASVPAASNSFSTAVGFNPATNAPAGSTYVGVSGSGAIASTVANTNGAIGYVSPDFAEFNNAAKVATVNGFLPTEVNVQITLDTALPPTNPASGKNPANPLDWVPTFANPSTGYPIVGYTNLIFSQCYKDAGDNLRIRNFLNAHYTGVNNSAVSSHSFIPLSAAWQTAVHDTFYKTTSALRVGDTNVCNGIGRPS
>CP027745.1|AZD60691.1|3053522_3053927_+|Filamentous-hemagglutinin-family-outer-membrane-protein
MRSEPNLPVSRLINASAAHGQPVLRLKPLAHAIALLMLAGTAQAAQPQAFSSGWFGAMGANQGAGAARPSVAQPAGTPPPLAQQQRVNSQLQRSMSNLNNTVAAIAAQQAAQAAGRAAALTAAQTLHNGLGAMA
>CP027745.1|AZD60692.1|3053929_3054184_+|Filamentous-hemagglutinin-family-outer-membrane-protein
MLVGADGKPLFVNAEGPVQTDANGKALVSIKQTADKAILNWETFNIGRDTTVEFQQNAEWAALNRVNNSTSPSQIQGHSRPTVR
>CP027745.1|AZD60693.1|3054183_3062727_+|Filamentous-hemagglutinin-family-outer-membrane-protein
MILNRNGVVFSGSSQINVRNLVAAATTISDEQFNNRGLFSASDSAPTFSDAAGKVLVEQGAQLQTHVPGSSTSSGGYVLLLGKEVDNAGSINTPRGQTALVAGDSFVIKKGYSTDGNPTSTTRGNEVVASGIGKVSNHGSIQAATGDITLSAQEVLQKGLALSSTSVDARGTLHLNARGNDAKVTLGEGSTSAILIDSSTALDSQRDGLLTPALTQAGNSTPADTYRRDQSLVEIASGGTVDFQSGSITLATGGQVAVNAGQRSLVRDGAVIDVSGAVGVKVAMESNSVKVNIQGNEQRDASVNRDSKNLNNNDVWVDARELVLVPAGTNGYATDRWYTAGGLLEVGGYLGTQPHNVGEWMAQGGSVRLSGNEVVTQQGSQINLSGGTLDVQDGMIQQTWLRAADGRLIELSRAPGDILYSGLYKGFEEHSVRWGQTEYHYNSLIAPRERLEQGYSVGRDAGRLEVSTRNAVLEGQIVGDTFQGDRQTQAPRPGLDGYQQGQNAVARGGQLVVGAYVPYYVKDSASLQYALSADANTVKQVVLGQAAAIASGLDLDTVLPDERKGALWLDTEQLNGFKLSSVKVAATDSILVDGALEVSSGGDITLYGPQVQVDADLTAHGGSLALGNVLQQITSNGKLDTTLAATGGKRATLTVGSGVRLDTSGLWSNLLLDPADGSRLPYLNGGSVSLRSSADVALESGSLIDVSSGAALMSDGKTRSGKGGNLTLAVNANSAAAIGTLTLDGELRGHGVNGGGTLSLQSGKVLIGERAADTAADTLVLAPQFFDKGFAAYDITGNQGLRVADGAQVEVTQPIYLLGDQARSTATGADLTSALERWLPGLYQEDPIKAVLSQRQGASISLRAGTARSSAADMASTQLVVGKGAAISVDPGQSIALGSIGQLTLDGALNAWGGAITLSGISVAPDVAEVVESAGHGRSIWVGEQAVLDVAVRAVTATDALRRRYGKVDAGGTIVIGGQIDPQTGIASAANQFVVVREGARLEASGAQAMVDVAGQGPVAIASSGGSISLASNNGLYLDGSFNARAGGSGAAGGSLNVALEAPLYRPSASQRVRQAREMVVGQVSADSLLPSGAGPETVQDTLAYGHARLGLDKVQAGGFDNLSLLSNGLISFDGALSLSLGQSLQLYAGALALSDSAAAGSRVQLAAPYIRLAGVGAVDAPDRSIRPTVQGGVSTQASTGSLLVTAGNVLDVRDGVSIGAHGTTASSLSQAIDRRAFDDTQLISQGDMRFLASTIDLRNTNLSTQADLRLAAAQIYPATGAVAQVLAGYRGNGLDYDPDRTLSIGRTGSVDPAQPYSVFGKLTLGAAVIEQGGVLRAPLGNISLGTEFGVLRYTKQLSLLPGSLTSVSAAGLTLPYGGTVDGVTWRFDGKQVDLLGVGGTSSNANLVVGAQLLGQSIEVQQGAVLDLSGGGQLLGAAFVSGRGGSTDARYNPLVQFGANGRFTLPGLDTNPVYAIVPGVQASVAPSGGEAGATTPLVGQQFSIDAGVPGLPAGTYTLLPSTYALLPGAFRVEINGLAAPFGATALTRGTVMSNGSWSSAGRLSIAQTGIQDALSRQVILTPAAVLRSYSQYNETPYADFVRSDAARRGVPRAALEADGKTLRVSLIAGQSGSPSGFEFAGVARSGVAEGGFGASLEVMSGSSESPIEILPAGASASGNGVSFHADDLNAIGTARMSIGGAPTVVYGQGGNFVGFDANRAAESVTLRQGVTLSAPEVFLVSGRPNGAIQVEQGASINTLGRGDAAYDSTDGFIYQPGLRSVLAVSNGVLQMLAPTEGDAGRGPGSILIGDCVQAACQGETTLYSQGTIAFATTNTFRLGDAVRYGTRHLALAVGGINVGSPEALAAAQARNALPSGLTLNQDVMNRLLRGDIASGAPALETLSLTAGQSLNFYGSTTLSTLDSNGQSMLDNLMLSTPAIYGDGAAGDVALIQTGNLIWNGVAGTPAAVIANGAGTGSGTLEIQSRRIEFGYGPNTQPDPLADYARLALGFANVNLSASERLTANHKGSLAVYQSQGAYEAGKGFVYSGGNLNISTPLLTGEAGSVNRITAGSDLRLSRAPGQQAAVPAIDSLGAEVLLAGNNVELDSAVVLPSGKLTVNAEHGLNLTDRAHLDLAGRQVMFNEVSQYSWGGDVILQSREGDIRQAAGSLIDLSAQNNHGGSLKVVAVDEGGGQVDLQGQLLGASSGHYDAGGTLVPYKAGSVDIRAQTLGDFAALNQRLNQGQVFGARSFQIKRGDLTIGSELKAGEVNVSVDNGQLTVLGTIDASGERVGSIRLAASQGLTLAGSALLDAHGTALRVDSYGKIIDSPNRAVVELNSGLGQLTLADGARIDLRHGTSVAAGTAPGQYDGQARGTLELNAPRLDASDPTLGDIAIDASGRLNILGARSIAVNGTARYTDVPEGTAPAASGRPYQVIDQAYLDAKHQDSQRFIDNALSNAGLMNGKLAGLNNATYADAFHLRPGLEIVTQGDLVISGDLDLSGYRYTSVNPHAQKTSVYGSGEPGNLVIRAGGNLDIYGSINDGFAPPPPTPDDAGWVLTPGRQAFGGDVVVPGPGVTLADGSLFPAGKTLNYALPIKPVRLAQGTLLPVEATLQAPLELPAGTVLQAAVRDSAGNQVYAAGTLIREAVTLASGMTLDAGTRLPAAASLGAMTWPAGVPLPSRDSVGPNNPDGVQLAGSLALKVGALIPSETDIKLPSGVISVPLRTVTGGRQGSNWAVASLLPEGSLSWSMRLVSGADTQAADTRAIKPVMAGDLTLADTHYAVFEGHETIIIPGTPERPAGAWFWNELGVLIDPSFVEGTRVAPAEESWCAEGMCNRFNYVWNDLGY
>CP027745.1|AZD60694.1|3062723_3064079_+|Filamentous-hemagglutinin-family-outer-membrane-protein
MIDPSFVEGAPVLAEYESWCAEGLCTSLGEAIPGTPEQVIVGPVNKVTPVTQNFSVLRTGTGDLDLLAAGNVAMQSSYGVYTAGASTATRAGDLQGAFDQARSRGGDGSVLGNAATAYESLVNEGPGSLYAAWYPDQGGNLLLRSGGSLTGDVFSNYTEPRKENARAQLASSNLGNWLWRQGTGDTAGVTPIPASWWINFGTYVSGRGVVNTGNPDSSLIAQLPILVGFTGIGTLGGGNLTLDVGRDAGLLSRRGAPDAVSSPRSQGLVLAVGSSGRVTPTGELLLTGGGDLDVHVGGDLNPGLSARAAATASTANPVSTDYTRQDLRLNGVLSNLRGALGLQASSLGGVALNYGSLALFNDSKESRAYDPFNASLGTATGGMVLMLGDATASLATRGDLVLAGTGDPGRTSTENASAFTYDGTSYGTGGYGWFRCGPSALPSICFRREVA
>CP027745.1|AZD60695.1|3064263_3065907_+|Filamentous-hemagglutinin-family-outer-membrane-protein
MLLAPSTQGRLEVLAGDSIYAGGYAINQSGASLSAMPTPFTPAFAGWGTDIAPIVTNLSSDGITIPNTKAEFSLFAFGANTANSQFTSSEAARFYAVGGDIVGLRSGEILNFTFGPRLGQTWYEAAGPVWMKAGRDIVNSGTALGEPTGVTGIIASSLGNMFGGGTSSGNLFVHNNPSDISIVSAGRDLLFSSFNVAGPGTLEISAGRNILMQDKASVNSLGPVVAGDSRPGASIVMQAGVGAAGLDYLKFVTPYLDPINQAQAGVPLAEQRGKVAKTYEAELLKWLKERFAFEGSSDEARGYFASLPAEQQRVFARRVYFEELREGGREYNDANGPRFGSFLRSRNAIASLLPAADVAGNPIVYDGDITLYGGAGVRTLFGGDIQMLTPGGQQVFGIEGEAPPASAGIITQGAGDIQLYSQGSILLGQSRVMTTFGGSILGWSNAGDINAGRGSKTTVIYTPPKRVYDNWGNVTLSSNVPSSGRGSPPWHRLPKCLPGISTCWRHWAPSMPVRQGSGSRATSISSPCRWSTRRISRPRASLPGYRW
>CP027745.1|AZD60696.1|3065900_3066206_+|Filamentous-hemagglutinin-family-outer-membrane-protein
MVASVNTGALTSASSAASSATQAAEDVARQQQAAARQNMPSVFSVQVLSFGQERLAPTQDGASRANPGYNPDSPVQVLGAGPLSEQARQQLTEEERRQLTL
>CP027745.1|AZD60697.1|3066413_3067049_+|hypothetical-protein
MTEVVMKYLKLAGLLLVTTTLFGCATSRSVVDIDGPEVASGNGQKVVINVLDERRFEADPRSADIPSLKNGEINDKAITERAIARKRNGYGMGLGDVLLPEGVKVSTLIAKSIGAAYGKAGYQVVPSTEQASDARTITVHVVEFWSWMSPGAFSVAVNNKSHLKVDTGSASSPVEVKTLKREGMQMITEDDWKLITEAGLQAISESMAKQL
>CP027745.1|AZD60698.1|3067235_3067553_-|hypothetical-protein
MFGDEYRAAISNSLRSVTDDSAIHPPYRHRLHHPLPADRQNTPLDVLHANSTARLLAVTQVLESLARLDLKDADSADLQHLANASAILLRDSCDLLDVMGWRLQA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

