CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027727	Pseudomonas sp. R5-89-07 chromosome, complete genome	1 crisprs	DEDDh,DinG,csa3,cas3	4	4	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027727_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027727_4

3936535-3936679

Orphan

Consensus_repeat	Method
GATGAGGCCAGCCCCGTCACCGCCAATCAGACAGCCAGCAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027727_4

>merge|CP027727|4|3936535-3936679|CRISPRCasFinder
GATGAGGCCAGCCCCGTCACCGCCAATCAGACAGCCAGCAACCTGCCGTCTCCCCCATCTCGATTTGTGAACACTTTCAAATGTGGAAGGGGGCTTGCCCCCGATGAGGCCAGCCCAGTCACCGCCAATCAGACAGCCAGCAACC

>CP027727|4|3|3936535-3936679|CRISPRCasFinder
GATGAGGCCAGCCCCGTCACCGCCAATCAGACAGCCAGCAACC	TGCCGTCTCCCCCATCTCGATTTGTGAACACTTTCAAATGTGGAAGGGGGCTTGCCCCC
GATGAGGCCAGCCCAGTCACCGCCAATCAGACAGCCAGCAACC

Protein	Signature genes	Signature genes Name	Protein_function
CP027727.1\|AZF06349.1\|3922917_3924336_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|235490
CP027727.1\|AZF06357.1\|3933511_3934051_-\|Transcriptional-regulator,-AcrR-family	unknown	unknown	gnl\|CDD\|224228
CP027727.1\|AZF06354.1\|3931174_3932134_-\|tRNA-dihydrouridine(16)-synthase	unknown	unknown	gnl\|CDD\|236713
CP027727.1\|AZF06356.1\|3932663_3933497_-\|Putative-hydrolase	unknown	unknown	gnl\|CDD\|366166
CP027727.1\|AZF06353.1\|3929826_3930786_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
CP027727.1\|AZF06367.1\|3945829_3946840_+\|Cobalt-ABC-transporter,-periplasmic-substrate-binding-component-CbtJ	unknown	unknown	gnl\|CDD\|238568
CP027727.1\|AZF06350.1\|3924476_3925367_+\|Cys-regulon-transcriptional-activator-CysB	unknown	unknown	gnl\|CDD\|223656
CP027727.1\|AZF06365.1\|3943357_3944419_-\|putative-metalloprotease	unknown	unknown	gnl\|CDD\|341060
CP027727.1\|AZF06358.1\|3934889_3936371_-\|Glutamyl-tRNA-synthetase	unknown	unknown	gnl\|CDD\|234953
CP027727.1\|AZF06352.1\|3928779_3929736_-\|hypothetical-protein	unknown	unknown	unknown
CP027727.1\|AZF06369.1\|3947837_3948602_+\|Cobalt-ABC-transporter,-ATP-binding-component-CbtL	unknown	unknown	gnl\|CDD\|224045
CP027727.1\|AZF06368.1\|3946836_3947841_+\|Cobalt-ABC-transporter,-permease-component-CbtK	unknown	unknown	gnl\|CDD\|376439
CP027727.1\|AZF06361.1\|3940316_3940526_+\|hypothetical-protein	unknown	unknown	unknown
CP027727.1\|AZF06363.1\|3941549_3942941_+\|Succinate-semialdehyde-dehydrogenase-(NAD)	unknown	unknown	gnl\|CDD\|184426
CP027727.1\|AZF06366.1\|3944553_3945483_+\|DNA/RNA-non-specific-endonuclease	unknown	unknown	gnl\|CDD\|224777
CP027727.1\|AZF06362.1\|3940571_3941444_-\|LysR-family-transcriptional-regulator-YneJ	unknown	unknown	gnl\|CDD\|176133
CP027727.1\|AZF06351.1\|3925433_3928712_+\|Sensory-box/GGDEF-family-protein	unknown	unknown	gnl\|CDD\|238923
CP027727.1\|AZF06355.1\|3932189_3932624_-\|4-hydroxybenzoyl-CoA-thioesterase-domain-protein	unknown	unknown	gnl\|CDD\|223894
CP027727.1\|AZF06364.1\|3943026_3943329_-\|hypothetical-protein	unknown	unknown	unknown
CP027727.1\|AZF06360.1\|3939020_3940217_+\|aromatic-amino-acid-aminotransferase	unknown	unknown	gnl\|CDD\|181731

Protein	Function_ID	Function_description	E-value
CP027727.1\|AZF06349.1\|3922917_3924336_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|235490	PRK05478, PRK05478, 3-isopropylmalate dehydratase large subunit.	0
CP027727.1\|AZF06357.1\|3933511_3934051_-\|Transcriptional-regulator,-AcrR-family	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.12798e-09
CP027727.1\|AZF06362.1\|3940571_3941444_-\|LysR-family-transcriptional-regulator-YneJ	gnl\|CDD\|176133	cd08442, PBP2_YofA_SoxR_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.68299e-84
CP027727.1\|AZF06356.1\|3932663_3933497_-\|Putative-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	8.45874e-12
CP027727.1\|AZF06353.1\|3929826_3930786_-\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	5.13841e-05
CP027727.1\|AZF06350.1\|3924476_3925367_+\|Cys-regulon-transcriptional-activator-CysB	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.29393e-55
CP027727.1\|AZF06366.1\|3944553_3945483_+\|DNA/RNA-non-specific-endonuclease	gnl\|CDD\|224777	COG1864, NUC1, DNA/RNA endonuclease G, NUC1 [Nucleotide transport and metabolism].	1.93421e-55
CP027727.1\|AZF06358.1\|3934889_3936371_-\|Glutamyl-tRNA-synthetase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
CP027727.1\|AZF06360.1\|3939020_3940217_+\|aromatic-amino-acid-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0
CP027727.1\|AZF06368.1\|3946836_3947841_+\|Cobalt-ABC-transporter,-permease-component-CbtK	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.04832e-75
CP027727.1\|AZF06367.1\|3945829_3946840_+\|Cobalt-ABC-transporter,-periplasmic-substrate-binding-component-CbtJ	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	1.66959e-98
CP027727.1\|AZF06363.1\|3941549_3942941_+\|Succinate-semialdehyde-dehydrogenase-(NAD)	gnl\|CDD\|184426	PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional.	0
CP027727.1\|AZF06355.1\|3932189_3932624_-\|4-hydroxybenzoyl-CoA-thioesterase-domain-protein	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	8.09588e-32
CP027727.1\|AZF06369.1\|3947837_3948602_+\|Cobalt-ABC-transporter,-ATP-binding-component-CbtL	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	6.30591e-97
CP027727.1\|AZF06351.1\|3925433_3928712_+\|Sensory-box/GGDEF-family-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	2.21797e-112
CP027727.1\|AZF06354.1\|3931174_3932134_-\|tRNA-dihydrouridine(16)-synthase	gnl\|CDD\|236713	PRK10550, PRK10550, tRNA dihydrouridine(16) synthase DusC.	7.01382e-90
CP027727.1\|AZF06365.1\|3943357_3944419_-\|putative-metalloprotease	gnl\|CDD\|341060	cd09597, M4_TLP, Peptidase M4 family including thermolysin, protealysin, aureolysin, and neutral protease. This peptidase M4 family includes several endopeptidases such as thermolysin (EC 3.4.24.27), aureolysin (the extracellular metalloproteinase from Staphylococcus aureus), neutral protease from Bacillus cereus, protealysin, and bacillolysin (EC 3.4.24.28). Typically, the M4 peptidases consist of a presequence (signal sequence), a propeptide sequence, and a peptidase unit. The presequence is cleaved off during export while the propeptide has inhibitory and chaperone functions and facilitates folding. The propeptide remains attached until the peptidase is secreted and can be safely activated. All peptidases in this family bind a single catalytic zinc ion which is tetrahedrally co-ordinated by three amino acid ligands and a water molecule that forms the nucleophile on activation during catalysis. The active site is found between two sub-domains; the N-terminal domain contains the HEXXH zinc-binding motif while the helical C-terminal domain, which is unique for the family, carries the third zinc ligand. These peptidases are secreted eubacterial endopeptidases from Gram-positive or Gram-negative sources that degrade extracellular proteins and peptides for bacterial nutrition. They are selectively inhibited by Steptomyces metalloproteinase inhibitor (SMPI) as well as by phosphoramidon from Streptomyces tanashiensis. A large number of these enzymes are implicated as key factors in the pathogenesis of various diseases, including gastritis, peptic ulcer, gastric carcinoma, cholera and several types of bacterial infections, and are therefore important drug targets. Some enzymes of the family can function at extremes of temperatures, while some function in organic solvents, thus rendering them novel targets for biotechnological applications. Thermolysin is widely used as a nonspecific protease to obtain fragments for peptide sequencing. It has also been used in production of the artificial sweetener aspartame.	1.18477e-132

>CP027727.1|AZF06358.1|3934889_3936371_-|Glutamyl-tRNA-synthetase
MTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFDALRWLGITWAEGPDVGGPHGPYRQSERSDIYKQYTQQLVDMGHAFPCFCTAEELDQMRAEQQARGETPRYDGRALLLSKEEVAARLAAGEPHVIRMKVPSEGVCVVPDMLRGDVEIPWDRMDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWEQPQLCYMPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREKFSLQEMVDNFDLSRVSLGGPIFDIEKLSWLNGQWLRDLPVEEFASRVQQWALNPEYMMKIAPLVQGRVETFSQVAPLASFFFAGGVNPDAKLFESKKLSADQVRQLMQLILWKLESLRQWEKDAITATIQAVVESLELKLRDAMPLMFAAITGQASSVSVLDAMEILGPDLTRFRLRQALDLLGGVSKKENKEWEKLLGAIA
>CP027727.1|AZF06357.1|3933511_3934051_-|Transcriptional-regulator,-AcrR-family
MSDKKAQTRERILQAASSALIQRGPAEPSVGEVMGAAGLTVGGFYAHFESKDALMLEAFTKLLAKRRAAIEEVDSQLSGEERRSLVAAFYLSRKHRDSTAQACPLPATVGEMGRLPDAFRQVLSEHCELMAAQLAASPEDTDKALADMALMVGGLTLARALGPGELSDRVLRAAKSAVR
>CP027727.1|AZF06356.1|3932663_3933497_-|Putative-hydrolase
MGSLTWVRGFNRTVGRLAPQTVANSMRRTFMTPRELPPREWELPLLAQSERITLRFGLSALRWGQGPAVLLMHGWEGRPTQFASLITALVDNGYSVIALDGPAHGHSPGREAHVLLFARAMLEAAAELPPLHAVVGHSMGGASAMLAVQLGLRTQALVSIAAPSRFLDVLRGFTRMMGLPPRARSAFIQEVELAFGMPLKHLDVAHYHMNLPGLIVHAEDDTFVPVKASLAIHEAWFDSRLLRLEQGGHQKVLADPRVIEGVLTLLASCHLQQRQTA
>CP027727.1|AZF06355.1|3932189_3932624_-|4-hydroxybenzoyl-CoA-thioesterase-domain-protein
MGWDLATPFIIDLQVAPEDIDGLGHANNAVYVSWLERCAWRHSQRLGLDLTEYRRLDRAMAVVRHEIDYLAAGYEGDELQLATWIVDWDQRLKMTRRFQLVRPRDGATLLRAQTTFVCIELSSGRPKRMPAEFVEGYGPALTGG
>CP027727.1|AZF06354.1|3931174_3932134_-|tRNA-dihydrouridine(16)-synthase
MQIALAPMEGLVDNILRDVLTRVGGIDWCVTEFIRVNDRLLTPAYFYKLAPELLHGAHTAAGVPLRVQLLGSDPVCLAENAALACELGSQVIDLNFGCPAKTVNKSRGGAVLLKEPELLNRIVEHVRRAVPAHIPVTAKMRLGFDSPDGALVCATALAEGGAAHIVVHARTKTDGYKPPAHWEWIPRVQDVVKVPVFANGDIWSVEDWKRCREVSGAEDIMLGRGLVARPDLARQIAAARAGQEVVEMTWTQMQPMLQEFWTQSVAQLTERQAPGRLKQWLAMLTRNYPEAVELFTAMRRETDLEQVSRLLGMPHPMVA
>CP027727.1|AZF06353.1|3929826_3930786_-|hypothetical-protein
MSMSINTPPMAKFDTSAVDQQAVSKNKAVIDSNTQSLGTTPPQTSLRPDGTQGLHNRVVTPETALAQLFDMLEGIFKAMRDIFSGKTALKPDSGKLPITPDTNKELARPDAGKLLVKPDTSKEPTKPGVDKLPVLPNTRKELTKPDAGTLPVVPDAGKELTKPDVDKSPVLPKPSDLPVLVPDGNKPRPLPFPPTVPKPEVSVNNDPKANVQVNVVVSHCHCPDGKVLPERLPTPKVSVDTRPQPPVLPDAKPQPPVLPGNFPRPNVPMDTKPQPAVLPDNKPAPLPDAPTPDLTSPGPVDDRSAGRHGRFNHRLSSRF
>CP027727.1|AZF06352.1|3928779_3929736_-|hypothetical-protein
MSLFPINNIARVIDVRRSLPIESLSASNERTIEANVSRESISATPVMAYRDRPQHSAGIGNDSEAINAVVALFTSFFTQLLALVTDKKERNRPDGVPLPSPVVPQVIPQPVLPKPDATAQIPGLSGKRNGAKPDNIWSGFRQGPDGNCVTVSAIKAAMYRFGQSPTDIFKEVARTHDGYQVVMRDGFRLTLTDRELAEGARGAQFNGPDKGMLKDAQFLFAVSAKRAQMENNDGTAGRSYQAAIRSLNNGEDETGPGEGFLRLGLRSHMKRVPVRELAQGQIGMCNRTGHSVAVINGREELWGKQGRVPTHGQAVALI
>CP027727.1|AZF06351.1|3925433_3928712_+|Sensory-box/GGDEF-family-protein
MPNPVDSVPPLPRIYALDPQEAEQRWDSAPQLLSALNAARLGAWCWEIDTGKISWSRGTQALFGYDPRQPLSNDLNYLDLLAPEDRARVVRAFHAVLAGEPVEQAMHHRIQWPDGSLHWLEINGSLVPDKNGRRRMIGVIREITHQREREHALSHSEKRFATLFHLCPNMVLLTRQTDGLISEANHHFEMLFGWPVAAAIGRTTLELGLWRHPEQRAQLVKATQRKGESITMEVQFCASNGQIHDGTLSAQKVELEGEAYLISTFLDTTERKNAEQALKDSQERLDLALDSAQLGTWDWHIPSGMLYGSARAAQLHGLPCEPFHESFDAFFEGMSDEDREGMRHAYRTLREGPDGNYQLTYRVLLEDGSPRYLESRARLYRDESGKPLRMAGTLLDITDQVERELRLSASEEKFASLFQASPDPICVTCLDSGAFTEINPAFTQTFGWTAAEVLDKSAEQIGLWDESSKRLQRIEQVIREQSLSNVAIVVHAKNGQSLTCVISSRLIKVSEQPCIVTTLRDITQQQRSEAALKASEEKFAKAFHSSPDAISITERDTGRYVEVNDGFCRLTGYRAEEAIGLTLYQIGIWADENQRTALLAELEIKGRIHHLEMLWHNKRGEVLAVEVSVEPITLNETPCLLLTARDVSLLKNAQAQIRHLAYHDPLTNLPNRALLMDRLSQQIALLKRHNLRGALLFLDLDHFKHINDSLGHPVGDTVLKIVTARLEASVRMEDTVARLGGDEFVVLLSGLEGSRTQVGGQVQELADTLRELLSEPMFLDGHRLQVTPSIGVALIPDHGTTPADLLKRADIALYRAKDSGRNTTQMFHNSMQKTASERLRMETDLRLALSRGEFSVHYQPQVDARGNRIVGAEALVRWQHPQLGAQSPTEFIKVLEDSGLILEVGTWILDEACGAFARLIAEGLVDPLSFSLCVNISPRQFRQNDFVERVERSLTQHQLPYSLLKLEITEGIVIQNLDDTVMKMRRLKKLGVSFAMDDFGTGYSSLTYLKRLPVDALKIDQSFVRDATHDPNDAEIIRAIVAMARSLNLEVIAEGVETEEQLAFLQRLGCHLYQGYLHSRPLPIEGFRQLLG
>CP027727.1|AZF06350.1|3924476_3925367_+|Cys-regulon-transcriptional-activator-CysB
MDLANLNAFIAIAETGSFSGAGERLHLTQPAISKRIAGLEQQLKVRLFDRLGREVGLTEAGRALLPRAYQILNVLDDTRRALTNLTGEVSGRLTLATSHHIGLHRLPPILRTFTRQYPNVALDIQFLDSEVAYEEILHGRAEVAVITLAPEPHNLVRATPVWDDPLDFVVAPEHSLISNGTVNLADIAGHPAVFPGGNTFTHHIVSRLFEAQGLTPNIAMSTNYLETIKMMVSIGLAWSVLPRTMLDDQVASIALPGIQLSRQLGYIVHTERTLSNAARAFMSLLDAQVDLPGVPA
>CP027727.1|AZF06349.1|3922917_3924336_-|3-isopropylmalate-dehydratase-large-subunit