422177 : 429736

Pseudomonas_phage(80.0%)

tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD58353.1\|422177_422861_+	Phage protein	H6WRZ8	Salmonella_phage	5.4e-40	59.2
AZD58354.1\|423178_423340_+	hypothetical protein	A0A1B0VP73	Pseudomonas_phage	1.4e-10	72.0
AZD58355.1\|423336_423648_+	hypothetical protein	NA	NA	NA	NA
AZD58356.1\|423644_423890_+	hypothetical protein	NA	NA	NA	NA
AZD58357.1\|423886_424216_+	hypothetical protein	NA	NA	NA	NA
AZD58358.1\|424219_424507_+	hypothetical protein	A0A1B0VMJ4	Pseudomonas_phage	1.1e-37	88.5
AZD58359.1\|424508_424727_+	hypothetical protein	A0A1B0VRK9	Pseudomonas_phage	2.6e-28	83.3
AZD58360.1\|424723_425605_+	DNA primase, phage-associated	A0A1B0VML8	Pseudomonas_phage	3.7e-142	87.7
AZD58361.1\|425591_427394_+	DNA primase, phage-associated	A0A1B0VP75	Pseudomonas_phage	0.0e+00	95.7
AZD58362.1\|427725_428040_+	hypothetical protein	A0A1B0VML7	Pseudomonas_phage	1.0e-38	75.5
AZD58363.1\|428036_428642_+	hypothetical protein	A0A1B0VMK2	Pseudomonas_phage	2.1e-51	53.0
AZD58364.1\|428754_429135_+	hypothetical protein	A0A1B0VML3	Pseudomonas_phage	2.9e-35	61.4
AZD58365.1\|429145_429736_+\|tail	Phage tail assembly protein I	A0A2H4J1H0	uncultured_Caudovirales_phage	1.9e-57	61.5

DBSCAN-SWA_2

1355910 : 1445628

Pseudomonas_phage(43.14%)