MAGKTLYDKLWDSHEVKRRDDGSSLIYIDRHIIHEVTSPQAFEGLRLAGRKPWRVDSIIATPDHNVPTTPERKGGIDAIVDTVSRLQVQTLDDYCDEYGITEFKMNDVRQGIVHVIGPEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEHVFATQCLVAKKMKNMLVRVEGLLPFGVTAKDIVLAVIGKIGTAGGNGHAIEFAGSAIRDLSIEGRMTICNMSIEAGARVGMVAADEKTVEYVKGRPFAPQGADWDAAVQAWKDLVSDADAVFDTVVELDATQIKPQVSWGTSPEMVLAVDQNVPDPAQEADLVKRGSIERALKYMGLKANQAITDIQLDRVFIGSCTNSRIEDLRAAAVIAKGRKVASTIKQAIVVPGSGLVKAQAEAEGLDKIFLEAGFEWREPGCSMCLAMNPDRLESGEHCASTSNRNFEGRQGAGGRTHLVSPAMAAAAAVNGRFIDVRELI
>CP027727.1|AZF06360.1|3939020_3940217_+|aromatic-amino-acid-aminotransferase
MSLFSAVEMAPRDPILGLNEAFNADTRTTKVNLGVGVYCDEGGKIPLLRAVAEAEAIRVAQHAARGYLPIDGIAAYDKAVQTLLFGADSPLLEASRVVTVQAVGGTGALKIGADFLKQLLPNAVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRAGLLEDLNALPPQSIVVLHACCHNPTGVDLSPADWQNVLDVVKARNLVPFLDMAYQGFGDGIHEDAAAVRLFAESGLTFFVSSSFSKSFSLYGERVGALSIVSDSKEESARILSQVKRVIRTNYSNPPTHGAAIVAAVLNNPELRAQWEAELAEMRLRIRGMREQMVAELAKAAPGHDFSFVGRQRGMFSYSGLSVEQVTRLRSEFGIYALDTGRICVAALNQSNIGAVTKAIVQVL
>CP027727.1|AZF06361.1|3940316_3940526_+|hypothetical-protein
MRNDDLDLRADRDELHDYAPRAPQAKRQKSLVLQVALGVFLGGLALWLVQLGATAIMAKLAMGTLQFGG
>CP027727.1|AZF06362.1|3940571_3941444_-|LysR-family-transcriptional-regulator-YneJ
MDLVQLEIFKAVAEQGSISAAAQLIHRVPSNLTTRIKQLEQDLGVELFIREKSRLRLSPAGWNFLGYARRILDLVQEARATVAGEEPQGAFALGSLESTAAVRIPALLAAYNQKHTKVELDLSTGPSGTMIEGVLSGRLTAAFVDGPVLHSTLEGVAVFEEEMVVIAPLHHAPITRGREVNGENIYTFRSNCSYRHHFERWFSQDGAMPGKIFEIESYHGMLACVSAGAGLALMPRSMLENMPGFAAVSVWPLADSYRVLNTWLIWRRGTVSQSLNSFVKLLEERGLVAA
>CP027727.1|AZF06363.1|3941549_3942941_+|Succinate-semialdehyde-dehydrogenase-(NAD)
MNAISHQTHALSINPANGETVASYVYESPSQLDAALDRSTAAFRTWRRQPVGQRAELLLALASALRDQAEAMAQMITLEMGKPIAQARAEIEKCAQLSEWYAEHGPAMLAPEPTLVDNGSAQIEYRPLGPILAVMPWNFPVWQVLRGAIPTLLAGNTYVLKHAPNVMGSAYLIQQAFQKAGFAEGLFEVINVTTEGVSSAIADPRIAAVTLTGSVRAGIAIGSQAGAALKKCVLELGGSDPFIVLNDADLDAAVQAALIGRFQNSGQVCAAAKRLIIEAGVVEAFTAKFLEASRNLVMGDPTSAATYIGPMARFDLRDELHGQVQATLEEGATLLLGGNKVAGAGNYYEPTVLADVTDQMTSFRQELFGPVASIITARDADHAVALANDSEFGLTASIFTADPAKARDIANQLETGGIFVNAFSVSDPRVAFGGIKKSGFGRELSHFGVREFCNAQTVWFDRK
>CP027727.1|AZF06364.1|3943026_3943329_-|hypothetical-protein
MRISIKENGGPAFFPGLAQPRSVELDALPEQDQQELRQLVEESKFFQLPQSTQPSGNPGQVHYTLTVTEGEREHTVCVLAPVKPQALDGLVQCVRRHIRC
>CP027727.1|AZF06365.1|3943357_3944419_-|putative-metalloprotease
MCVRQPRNPIFCLIPPYMLDQIARHGDKAQREVALRTRAKDSTFRSLRMVAVPAKGPARMALAAGAEKQRSIYSAENTDSLPGKLIRGEGQPASGDAAVDEAYDGLGATFDFFDQVFDRNSIDDAGMALDATVHFGQDYNNAFWNSTQMVFGDGDQQLFNRFTVALDVIGHELAHGVTEDEAKLMYFNQSGALNESLSDVFGSLIKQYALQQKAEDADWLIGKGLFTKKIKGTALRSMKAPGTAFDDKLLGKDPQPGHMDDFVQTYDDNGGVHINSGIPNHAFYQVATRIGGFAWERAGRIWYDALRDARLRPNSGFLRFARITYDVAGRLYGANKDEQKAVKEGWKAVGINV
>CP027727.1|AZF06366.1|3944553_3945483_+|DNA/RNA-non-specific-endonuclease
MPTRNVKIDLAYRPRLADLRPLITPTRSLLEARATAPRVTAAKDLQDRRGYAEDFLGSFGVPWPTLDPAQASDAQPGRLDYTHFSISMSRSRRLALCVGVNIDGAKHVDIVRSNDTWAYDGRLPIDAQVGEDLYAGNGLDRGHLVRRQDPNWGDDANTANGDTFHFTNCSPQMSGFNQKTWLELEDYILDNNQRWKARASVFTGPVFADDDRLYRGVKIPKAFWKVVAYLSDDGKPSASAYMIDQSRELGQLDLVFGPLRTYQRSVIQIEQLTGIHFGNLADYDGFSNEERATGTRIEALIREPGDIRL
>CP027727.1|AZF06367.1|3945829_3946840_+|Cobalt-ABC-transporter,-periplasmic-substrate-binding-component-CbtJ
MLPRITALIIGLGCCALAQAAPTHFPLTLENCGNPITFQQAPARSVTIGQAATEMLYALGVGDKVVGTSLWFNDVLPQYKAQNDNVERLANNEPSFEAVIAKRPQLVAAELEWVVGPQGVVGTREQFHELNIPTYLLPSDCEAKDNRVGADGTRLEAFRIETIYKSLSQLAEIFDVQARGQQLTDQLKARLATSIATAQRKGLKQASALVWFSSAEMASDPYVAGHKGVPELMLQTLGLRNVVQSDEEWPAVGWETIAKANPTFLVIARMDRRRYPADDHEKKLAFLRSDPVTRNMDAVKHNRIIILDALALQASLRTFDGLEQLSAAIDGYDLPQ
>CP027727.1|AZF06368.1|3946836_3947841_+|Cobalt-ABC-transporter,-permease-component-CbtK
MIRTLLALTLLLVALLAGVAIGETAISPQVVLQVLANKLWAAGYALDPIDEGVVWNYRLTRALVAGACGAGLATCGVILQSLLRNPLADPYLLGISAGASTGAVLIALIGVGGGLISLSAGAFVGAMAAFALVILLARASGSSSGTGQIILAGIAGSQLFNALTAFLITKSASSEQARGIMFWLLGNLSGVRWPSVWLAVPVALAGLVVCLWHRRALDAFTFGTDSAASLGIPVRRVQFVLVGCAAVVTAVMVSIVGSIGFVGLVIPHAARLILGTAHSRLLPASALGGALFLIAADVLSRTLIKGQVIPVGVVTALVGAPVFALILIGRRNAR
>CP027727.1|AZF06369.1|3947837_3948602_+|Cobalt-ABC-transporter,-ATP-binding-component-CbtL
MNVLSCSGLGFRVREAQLLRDINLQVASGETLGIVGPNGSGKSTLLKLLAGLRTPANGEVRLGDQRLGDLSRRTIAQQMAVVEQQADTDDAIRVFDAVALGRTPWLSALSPWSSEDDAIVRQALHDVDATHLSHRAWRSLSGGERQRVHIARALAQRPQILLLDEPTNHLDIQHQLTILKGVQALPVTTLIALHDLNQALTCDRLAVLDRGRLVALGTPLQVLTPERLQETFGVQGHYLTDPFDGAQILRLRST

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP027727_1	1.1\|761296\|18\|CP027727\|CRT	761296-761313	18	CP027727.1	761272-761289	1	0.944
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	CP027727.1	761272-761301	1	0.967
CP027727_1	1.4\|761428\|18\|CP027727\|CRT	761428-761445	18	CP027727.1	761272-761289	1	0.944
CP027727_1	1.6\|761512\|18\|CP027727\|CRT	761512-761529	18	CP027727.1	761272-761289	1	0.944

1. spacer 1.1|761296|18|CP027727|CRT matches to position: 761272-761289, mismatch: 1, identity: 0.944

tgccgccgcccgtgccac	CRISPR spacer
tgccgccgcctgtgccac	Protospacer
**********.*******

2. spacer 1.3|761380|30|CP027727|CRT matches to position: 761272-761301, mismatch: 1, identity: 0.967

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccgcctgtgccaccgcctgtgccgc	Protospacer
**********.*******************

3. spacer 1.4|761428|18|CP027727|CRT matches to position: 761272-761289, mismatch: 1, identity: 0.944

tgccgccgcccgtgccac	CRISPR spacer
tgccgccgcctgtgccac	Protospacer
**********.*******

4. spacer 1.6|761512|18|CP027727|CRT matches to position: 761272-761289, mismatch: 1, identity: 0.944

tgccaccgcctgtgccac	CRISPR spacer
tgccgccgcctgtgccac	Protospacer
****.*************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	MN694015	Marine virus AFVG_250M337, complete genome	23659-23688	2	0.933
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	MN694052	Marine virus AFVG_250M52, complete genome	15768-15797	2	0.933
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	318179-318208	3	0.9
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	244280-244309	4	0.867
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	137588-137617	4	0.867
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	318179-318208	4	0.867
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	244280-244309	4	0.867
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	137588-137617	4	0.867
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP014683	Kozakia baliensis strain NBRC 16680 plasmid pKB16680_2, complete sequence	36676-36705	4	0.867
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP014676	Kozakia baliensis strain DSM 14400 plasmid pKB14400_2, complete sequence	9344-9373	4	0.867
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	244280-244309	4	0.867
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NC_013859	Azospirillum sp. B510 plasmid pAB510e, complete sequence	142600-142629	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	AY616033	Burkholderia cenocepacia phage BcepB1A, complete genome	36373-36402	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	468597-468626	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	944187-944216	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	468606-468635	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	868939-868968	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	468488-468517	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP032324	Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence	429638-429667	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	359219-359248	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	216803-216832	5	0.833
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	AY616033	Burkholderia cenocepacia phage BcepB1A, complete genome	36373-36402	5	0.833
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	NZ_CP014598	Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence	250827-250856	5	0.833
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	244268-244297	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	95406-95435	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	95406-95435	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP035512	Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence	332583-332612	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	57651-57680	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	47059-47088	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	265161-265190	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1142527-1142556	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	KY365739	Streptomyces phage BabyGotBac, complete genome	23417-23446	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MH178382	Streptomyces phage Salete, complete genome	23417-23446	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	JN698995	Mycobacterium phage Dori, complete genome	29873-29902	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	KU189325	Streptomyces phage Maih, complete genome	23416-23445	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MH178381	Streptomyces phage BayC, complete genome	23417-23446	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	KP876466	Streptomyces phage TP1604, complete genome	23417-23446	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP035512	Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence	332583-332612	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	95406-95435	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP019456	Escherichia coli strain FHI_NMBU_03 plasmid pFHI_NMBU_03_1, complete sequence	111016-111045	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NC_018023	Mycolicibacterium chubuense NBB4 plasmid pMYCCH.02, complete sequence	89395-89424	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	95406-95435	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	57651-57680	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	47059-47088	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	944187-944216	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	359219-359248	6	0.8
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	868939-868968	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	241319-241348	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	390732-390761	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_016624	Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence	463270-463299	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	401013-401042	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	944187-944216	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	868939-868968	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP035512	Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence	332583-332612	6	0.8
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	543398-543427	6	0.8
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	CP000663	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence	270344-270373	6	0.8
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	NZ_CP031752	Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence	268443-268472	6	0.8
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	NC_013930	Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence	202857-202886	6	0.8
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	257131-257160	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	148112-148141	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	120674-120703	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MT855965	Microcystis phage vB_MaeS-yong1, complete genome	34592-34621	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	412571-412600	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MG869617	Polaromonas sp. E3S plasmid pE3SP1, complete sequence	29742-29771	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	318191-318220	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	378307-378336	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NC_042339	Mycobacterium virus Arturo, complete genome	3278-3307	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP041766	Tomitella sp. HY188 plasmid unnamed, complete sequence	8904-8933	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP022366	Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence	613210-613239	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_LN831788	Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE1, complete sequence	38370-38399	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	71075-71104	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NC_023282	Streptomyces sp. FR1 plasmid pFRL2, complete sequence	42232-42261	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	132715-132744	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	429176-429205	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	462940-462969	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	119205-119234	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MK494098	Gordonia phage Tredge, complete genome	69707-69736	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MH576976	Gordonia phage Teatealatte, complete genome	69707-69736	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP045223	Achromobacter xylosoxidans strain DN002 plasmid unnamed	244268-244297	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	MG869617	Polaromonas sp. E3S plasmid pE3SP1, complete sequence	29742-29771	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	318191-318220	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	216803-216832	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP010326	Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence	327396-327425	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP003988	Streptomyces sp. 769 plasmid pSGZL, complete sequence	68337-68366	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	480587-480616	7	0.767
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP030828	Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence	462940-462969	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_023600	Mycobacterium phage Jolie1, complete genome	22460-22489	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	CP000664	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA03, complete sequence	118596-118625	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_014838	Pantoea sp. At-9b plasmid pPAT9B01, complete sequence	504662-504691	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP010858	Marinovum algicola DG 898 plasmid pMaD3	93897-93926	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	1789016-1789045	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP040937	Hymenobacter sp. DG01 plasmid unnamed, complete sequence	26825-26854	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_LR594691	Variovorax sp. WDL1 plasmid 3	554335-554364	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	MN586060	Mycobacterium phage PetterN, complete genome	23090-23119	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	MK494091	Mycobacterium phage Scorpia, complete genome	23093-23122	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	MH020239	Mycobacterium phage Naca, complete genome	23656-23685	7	0.767
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP021031	Rhizobium sp. NXC14 plasmid pRspNXC14a, complete sequence	410415-410444	7	0.767
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	MN699848	Citrobacter pasteurii strain 175G8 plasmid pCfr-OXA-198, complete sequence	111315-111344	7	0.767
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	NC_031107	Erwinia phage vB_EamM_Asesino, complete genome	73871-73900	7	0.767
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	247391-247420	8	0.733
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP007144	Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence	132682-132711	8	0.733
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	95308-95337	8	0.733
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	734747-734776	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP017756	Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence	163106-163135	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	40782-40811	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	40634-40663	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	259749-259778	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	268429-268458	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP012918	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence	117724-117753	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	LN997843	Streptomyces reticuli genome assembly TUE45, plasmid : II	295371-295400	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	987136-987165	8	0.733
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	MN304818	Phage 71_18, complete genome	35125-35154	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP010326	Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence	327396-327425	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP044082	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence	227017-227046	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP031080	Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence	118650-118679	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1255472-1255501	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP017756	Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence	163106-163135	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1180404-1180433	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP024424	Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence	213618-213647	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP020440	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence	95659-95688	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1240114-1240143	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1179501-1179530	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1180396-1180425	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1179752-1179781	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1180387-1180416	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1255591-1255620	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1255575-1255604	8	0.733
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1255567-1255596	8	0.733
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3334818-3334847	8	0.733
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	40782-40811	9	0.7
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	40634-40663	9	0.7
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP026518	Deinococcus sp. NW-56 plasmid unnamed2, complete sequence	268429-268458	9	0.7
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	MN694595	Marine virus AFVG_250M567, complete genome	57965-57994	9	0.7
CP027727_1	1.3\|761380\|30\|CP027727\|CRT	761380-761409	30	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	247391-247420	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	KR997929	Mycobacterium phage Barriga, complete genome	28136-28165	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	MT740744	Ralstonia phage Jenny, complete genome	35764-35793	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	MH576971	Mycobacterium phage Arlo, complete genome	28537-28566	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_028815	Mycobacterium phage Nhonho, complete genome	28880-28909	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NZ_CP053711	Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed4, complete sequence	147473-147502	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	NC_020548	Azoarcus sp. KH32C plasmid pAZKH, complete sequence	616562-616591	9	0.7
CP027727_1	1.5\|761464\|30\|CP027727\|CRT	761464-761493	30	MT740729	Ralstonia phage Bakoly, complete genome	8128-8157	9	0.7
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	560420-560449	9	0.7
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	MH221129	Salmonella phage SPAsTU, complete genome	225576-225605	9	0.7
CP027727_1	1.7\|761548\|30\|CP027727\|CRT	761548-761577	30	MH221128	Salmonella phage STsAS, complete genome	46507-46536	9	0.7
CP027727_1	1.2\|761332\|30\|CP027727\|CRT	761332-761361	30	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	349744-349773	10	0.667

1. spacer 1.7|761548|30|CP027727|CRT matches to MN694015 (Marine virus AFVG_250M337, complete genome) position: , mismatch: 2, identity: 0.933

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
tgccaacgccagtaccaacgccagtaccgc	Protospacer
***** *********** ************

2. spacer 1.7|761548|30|CP027727|CRT matches to MN694052 (Marine virus AFVG_250M52, complete genome) position: , mismatch: 2, identity: 0.933

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
tgccaacgccagtaccaacgccagtaccgc	Protospacer
***** *********** ************

3. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

tgccgccgcccgtgccaccgcc-tgtgccgc	CRISPR spacer
tgccgccgcccgtgccgccgccgggtgccg-	Protospacer
****************.*****  ******

4. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 4, identity: 0.867

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgccggtgccaccgccagtgcccg	Protospacer
********** *********** *****

5. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.867

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
taacgccgcccgtgccgccgcccgtgccgc	Protospacer
*. *************.***********.*

6. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.867

tgccgccgcccgtgccaccgcc-cgtgccac	CRISPR spacer
tgccgccgcccgtgccgccgccgggtgccg-	Protospacer
****************.*****  *****.

7. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 4, identity: 0.867

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccgccggtgccaccgccagtgcccg	Protospacer
********** *********** *****

8. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 4, identity: 0.867

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
taacgccgcccgtgccgccgcccgtgccgc	Protospacer
*. *************.*****.*******

9. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP014683 (Kozakia baliensis strain NBRC 16680 plasmid pKB16680_2, complete sequence) position: , mismatch: 4, identity: 0.867

tgccgccg-cccgtgccaccgcctgtgccgc	CRISPR spacer
-gcggccgaaccgtgccacggcctgtgccgc	Protospacer
 ** ****  ********* ***********

10. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP014676 (Kozakia baliensis strain DSM 14400 plasmid pKB14400_2, complete sequence) position: , mismatch: 4, identity: 0.867

tgccgccg-cccgtgccaccgcctgtgccgc	CRISPR spacer
-gcggccgaaccgtgccacggcctgtgccgc	Protospacer
 ** ****  ********* ***********

11. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 4, identity: 0.867

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
tgccgccgccggtgccaccgccagtgcccg	Protospacer
**********.*********** *****

12. spacer 1.2|761332|30|CP027727|CRT matches to NC_013859 (Azospirillum sp. B510 plasmid pAB510e, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgccgcccgtgccaccgtccgcgccgt	Protospacer
.*******************.***.***..

13. spacer 1.2|761332|30|CP027727|CRT matches to AY616033 (Burkholderia cenocepacia phage BcepB1A, complete genome) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgatgccgcccgtaccaccgcccgtgccgc	Protospacer
.* .*********.**************.*

14. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
agccgccgcccgtgctgccgcccg-gcctcg	Protospacer
 **************..******* *** *

15. spacer 1.2|761332|30|CP027727|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccg-tgccac	CRISPR spacer
ggccgccgccggtgccaccgcccgccggca-	Protospacer
 ********* ************* .* **

16. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
agccgccgcccgtgctgccgcccg-gcctcg	Protospacer
 **************..******* *** *

17. spacer 1.2|761332|30|CP027727|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccg-tgccac	CRISPR spacer
ggccgccgccggtgccaccgcccgccggca-	Protospacer
 ********* ************* .* **

18. spacer 1.2|761332|30|CP027727|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
agccgccgcccgtgctgccgcccg-gcctcg	Protospacer
 **************..******* *** *

19. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP032324 (Azospirillum brasilense strain MTCC4035 plasmid p3, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tcccgccgcccgtgcccccgcccgggaaac	Protospacer
* ************** ******* *  **

20. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
ggccgccgcccgcgccaccgccc-cgccccg	Protospacer
 ***********.********** .*** *

21. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgc--ccgtgccac	CRISPR spacer
tgccgccgcccgtgccatcgcagccgcgtc--	Protospacer
*****************.***  ***.*.*

22. spacer 1.3|761380|30|CP027727|CRT matches to AY616033 (Burkholderia cenocepacia phage BcepB1A, complete genome) position: , mismatch: 5, identity: 0.833

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
cgatgccgcccgtaccaccgcccgtgccgc	Protospacer
.* .*********.********.*******

23. spacer 1.7|761548|30|CP027727|CRT matches to NZ_CP014598 (Yangia sp. CCB-MM3 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
ggccatcgccagcaccaccgccagcagcac	Protospacer
 ***********.***********.* *.*

24. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cttcaccgcccgtgccgccgccggtgccac	Protospacer
. .*.***********.***** *******

25. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.****************. * ..*

26. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.****************. * ..*

27. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP035512 (Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
ggccgccgcccgtgccaccg-ccacgccctg	Protospacer
 ******************* **..*** .

28. spacer 1.2|761332|30|CP027727|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.****************. * ..*

29. spacer 1.2|761332|30|CP027727|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.****************. * ..*

30. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ggccgccgcccgcgccaccgcccgcgtcga	Protospacer
 ***********.***********.*.*.

31. spacer 1.2|761332|30|CP027727|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ggccgccgcccgttccgccgcccgcgtccc	Protospacer
 ************ **.*******.*.* *

32. spacer 1.2|761332|30|CP027727|CRT matches to KY365739 (Streptomyces phage BabyGotBac, complete genome) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgccc-gtgccac	CRISPR spacer
aaccgccgcccgagccaccgccctgcgcga-	Protospacer
 .********** ********** *.** *

33. spacer 1.2|761332|30|CP027727|CRT matches to MH178382 (Streptomyces phage Salete, complete genome) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgccc-gtgccac	CRISPR spacer
aaccgccgcccgagccaccgccctgcgcga-	Protospacer
 .********** ********** *.** *

34. spacer 1.2|761332|30|CP027727|CRT matches to JN698995 (Mycobacterium phage Dori, complete genome) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
cgccgccgcccgggacaccgcccg-gcgagg	Protospacer
.*********** * ********* ** *

35. spacer 1.2|761332|30|CP027727|CRT matches to KU189325 (Streptomyces phage Maih, complete genome) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgccc-gtgccac	CRISPR spacer
aaccgccgcccgagccaccgccctgcgcga-	Protospacer
 .********** ********** *.** *

36. spacer 1.2|761332|30|CP027727|CRT matches to MH178381 (Streptomyces phage BayC, complete genome) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgccc-gtgccac	CRISPR spacer
aaccgccgcccgagccaccgccctgcgcga-	Protospacer
 .********** ********** *.** *

37. spacer 1.2|761332|30|CP027727|CRT matches to KP876466 (Streptomyces phage TP1604, complete genome) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgccc-gtgccac	CRISPR spacer
aaccgccgcccgagccaccgccctgcgcga-	Protospacer
 .********** ********** *.** *

38. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP035512 (Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc-	CRISPR spacer
ggccgccgcccgtgccaccgcc-acgccctg	Protospacer
 ********************* ..*** .

39. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.***************.. * .**

40. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP019456 (Escherichia coli strain FHI_NMBU_03 plasmid pFHI_NMBU_03_1, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tactgaagcccgtgccaccgcctttgccgg	Protospacer
*.*.*  **************** *****

41. spacer 1.3|761380|30|CP027727|CRT matches to NC_018023 (Mycolicibacterium chubuense NBB4 plasmid pMYCCH.02, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccggccgcgccaccgcctgcaccag	Protospacer
******** ***.***********..**.

42. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.***************.. * .**

43. spacer 1.3|761380|30|CP027727|CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.***************.. * .**

44. spacer 1.3|761380|30|CP027727|CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgctgcccgtgccaccgcccaggatgc	Protospacer
******.***************.. * .**

45. spacer 1.3|761380|30|CP027727|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc-	CRISPR spacer
ggccgccgccggtgccaccgcccgc-cggca	Protospacer
 ********* ***********.*. * **

46. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc----	CRISPR spacer
ggccgccgcccgcgccaccgcc----ccgccccg	Protospacer
 ***********.*********    ****

47. spacer 1.3|761380|30|CP027727|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgcccgtgccaccgcctgtgccgc-	CRISPR spacer
ggccgccgccggtgccaccgcccgc-cggca	Protospacer
 ********* ***********.*. * **

48. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
tgccgccgccattgccaccgccgtttccgc	Protospacer
*********** **********  * **..

49. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
tgccgccgccattgccaccgccgtttccgc	Protospacer
*********** **********  * **..

50. spacer 1.5|761464|30|CP027727|CRT matches to NC_016624 (Azospirillum lipoferum 4B plasmid AZO_p5, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggccgccgccagtcccaccgcctcttcaag	Protospacer
 ************ ********* * * *

51. spacer 1.5|761464|30|CP027727|CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggccaccgccagcgccaccgcctggtccct	Protospacer
 ***.*******.***********  ** *

52. spacer 1.5|761464|30|CP027727|CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctg-tgccat	CRISPR spacer
ggccgccgccggtgccaccgcccgccggca-	Protospacer
 *********.***********.* .* **

53. spacer 1.5|761464|30|CP027727|CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctg-tgccat	CRISPR spacer
ggccgccgccggtgccaccgcccgccggca-	Protospacer
 *********.***********.* .* **

54. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP035512 (Haematobacter massiliensis strain OT1 plasmid pOT1-2, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctgtgccat-	CRISPR spacer
ggccgccgcccgtgccaccgcc-acgccctg	Protospacer
 ********* *********** ..*** *

55. spacer 1.5|761464|30|CP027727|CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 6, identity: 0.8

tgccgccgccagtgccaccgcctg-tgccat	CRISPR spacer
ggccgccgccagtgccgccgccagccgccg-	Protospacer
 ***************.***** * .***.

56. spacer 1.7|761548|30|CP027727|CRT matches to CP000663 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA02, complete sequence) position: , mismatch: 6, identity: 0.8

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
tgccatcgccagaaccagcgccaggaacag	Protospacer
************ **** ****** * *.

57. spacer 1.7|761548|30|CP027727|CRT matches to NZ_CP031752 (Rhodobacter sphaeroides strain EBL0706 plasmid p.A, complete sequence) position: , mismatch: 6, identity: 0.8

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
tgccatcgccagaaccagcgccaggaacag	Protospacer
************ **** ****** * *.

58. spacer 1.7|761548|30|CP027727|CRT matches to NC_013930 (Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence) position: , mismatch: 6, identity: 0.8

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
ggccaccgccagcaccaccgccagccctgc	Protospacer
 ****.******.***********. *.**

59. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgccgcccttgccgccgcccgaacccg	Protospacer
.********** ****.******* .**

60. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccgcgccgccgcccgccgctg	Protospacer
************.***.*******.  *

61. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccttgccgccgccccggcgct	Protospacer
*********** ****.******  **  .

62. spacer 1.2|761332|30|CP027727|CRT matches to MT855965 (Microcystis phage vB_MaeS-yong1, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgccgcccgtgctaccggccgtgttcg	Protospacer
.**************.**** *****..

63. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgccgtccgcgccaccgcccggctctc	Protospacer
.*******.***.***********  .* *

64. spacer 1.2|761332|30|CP027727|CRT matches to MG869617 (Polaromonas sp. E3S plasmid pE3SP1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ccacgccgcccgtgccaccgccagggcgtc	Protospacer
.  ******************* * **  *

65. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ctcccgtgcccgtgccgccgcccgtgccgc	Protospacer
. **  .*********.***********.*

66. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
agccgccgcccgcgcctccgcccgctggac	Protospacer
 ***********.*** *******.   **

67. spacer 1.2|761332|30|CP027727|CRT matches to NC_042339 (Mycobacterium virus Arturo, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccgcgccgccgcccggagcgt	Protospacer
************.***.******* . *..

68. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP041766 (Tomitella sp. HY188 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgacgcccgggccaccgcccgcaccct	Protospacer
.**** ****** ***********..** .

69. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP022366 (Azospirillum sp. TSH58 plasmid TSH58_p04, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgccc-gtgccac	CRISPR spacer
cgccgccgcccccgccaccgcccggcgctg-	Protospacer
.********** .********** *.**..

70. spacer 1.2|761332|30|CP027727|CRT matches to NZ_LN831788 (Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgccgcccgcgccaccacccgcacctg	Protospacer
.***********.******.****..**

71. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccttgccgccgccccggcgct	Protospacer
*********** ****.******  **  .

72. spacer 1.2|761332|30|CP027727|CRT matches to NC_023282 (Streptomyces sp. FR1 plasmid pFRL2, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgcggcccgggccaccgcccgcaacgc	Protospacer
.***** ***** ***********.. *.*

73. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccttgccgccgccccggcgct	Protospacer
*********** ****.******  **  .

74. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ggccgccgcccgtcccgccgcccggcccga	Protospacer
 ************ **.*******  **.

75. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac-	CRISPR spacer
ggctgccgcccgtgccaccg-ccacgccctg	Protospacer
 **.**************** **..*** .

76. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccttgccgccgccccggcgct	Protospacer
*********** ****.******  **  .

77. spacer 1.2|761332|30|CP027727|CRT matches to MK494098 (Gordonia phage Tredge, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
agccgccgcccgagccagcgcccgaccccg	Protospacer
 *********** **** ******  **

78. spacer 1.2|761332|30|CP027727|CRT matches to MH576976 (Gordonia phage Teatealatte, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
agccgccgcccgagccagcgcccgaccccg	Protospacer
 *********** **** ******  **

79. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP045223 (Achromobacter xylosoxidans strain DN002 plasmid unnamed) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
cttcaccgcccgtgccgccgccggtgccac	Protospacer
. .*.***********.***** *****.*

80. spacer 1.3|761380|30|CP027727|CRT matches to MG869617 (Polaromonas sp. E3S plasmid pE3SP1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
ccacgccgcccgtgccaccgccagggcgtc	Protospacer
.  ******************* * **  *

81. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
ctcccgtgcccgtgccgccgcccgtgccgc	Protospacer
. **  .*********.*****.*******

82. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccgcccgtgccatcgcagccgcgtc	Protospacer
*****************.***   .**  *

83. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP010326 (Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc-	CRISPR spacer
cgccaccgcctgtgccaccgcctg-acggtt	Protospacer
.***.*****.************* .* *.

84. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP003988 (Streptomyces sp. 769 plasmid pSGZL, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
agccgccgcccgagccaccgcttggggaac	Protospacer
 *********** ********.** *  .*

85. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccgcccgtgggaccgccttcgtgac	Protospacer
**************  ******* .*. .*

86. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP030828 (Neorhizobium sp. NCHU2750 plasmid pNCHU2750a, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgcccgtgccaccgcctgtgccgc-	CRISPR spacer
ggctgccgcccgtgccaccgcc-acgccctg	Protospacer
 **.****************** ..*** .

87. spacer 1.5|761464|30|CP027727|CRT matches to NC_023600 (Mycobacterium phage Jolie1, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
gaacgccgccagcgccgccgcctgtgccgc	Protospacer
 . *********.***.***********..

88. spacer 1.5|761464|30|CP027727|CRT matches to CP000664 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA03, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggccgccgccagtgccgccgcctcggcgtc	Protospacer
 ***************.******  **  .

89. spacer 1.5|761464|30|CP027727|CRT matches to NC_014838 (Pantoea sp. At-9b plasmid pPAT9B01, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
tttcgccgccagcgccaccccctgtgcatg	Protospacer
* .*********.****** *******

90. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP010858 (Marinovum algicola DG 898 plasmid pMaD3) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
tgccgcagccagggccaccgcctggccggc	Protospacer
****** ***** ***********  * ..

91. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctg-tgccat	CRISPR spacer
ggccggcgccagggccaccgcctgccggcg-	Protospacer
 **** ****** *********** .* *.

92. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP040937 (Hymenobacter sp. DG01 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
gggcaccgccagccccaccgcctgtgcctc	Protospacer
 * *.*******. ************** .

93. spacer 1.5|761464|30|CP027727|CRT matches to NZ_LR594691 (Variovorax sp. WDL1 plasmid 3) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccaggtccgc	Protospacer
.***********.********* *  **..

94. spacer 1.5|761464|30|CP027727|CRT matches to MN586060 (Mycobacterium phage PetterN, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagatccaccgcctgggtaac	Protospacer
.***********  ********** *. *.

95. spacer 1.5|761464|30|CP027727|CRT matches to MK494091 (Mycobacterium phage Scorpia, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagatccaccgcctgggtaac	Protospacer
.***********  ********** *. *.

96. spacer 1.5|761464|30|CP027727|CRT matches to MH020239 (Mycobacterium phage Naca, complete genome) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagatccaccgcctgggtaac	Protospacer
.***********  ********** *. *.

97. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP021031 (Rhizobium sp. NXC14 plasmid pRspNXC14a, complete sequence) position: , mismatch: 7, identity: 0.767

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggccgccgccagttccaccgccgtcgcgac	Protospacer
 ************ ********  .** *.

98. spacer 1.7|761548|30|CP027727|CRT matches to MN699848 (Citrobacter pasteurii strain 175G8 plasmid pCfr-OXA-198, complete sequence) position: , mismatch: 7, identity: 0.767

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
tgccaccgccagtaccaccgctctggctgc	Protospacer
*****.***************.   .*.**

99. spacer 1.7|761548|30|CP027727|CRT matches to NC_031107 (Erwinia phage vB_EamM_Asesino, complete genome) position: , mismatch: 7, identity: 0.767

tgccat----cgccagtaccaccgccagtaccgc	CRISPR spacer
----attacgcgccagtaccagtgccagtaccgg	Protospacer
    **    *********** .**********

100. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ggcctccgcccgtgccaccgccgtcctcag	Protospacer
 *** *****************  . .**

101. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP007144 (Hymenobacter swuensis DY53 plasmid pHsw1, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgcggcccgggccaccgcccggttcct	Protospacer
.***** ***** ***********  .* .

102. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ggccgccgcctgtgccagcgcccggtcagg	Protospacer
 *********.****** ******  * .

103. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
cgccgccgcccgcgccgccgcccggctcgg	Protospacer
.***********.***.*******  .*.

104. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP017756 (Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
agccgccgccggtgccaccacctgcgatcg	Protospacer
 ********* ********.****.* .

105. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccgcccgggccaccgcgataggtga	Protospacer
************ ********    * .*

106. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
tgccgccgcccgggccaccgcgataggtga	Protospacer
************ ********    * .*

107. spacer 1.3|761380|30|CP027727|CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
gggggattgccgtgccaccgcctgggccgc	Protospacer
 *  * .  *************** *****

108. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
ggccgccgcccgtgcccccgccgccgggga	Protospacer
 *************** *****  .*  *

109. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP012918 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p4, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
ctccgccgcccgtgtcaccgcctcggcgaa	Protospacer
. ************.********  ** .

110. spacer 1.3|761380|30|CP027727|CRT matches to LN997843 (Streptomyces reticuli genome assembly TUE45, plasmid : II) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
cgccgccgcccgggccgccgcctggggaat	Protospacer
.*********** ***.******* *  ..

111. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
cgtcgccggccgtgccaccgcctggattgt	Protospacer
.*.***** *************** ...*.

112. spacer 1.3|761380|30|CP027727|CRT matches to MN304818 (Phage 71_18, complete genome) position: , mismatch: 8, identity: 0.733

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
ggccgccgcccgtgacgccgcctggcaggt	Protospacer
 ************* *.*******    *.

113. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP010326 (Pantoea sp. PSNIH1 plasmid pPSP-3a9, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccaccgcctgtgccaccgcctgacggtt	Protospacer
.***.***** *************     *

114. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP044082 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggcccccgccagcgccaccgcctgccgcgc	Protospacer
 *** *******.***********.  *..

115. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP031080 (Paracoccus yeei strain CCUG 32053 plasmid pYEE2, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggcccccgccagcgccaccgcctgccgcgc	Protospacer
 *** *******.***********.  *..

116. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

117. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP017756 (Cupriavidus malaysiensis strain USMAA1020 isolate pure plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
agccgccgccggtgccaccacctgcgatcg	Protospacer
 *********.********.****.* .

118. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

119. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP024424 (Paracoccus yeei strain TT13 plasmid pTT13-2, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggcccccgccagcgccaccgcctgccgcgc	Protospacer
 *** *******.***********.  *..

120. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP020440 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggcccccgccagcgccaccgcctgccgcgc	Protospacer
 *** *******.***********.  *..

121. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

122. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

123. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

124. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

125. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

126. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

127. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

128. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgcaggctg	Protospacer
.***********.*********   * *

129. spacer 1.7|761548|30|CP027727|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.733

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
cgcgatcgccagcaccaccgccagtggatg	Protospacer
.** ********.************.

130. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 9, identity: 0.7

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccgggccaccgcgataggtga	Protospacer
************ ********    * ..

131. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 9, identity: 0.7

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
tgccgccgcccgggccaccgcgataggtga	Protospacer
************ ********    * ..

132. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP026518 (Deinococcus sp. NW-56 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
ggccgccgcccgtgcccccgccgccgggga	Protospacer
 *************** *****  .*  .

133. spacer 1.2|761332|30|CP027727|CRT matches to MN694595 (Marine virus AFVG_250M567, complete genome) position: , mismatch: 9, identity: 0.7

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
gatcgccgcccatgccaccgcccatgtgcg	Protospacer
 ..********.***********.**.

134. spacer 1.3|761380|30|CP027727|CRT matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.7

tgccgccgcccgtgccaccgcctgtgccgc	CRISPR spacer
ggcctccgcccgtgccaccgccgtcctcag	Protospacer
 *** *****************  . .*.

135. spacer 1.5|761464|30|CP027727|CRT matches to KR997929 (Mycobacterium phage Barriga, complete genome) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgtccgggt	Protospacer
.***********.*********  .   .*

136. spacer 1.5|761464|30|CP027727|CRT matches to MT740744 (Ralstonia phage Jenny, complete genome) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggccgccgccagtgcccccgccgagcacga	Protospacer
 *************** ***** .   *.

137. spacer 1.5|761464|30|CP027727|CRT matches to MH576971 (Mycobacterium phage Arlo, complete genome) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgtccgggt	Protospacer
.***********.*********  .   .*

138. spacer 1.5|761464|30|CP027727|CRT matches to NC_028815 (Mycobacterium phage Nhonho, complete genome) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccagcgccaccgccgtccgggt	Protospacer
.***********.*********  .   .*

139. spacer 1.5|761464|30|CP027727|CRT matches to NZ_CP053711 (Acetobacteraceae bacterium strain PAMC 26569 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
cgccgccgccaccgccaccgcctggagacc	Protospacer
.********** .*********** .   .

140. spacer 1.5|761464|30|CP027727|CRT matches to NC_020548 (Azoarcus sp. KH32C plasmid pAZKH, complete sequence) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
tgccgccgccagtgcgaccgcgatcattgt	Protospacer
*************** *****   .....*

141. spacer 1.5|761464|30|CP027727|CRT matches to MT740729 (Ralstonia phage Bakoly, complete genome) position: , mismatch: 9, identity: 0.7

tgccgccgccagtgccaccgcctgtgccat	CRISPR spacer
ggccgccgccagtgcccccgccgagcacga	Protospacer
 *************** ***** .   *.

142. spacer 1.7|761548|30|CP027727|CRT matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
ggccagcgccagttccaccgccagcgtgaa	Protospacer
 **** ******* **********... .

143. spacer 1.7|761548|30|CP027727|CRT matches to MH221129 (Salmonella phage SPAsTU, complete genome) position: , mismatch: 9, identity: 0.7

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
cagggtcgactgtaccaccgccagtaccag	Protospacer
..  .*** * *****************.