tail,tRNA,protease,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD59166.1\|1355910_1357140_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD59167.1\|1357127_1357262_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD59168.1\|1357335_1359723_+	Outer membrane protein assembly factor YaeT	NA	NA	NA	NA
AZD59169.1\|1359767_1360271_+	Outer membrane chaperone Skp, precursor	NA	NA	NA	NA
AZD59170.1\|1360274_1361330_+	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	NA	NA	NA	NA
AZD59171.1\|1361439_1361880_+	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZD59172.1\|1361876_1362653_+	Acyl-ADP--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZD59173.1\|1363796_1364429_+	Ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.7e-27	38.9
AZD59174.1\|1364498_1366070_+	DNA polymerase III alpha subunit	A0A1C9LWZ5	Streptomyces_phage	3.2e-83	39.2
AZD59175.1\|1366045_1368022_+	DNA polymerase III alpha subunit	A0A291AVA6	Streptomyces_phage	6.7e-99	38.2
AZD59176.1\|1368162_1369110_+	Acetyl-coenzyme A carboxyl transferase alpha chain	NA	NA	NA	NA
AZD59177.1\|1369229_1370558_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZD59178.1\|1370603_1370747_+	hypothetical protein	NA	NA	NA	NA
AZD59179.1\|1370832_1372464_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.9e-158	53.5
AZD59180.1\|1373541_1374759_+	Enolase	A0A1X9I5Z8	Streptococcus_phage	3.6e-127	59.2
AZD59181.1\|1374929_1375208_+	Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage	NA	NA	NA	NA
AZD59182.1\|1375204_1375912_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZD59183.1\|1377079_1378192_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	2.4e-29	27.2
AZD59184.1\|1379645_1380704_+\|tRNA	tRNA pseudouridine(13) synthase	NA	NA	NA	NA
AZD59185.1\|1380691_1381441_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.1e-69	52.6
AZD59186.1\|1381440_1382118_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.8e-43	52.0
AZD59187.1\|1382408_1383161_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	5.7e-06	33.3
AZD59188.1\|1383267_1384272_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZD59189.1\|1384771_1385095_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZD59190.1\|1385237_1387817_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	3.1e-27	23.5
AZD59191.1\|1387901_1388738_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	1.2e-129	90.7
AZD59192.1\|1389477_1390059_+	hypothetical protein	NA	NA	NA	NA
AZD59193.1\|1390161_1390509_+	Holin	B5TK61	Pseudomonas_phage	1.0e-50	87.7
AZD59194.1\|1390675_1391440_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	8.9e-07	26.8
AZD59195.1\|1391662_1392187_+	hypothetical protein	NA	NA	NA	NA
AZD59196.1\|1392190_1392799_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	1.8e-47	59.0
AZD59197.1\|1392812_1393145_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	2.3e-36	68.2
AZD59198.1\|1393141_1394137_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	8.9e-108	62.6
AZD59199.1\|1394133_1394769_+	Tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	9.9e-44	53.7
AZD59200.1\|1394769_1396332_+\|tail	Prophage long tail fiber protein	A0A1I9KF43	Aeromonas_phage	1.2e-29	40.9
AZD59201.1\|1396866_1397088_+	hypothetical protein	NA	NA	NA	NA
AZD59202.1\|1397090_1398257_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	1.1e-125	57.5
AZD59203.1\|1398256_1398763_+	hypothetical protein	Q6R4W3	Vibrio_virus	2.1e-25	36.9
AZD59204.1\|1398890_1399472_+	hypothetical protein	B0ZSH0	Halomonas_phage	9.1e-28	39.4
AZD59205.1\|1399468_1399594_+	hypothetical protein	NA	NA	NA	NA
AZD59206.1\|1399600_1401814_+\|tail	Phage tail length tape-measure protein	A2I2Y1	Vibrio_virus	3.8e-34	34.8
AZD59207.1\|1401872_1402256_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	4.7e-33	53.5
AZD59208.1\|1402248_1402461_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	3.9e-21	68.6
AZD59209.1\|1403192_1403489_+	hypothetical protein	A0A2H4JH05	uncultured_Caudovirales_phage	2.0e-23	58.9