144. spacer 1.7|761548|30|CP027727|CRT matches to MH221128 (Salmonella phage STsAS, complete genome) position: , mismatch: 9, identity: 0.7

tgccatcgccagtaccaccgccagtaccgc	CRISPR spacer
cagggtcgactgtaccaccgccagtaccag	Protospacer
..  .*** * *****************.

145. spacer 1.2|761332|30|CP027727|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 10, identity: 0.667

tgccgccgcccgtgccaccgcccgtgccac	CRISPR spacer
gcgggccgcccgtgccaccccccgtcttcg	Protospacer
    *************** ***** ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1353918 : 1392867

uncultured_Caudovirales_phage(38.1%)

plate,tRNA,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZF03995.1\|1353918_1354389_+\|tRNA	Cys-tRNA(Pro) deacylase YbaK	NA	NA	NA	NA
AZF03996.1\|1354450_1355521_-	Ferric iron ABC transporter, ATP-binding protein	Q6GZ03	Mycoplasma_phage	8.0e-22	38.4
AZF03997.1\|1355517_1356441_-	Ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	1.2e-18	27.4
AZF03998.1\|1356870_1358979_+	Formate dehydrogenase-O, major subunit	NA	NA	NA	NA
AZF03999.1\|1359078_1359417_+	Glutaredoxin-related protein	NA	NA	NA	NA
AZF04000.1\|1359613_1360084_-	Bacterioferritin	NA	NA	NA	NA
AZF04001.1\|1360284_1360503_-	Bacterioferritin-associated ferredoxin	NA	NA	NA	NA
AZF04002.1\|1360748_1361351_+	Alkyl hydroperoxide reductase subunit C-like protein	NA	NA	NA	NA
AZF04003.1\|1361414_1362089_-	Ribonuclease T	NA	NA	NA	NA
AZF04004.1\|1362085_1363132_-	Dihydroorotase	NA	NA	NA	NA
AZF04005.1\|1363288_1364197_+	Sodium-type flagellar protein motY precursor	NA	NA	NA	NA
AZF04006.1\|1364325_1365543_+	Argininosuccinate synthase	NA	NA	NA	NA
AZF04007.1\|1366168_1366801_+	Two-component transcriptional response regulator, LuxR family	NA	NA	NA	NA
AZF04008.1\|1366887_1367070_-	hypothetical protein	NA	NA	NA	NA
AZF04009.1\|1367177_1367816_-	Endonuclease III	NA	NA	NA	NA
AZF04010.1\|1367906_1368860_-	Electron transport complex protein RnfB	NA	NA	NA	NA
AZF04011.1\|1368947_1370999_-\|tRNA	Methionyl-tRNA synthetase	NA	NA	NA	NA
AZF04012.1\|1371170_1372265_+	[4Fe-4S] cluster assembly scaffold protein Mrp (ApbC)	NA	NA	NA	NA
AZF04013.1\|1372724_1373048_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZF04014.1\|1373190_1375782_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	1.8e-27	21.5
AZF04015.1\|1375966_1376338_-	hypothetical protein	NA	NA	NA	NA
AZF04016.1\|1376330_1376819_-	GepA protein	D0UIM3	Aggregatibacter_phage	2.9e-27	45.3
AZF04017.1\|1377083_1377818_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	8.3e-119	87.3
AZF04018.1\|1378004_1378124_+	hypothetical protein	NA	NA	NA	NA
AZF04019.1\|1378408_1378747_+	Holin	B5TK61	Pseudomonas_phage	6.2e-45	85.4
AZF04020.1\|1378766_1379282_+	hypothetical protein	NA	NA	NA	NA
AZF04021.1\|1379285_1379894_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	1.1e-44	51.7
AZF04022.1\|1379906_1380239_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	1.8e-36	68.2
AZF04023.1\|1380235_1381231_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	4.6e-112	64.1
AZF04024.1\|1381227_1381956_+\|tail	Phage tail fiber	A0A2H4JDK0	uncultured_Caudovirales_phage	5.4e-38	53.7
AZF04025.1\|1381952_1382483_+\|tail	Phage tail fiber protein	A2I2X8	Vibrio_virus	1.9e-48	60.7
AZF04026.1\|1382566_1383184_+	hypothetical protein	NA	NA	NA	NA
AZF04027.1\|1383532_1383706_+	hypothetical protein	NA	NA	NA	NA
AZF04028.1\|1383708_1384875_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	5.5e-125	57.0
AZF04029.1\|1384874_1385381_+	hypothetical protein	Q6R4W3	Vibrio_virus	1.9e-21	35.1
AZF04030.1\|1385546_1386128_+	hypothetical protein	B0ZSH0	Halomonas_phage	3.1e-28	39.7
AZF04031.1\|1386124_1386250_+	hypothetical protein	NA	NA	NA	NA
AZF04032.1\|1386256_1388476_+\|tail	Phage tail length tape-measure protein	NA	NA	NA	NA
AZF04033.1\|1388475_1388859_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	1.2e-36	59.1
AZF04034.1\|1388851_1389064_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	6.2e-19	67.1
AZF04035.1\|1389073_1390075_+\|tail	Phage tail protein D	A0A2H4JH05	uncultured_Caudovirales_phage	1.8e-100	55.4
AZF04036.1\|1390097_1390655_+	Lytic enzyme	B5TK83	Pseudomonas_phage	9.5e-75	73.2
AZF04037.1\|1390642_1391143_+	hypothetical protein	A0A2H4IZW4	uncultured_Caudovirales_phage	4.0e-40	66.4
AZF04038.1\|1391224_1391725_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.1e-71	84.3
AZF04039.1\|1391808_1392867_+	RecA protein	A0A0S2MVG1	Bacillus_phage	2.4e-111	62.4

DBSCAN-SWA_2

1493772 : 1498739

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZF04137.1\|1493772_1494522_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.5e-62	49.8
AZF04138.1\|1494521_1495199_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	3.1e-43	53.1
AZF04139.1\|1495406_1496243_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	8.2e-06	33.3
AZF04140.1\|1496348_1497356_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	1.3e-34	36.2
AZF04141.1\|1497575_1497785_-	Cold shock protein of CSP family	Q9AZD3	Lactococcus_phage	2.2e-16	66.7
AZF04142.1\|1498172_1498739_+	Deoxycytidine triphosphate deaminase	S5VM63	Pseudomonas_phage	6.2e-74	73.3

DBSCAN-SWA_3

3102888 : 3142819

Pseudomonas_phage(67.44%)

tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZF05591.1\|3102888_3103098_+	hypothetical protein	A0A2D1GNR5	Pseudomonas_phage	1.0e-10	56.1
AZF05592.1\|3103101_3104376_-	Error-prone, lesion bypass DNA polymerase V (UmuC)	I6RSM4	Salmonella_phage	1.9e-110	51.1
AZF05593.1\|3104368_3104611_-	Error-prone repair protein UmuD	A0A1B1ITQ0	uncultured_Mediterranean_phage	3.3e-08	38.0
AZF05594.1\|3105099_3105309_-	hypothetical protein	A0A2H4J2T0	uncultured_Caudovirales_phage	4.4e-09	52.2
AZF05595.1\|3105391_3106084_+	Gifsy-2 prophage protein	A0A2H4J991	uncultured_Caudovirales_phage	4.0e-123	90.2
AZF05596.1\|3106064_3106592_-	hypothetical protein	A0A2H4IZW4	uncultured_Caudovirales_phage	6.0e-63	77.7
AZF05597.1\|3106588_3107122_-	Phage endolysin	A0A059VA40	Pseudomonas_phage	9.7e-77	81.4
AZF05598.1\|3107181_3107310_-	hypothetical protein	A0A2H4J9Z7	uncultured_Caudovirales_phage	1.5e-07	57.1
AZF05599.1\|3107744_3108491_-	hypothetical protein	A0A1S5R1J5	Pseudomonas_phage	3.9e-31	47.6
AZF05600.1\|3108521_3109220_-	hypothetical protein	A0A2D1GNS6	Pseudomonas_phage	1.3e-25	33.9
AZF05601.1\|3109548_3113007_-\|tail	Phage tail fiber protein	A0A1B0VMH5	Pseudomonas_phage	0.0e+00	81.2
AZF05602.1\|3113066_3113576_-\|tail	Phage tail assembly protein I	A0A1B0VMI5	Pseudomonas_phage	9.2e-77	88.2
AZF05603.1\|3113715_3114144_-	putative lipoprotein	A0A1B0VMH3	Pseudomonas_phage	5.6e-51	70.5
AZF05604