AZD59210.1\|1403668_1404253_+	hypothetical protein	B5TK65	Pseudomonas_phage	6.9e-76	72.0
AZD59211.1\|1404249_1404432_+	Mu-like prophage FluMu protein GP38	B5TK66	Pseudomonas_phage	6.5e-25	93.3
AZD59212.1\|1404431_1405928_+\|tail	Bacteriophage tail sheath protein	B5TK67	Pseudomonas_phage	7.8e-257	90.8
AZD59213.1\|1405994_1406342_+\|tail	Phage tail tube protein	B5TK68	Pseudomonas_phage	2.9e-58	93.9
AZD59214.1\|1406338_1406635_+\|tail	Phage small tail protein E	B5TK69	Pseudomonas_phage	2.3e-43	94.9
AZD59215.1\|1406765_1408445_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	4.5e-35	37.4
AZD59216.1\|1408438_1408963_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	1.7e-25	55.0
AZD59217.1\|1408949_1410194_+\|tail	Phage tail/DNA circulation protein	B5TK71	Pseudomonas_phage	8.3e-180	75.4
AZD59218.1\|1410190_1411231_+\|tail	Prophage tail protein	B5TK72	Pseudomonas_phage	1.3e-162	82.9
AZD59219.1\|1411295_1411805_+\|plate	Prophage baseplate assembly protein V	B5TK73	Pseudomonas_phage	2.2e-78	88.8
AZD59220.1\|1411804_1412203_+	Bacteriophage protein GP46	B5TK74	Pseudomonas_phage	4.8e-65	88.6
AZD59221.1\|1412192_1413233_+	Phage FluMu protein gp47	B5TK75	Pseudomonas_phage	1.4e-167	87.3
AZD59222.1\|1413220_1413820_+\|tail	Prophage tail protein	B5TK76	Pseudomonas_phage	8.5e-106	91.5
AZD59223.1\|1413831_1414242_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	7.3e-24	76.4
AZD59224.1\|1414689_1415331_+\|tail	putative tail fiber assembly-like protein	B5TK78	Pseudomonas_phage	1.4e-37	62.1
AZD59225.1\|1415529_1415661_-	hypothetical protein	NA	NA	NA	NA
AZD59226.1\|1415714_1417256_+\|tail	Prophage tail fiber protein	A4PE45	Ralstonia_virus	1.8e-38	54.2
AZD59227.1\|1417268_1417739_+	hypothetical protein	A0A2H4EXG4	Aeromonas_phage	1.9e-07	35.0
AZD59228.1\|1417883_1417997_-	hypothetical protein	NA	NA	NA	NA
AZD59229.1\|1418133_1419198_+\|tail	Prophage tail fiber protein	B5TK79	Pseudomonas_phage	3.3e-116	59.1
AZD59230.1\|1419599_1419806_+	hypothetical protein	B5TK80	Pseudomonas_phage	3.9e-10	57.1
AZD59231.1\|1419827_1420391_+	Lytic enzyme	B5TK83	Pseudomonas_phage	2.0e-88	84.4
AZD59232.1\|1420372_1420909_+	hypothetical protein	B5TK84	Pseudomonas_phage	2.0e-61	71.9
AZD59233.1\|1420991_1421492_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.8e-72	86.7
AZD59234.1\|1421575_1422628_+	RecA protein	A0A0S2MVG1	Bacillus_phage	4.4e-113	60.9
AZD59235.1\|1422636_1423104_+	Regulatory protein RecX	NA	NA	NA	NA
AZD59236.1\|1423149_1424265_-	Decarboxylase family protein	NA	NA	NA	NA
AZD59237.1\|1424748_1424943_+	hypothetical protein	NA	NA	NA	NA
AZD59238.1\|1424944_1425367_-	Putative NADPH-quinone reductase (modulator of drug activity B)	NA	NA	NA	NA
AZD59239.1\|1425556_1426267_+	putative conserved protein YfiP, contains DTW domain	NA	NA	NA	NA
AZD59240.1\|1426586_1427237_+	Transcriptional regulator, LuxR family	NA	NA	NA	NA
AZD59241.1\|1427313_1427676_+	Diacylglycerol kinase	NA	NA	NA	NA
AZD59242.1\|1427672_1428599_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZD59243.1\|1428732_1429512_+	Ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZD59244.1\|1429584_1430313_-	S-adenosylmethionine-dependent methyltransferase YaeB	NA	NA	NA	NA
AZD59245.1\|1430401_1431172_-	Rhamnolipid biosynthesis 3-oxoacyl-ACP reductase RhlG	NA	NA	NA	NA
AZD59246.1\|1431304_1431766_-	Uncharacterized protein YehS	Q9EYF4	Enterobacteria_phage	8.5e-37	51.3
AZD59247.1\|1431832_1432543_-	Ribosomal large subunit pseudouridine synthase F	NA	NA	NA	NA
AZD59248.1\|1432625_1433099_-	Acetyltransferase	NA	NA	NA	NA
AZD59249.1\|1433205_1434543_-	Ribosomal protein S12p Asp88 methylthiotransferase	NA	NA	NA	NA
AZD59250.1\|1434737_1434914_-	hypothetical protein	NA	NA	NA	NA
AZD59251.1\|1434935_1436777_+	Kup system potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.2e-76	35.3
AZD59252.1\|1436968_1438264_-	Alanylphosphatidylglycerol hydrolase, periplasmic	NA	NA	NA	NA
AZD59253.1\|1442941_1443895_-	putative lipoprotein	NA	NA	NA	NA
AZD59254.1\|1443912_1445628_-\|tRNA	Prolyl-tRNA synthetase, bacterial type	NA	NA	NA	NA

DBSCAN-SWA_3

2180687 : 2296414

uncultured_Caudovirales_phage(57.14%)

tail,terminase,protease,plate,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD59913.1\|2180687_2181296_-\|protease	SOS-response repressor and protease LexA	A0A2H4JG58	uncultured_Caudovirales_phage	1.1e-12	55.4
AZD59914.1\|2181547_2182255_+	putative transcriptional regulator for fatty acid degradation FadQ, TetR family	NA	NA	NA	NA
AZD59915.1\|2182447_2183458_+	beta-N-acetylglucosaminidase	NA	NA	NA	NA
AZD59916.1\|2183469_2184213_+	S-methyl-5'-thioinosine phosphorylase	NA	NA	NA	NA
AZD59917.1\|2184309_2186790_-	DNA/RNA helicase, SNF2 family	V9XTV7	Choristoneura_murinana_nucleopolyhedrovirus	2.5e-50	31.0
AZD59918.1\|2187013_2191036_-	Transcription-repair coupling factor	NA	NA	NA	NA
AZD59919.1\|2191386_2192850_+	NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZD59920.1\|2194646_2195549_+	FAD:protein FMN transferase	NA	NA	NA	NA
AZD59921.1\|2195824_2197219_+	Soluble pyridine nucleotide transhydrogenase	NA	NA	NA	NA
AZD59922.1\|2197261_2197984_-	Glycerophosphoryl diester phosphodiesterase	A0A292GJA3	Xanthomonas_phage	7.8e-05	40.4
AZD59923.1\|2198045_2198633_-	hypothetical protein	NA	NA	NA	NA
AZD59924.1\|2198727_2199978_+	Lipoprotein releasing system transmembrane protein LolC	NA	NA	NA	NA
AZD59925.1\|2199970_2200669_+	Lipoprotein-releasing system ATP-binding protein LolD	G9BWD6	Planktothrix_phage	1.3e-36	41.1
AZD59926.1\|2202039_2203401_-	Copper sensory histidine kinase CusS	B5LWN8	Feldmannia_species_virus	7.9e-06	21.2
AZD59927.1\|2203400_2204081_-	Copper-sensing two-component system response regulator CusR	NA	NA	NA	NA
AZD59928.1\|2204236_2204791_+	Copper tolerance protein	NA	NA	NA	NA
AZD59929.1\|2204859_2205690_+	NADPH-dependent 7-cyano-7-deazaguanine reductase	A0A2I7SAX1	Vibrio_phage	3.6e-38	37.4
AZD59930.1\|2205738_2206002_-	Chromosome segregation ATPase	NA	NA	NA	NA
AZD59931.1\|2206937_2207621_+	Outer-membrane-phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
AZD59932.1\|2207680_2207980_-	hypothetical protein	NA	NA	NA	NA
AZD59933.1\|2209851_2210919_-	Transaldolase	A0A127KNC6	Cyanophage	1.4e-13	33.5
AZD59934.1\|2211108_2212128_-\|tRNA	tRNA-dihydrouridine(20/20a) synthase	NA	NA	NA	NA
AZD59935.1\|2213533_2214445_+	hypothetical protein	NA	NA	NA	NA
AZD59936.1\|2214405_2215011_+	hypothetical protein	NA	NA	NA	NA
AZD59937.1\|2216286_2216670_-	hypothetical protein	A0A2H4J897	uncultured_Caudovirales_phage	1.3e-43	71.1
AZD59938.1\|2217321_2217528_-	hypothetical protein	NA	NA	NA	NA
AZD59939.1\|2217733_2218084_-	hypothetical protein	NA	NA	NA	NA
AZD59940.1\|2218315_2219257_+	hypothetical protein	NA	NA	NA	NA
AZD59941.1\|2221152_2221641_+	hypothetical protein	A0A2H4JFM0	uncultured_Caudovirales_phage	1.4e-37	64.3
AZD59942.1\|2221633_2221840_+	hypothetical protein	A0A2H4JDJ0	uncultured_Caudovirales_phage	4.6e-19	64.7
AZD59943.1\|2224797_2225343_+	hypothetical protein	A0A2H4J8A5	uncultured_Caudovirales_phage	3.0e-41	55.6
AZD59944.1\|2225532_2225880_+	Holin	A0A2H4J893	uncultured_Caudovirales_phage	3.5e-43	80.6
AZD59945.1\|2226015_2226537_+\|terminase	Phage DNA packaging protein, Nu1 subunit of terminase	NA	NA	NA	NA
AZD59946.1\|2226541_2228467_+\|terminase	Phage terminase, large subunit	A0A2D1GMT1	Marinobacter_phage	4.8e-166	48.7
AZD59947.1\|2228479_2228695_+	hypothetical protein	NA	NA	NA	NA
AZD59948.1\|2228697_2230305_+	hypothetical protein	A0A0C5AJ48	Bacteriophage	1.4e-94	42.6
AZD59949.1\|2230307_2231528_+\|protease	Periplasmic serine protease (ClpP class)	A0A219YB02	Aeromonas_phage	1.4e-49	43.0
AZD59950.1\|2231540_2231891_+	hypothetical protein	NA	NA	NA	NA
AZD59951.1\|2231902_2232934_+	hypothetical protein	A0A0C5ABI0	Bacteriophage	3.4e-70	41.7
AZD59952.1\|2232935_2233115_+	hypothetical protein	NA	NA	NA	NA
AZD59953.1\|2233117_2233438_+	hypothetical protein	NA	NA	NA	NA
AZD59954.1\|2233434_2234088_+	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.2e-68	59.6
AZD59955.1\|2234080_2234614_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.9e-36	46.5
AZD59956.1\|2234610_2235192_+\|plate	Baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	3.3e-54	56.9
AZD59957.1\|2235234_2235450_+	hypothetical protein	NA	NA	NA	NA
AZD59958.1\|2235452_2235779_+\|plate	Phage baseplate assembly protein	A0A2H4JA09	uncultured_Caudovirales_phage	6.2e-34	65.1
AZD59959.1\|2235775_2236657_+\|plate	Baseplate assembly protein J	A0A2H4JFK9	uncultured_Caudovirales_phage	6.4e-110	70.0
AZD59960.1\|2236658_2237267_+\|tail	Phage tail fiber	A0A2H4JDH5	uncultured_Caudovirales_phage	1.4e-79	72.2
AZD59961.1\|2237259_2238816_+\|tail	Phage tail fiber protein	A0A077K818	Ralstonia_phage	1.5e-69	46.0
AZD59962.1\|2238825_2239254_+\|tail	Phage tail fiber assembly protein	Q9ZXK5	Pseudomonas_virus	1.4e-33	52.9
AZD59963.1\|2239352_2240516_+\|tail	Phage tail sheath monomer	A0A2H4J869	uncultured_Caudovirales_phage	6.4e-182	81.2
AZD59964.1\|2240528_2241038_+\|tail	Phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	6.2e-65	72.5
AZD59965.1\|2241062_2241359_+	hypothetical protein	A0A2H4J873	uncultured_Caudovirales_phage	2.7e-20	57.4
AZD59966.1\|2241490_2244100_+	Phage protein	A0A2H4JG00	uncultured_Caudovirales_phage	5.4e-80	33.4
AZD59967.1\|2244109_2244955_+	Phage protein U	A0A2H4J875	uncultured_Caudovirales_phage	8.7e-88	58.2
AZD59968.1\|2244929_2245220_+\|tail	Phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	1.0e-19	68.7
AZD59969.1\|2245191_2246244_+\|tail	Phage tail protein D	A0A2H4JBF6	uncultured_Caudovirales_phage	3.5e-147	74.9
AZD59970.1\|2246267_2246819_+	Phage endolysin	A0A2H4JHX4	uncultured_Caudovirales_phage	4.2e-67	69.2
AZD59971.1\|2247089_2247314_+	hypothetical protein	NA	NA	NA	NA
AZD59972.1\|2248201_2248621_+	Type II, N-methyl DNA methyltransferase (group alpha)	Q5ZQW7	Pseudomonas_phage	8.2e-31	73.3
AZD59973.1\|2248944_2249517_+	hypothetical protein	NA	NA	NA	NA
AZD59974.1\|2249998_2250673_+	hypothetical protein	NA	NA	NA	NA
AZD59975.1\|2251536_2252199_+	hypothetical protein	NA	NA	NA	NA
AZD59976.1\|2252925_2253540_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AZD59977.1\|2253657_2254512_+	Transcriptional regulator	NA	NA	NA	NA
AZD59978.1\|2254564_2255053_-	hypothetical protein	NA	NA	NA	NA
AZD59979.1\|2255310_2256873_+	Two-component transcriptional response regulator, LuxR family	NA	NA	NA	NA
AZD59980.1\|2256876_2257467_-	Acetyltransferase	NA	NA	NA	NA
AZD59981.1\|2257654_2258491_+	N-hydroxyarylamine O-acetyltransferase	NA	NA	NA	NA
AZD59982.1\|2258532_2258925_-	hypothetical protein	NA	NA	NA	NA
AZD59983.1\|2258986_2259406_-	hypothetical protein	NA	NA	NA	NA
AZD59984.1\|2263295_2263529_+	hypothetical protein	NA	NA	NA	NA
AZD59985.1\|2263535_2263814_-	hypothetical protein	NA	NA	NA	NA
AZD59986.1\|2263862_2265059_-	aromatic-amino-acid aminotransferase	NA	NA	NA	NA
AZD59987.1\|2265391_2267407_+	Excinuclease ABC subunit B	NA	NA	NA	NA
AZD59988.1\|2269078_2270140_-	Membrane fusion component of MSF-type tripartite multidrug efflux system	NA	NA	NA	NA
AZD59989.1\|2270377_2271859_+\|tRNA	Glutamyl-tRNA synthetase	NA	NA	NA	NA
AZD59990.1\|2272792_2273332_+	Transcriptional regulator, AcrR family	NA	NA	NA	NA
AZD59991.1\|2273361_2274195_+	Putative hydrolase	NA	NA	NA	NA
AZD59992.1\|2274243_2274681_+	4-hydroxybenzoyl-CoA thioesterase domain protein	NA	NA	NA	NA
AZD59993.1\|2274780_2275740_+\|tRNA	tRNA-dihydrouridine(16) synthase	NA	NA	NA	NA
AZD59994.1\|2275861_2276308_+	Small heat shock protein	A0A1D8KN82	Synechococcus_phage	2.2e-18	37.0
AZD59995.1\|2276492_2277191_+\|tRNA	putative tRNA ligase	NA	NA	NA	NA
AZD59996.1\|2277187_2279872_+	Putative molecular chaperone, DnaJ family	NA	NA	NA	NA
AZD59997.1\|2281667_2284946_-	Sensory box/GGDEF family protein	A0A127AWB9	Bacillus_phage	3.8e-14	31.2
AZD59998.1\|2285026_2285917_-	Cys regulon transcriptional activator CysB	NA	NA	NA	NA
AZD59999.1\|2286061_2287480_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AZD60000.1\|2287490_2288135_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZD60001.1\|2288362_2289445_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AZD60002.1\|2289462_2289627_-	hypothetical protein	NA	NA	NA	NA
AZD60003.1\|2289636_2290611_+	Aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZD60004.1\|2292006_2294622_+	putative type IV pilus assembly FimV-related transmembrane protein	NA	NA	NA	NA
AZD60005.1\|2294700_2295066_-	Xaa-Pro aminopeptidase	NA	NA	NA	NA
AZD60006.1\|2295559_2296414_+\|tRNA	tRNA pseudouridine(38-40) synthase	NA	NA	NA	NA

DBSCAN-SWA_4

3882997 : 3886126

uncultured_Caudovirales_phage(100.0%)

tail,integrase

attL 3874471:3874485|attR 3886238:3886252

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3874471:3874485	attL	NA	NA	NA	NA
AZD61381.1\|3882997_3883462_-	Lytic enzyme	A0A2H4JHX4	uncultured_Caudovirales_phage	1.6e-56	69.3
AZD61382.1\|3883571_3884624_-\|tail	Phage tail protein D	A0A2H4JBF6	uncultured_Caudovirales_phage	1.4e-148	75.2
AZD61383.1\|3884595_3884886_-\|tail	Phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.9e-19	67.2
AZD61384.1\|3884860_3885349_-	Phage protein U	A0A2H4J875	uncultured_Caudovirales_phage	8.3e-59	65.8
AZD61385.1\|3885429_3885807_+\|integrase	Phage-related integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	1.2e-41	70.7
AZD61386.1\|3885829_3886126_+	Integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	3.5e-20	59.4
3886238:3886252	attR	NA	NA	NA	NA

DBSCAN-SWA_5

4457005 : 4479317

Bacillus_virus(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD61826.1\|4457005_4457278_-	DNA-binding protein HU-beta	A7KV42	Bacillus_phage	1.4e-18	58.4
AZD61827.1\|4457425_4459822_-\|protease	ATP-dependent protease La Type I	A0A0R6PGP8	Moraxella_phage	2.0e-222	52.1
AZD61828.1\|4459984_4460731_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	6.1e-77	59.8
AZD61829.1\|4460742_4460916_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	8.1e-09	72.5
AZD61830.1\|4460909_4461266_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	4.8e-24	55.8
AZD61831.1\|4461372_4462014_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.2e-58	59.1
AZD61832.1\|4462107_4463418_-	Cell division trigger factor	NA	NA	NA	NA
AZD61833.1\|4464454_4465309_+	Methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	6.4e-30	34.3
AZD61834.1\|4465725_4466529_+	Murein-DD-endopeptidase	NA	NA	NA	NA
AZD61835.1\|4466619_4467294_-	TPR domain protein	NA	NA	NA	NA
AZD61836.1\|4467516_4467684_+	hypothetical protein	NA	NA	NA	NA
AZD61837.1\|4467764_4468526_-	putative membrane protein	A0A0R6PEZ3	Moraxella_phage	2.0e-38	37.9
AZD61838.1\|4468557_4468806_-	putative lipoprotein	NA	NA	NA	NA
AZD61839.1\|4468868_4469846_+	Transcriptional regulator, LysR family	NA	NA	NA	NA
AZD61840.1\|4469852_4471007_-	putative MFS-type transporter	NA	NA	NA	NA
AZD61841.1\|4472620_4473130_-	hypothetical protein	NA	NA	NA	NA
AZD61842.1\|4473267_4473918_+	Virulence factor mviM	NA	NA	NA	NA
AZD61843.1\|4473991_4474510_-	Auxin-binding protein, putative	NA	NA	NA	NA
AZD61844.1\|4474618_4475437_-	Shikimate 5-dehydrogenase I gamma	NA	NA	NA	NA
AZD61845.1\|4475690_4476047_+	hypothetical protein	NA	NA	NA	NA
AZD61846.1\|4476296_4476491_+	hypothetical protein	NA	NA	NA	NA
AZD61847.1\|4476599_4476782_+	hypothetical protein	NA	NA	NA	NA
AZD61848.1\|4478012_4479317_+\|protease	putative protease YegQ	Q6DW11	Phage_TP	6.1e-141	72.5

DBSCAN-SWA_6

4883644 : 4893612

Pseudomonas_phage(44.44%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD62155.1\|4883644_4884469_-	Phage internal (core) protein	A0A1B2AN65	Pseudomonas_phage	4.8e-67	48.7
AZD62156.1\|4884489_4885245_-	Phage internal (core) protein	F0V704	Pseudomonas_phage	5.6e-46	47.4
AZD62157.1\|4885304_4887548_-	Phage internal (core) protein	A0A0A0YQX6	Pseudomonas_phage	1.1e-142	41.3
AZD62158.1\|4887593_4888625_-	hypothetical protein	A0A192Y9X9	Morganella_phage	5.0e-37	31.8
AZD62159.1\|4888612_4889830_-	Phage internal (core) protein	W6PJL2	Cronobacter_phage	5.9e-61	35.8
AZD62160.1\|4890083_4890362_+\|transposase	ISxac3 transposase	U5P4I9	Shigella_phage	2.0e-17	58.8
AZD62161.1\|4890352_4891234_+\|transposase	ISxac3 transposase	U5P429	Shigella_phage	3.9e-99	63.3
AZD62162.1\|4891249_4891672_-	Phage internal (core) protein	A0A170PBD2	Pseudomonas_phage	1.3e-36	57.9
AZD62163.1\|4892830_4893022_-	hypothetical protein	NA	NA	NA	NA
AZD62164.1\|4893018_4893612_-	hypothetical protein	A6XMM0	Bacillus_virus	4.3e-09	27.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage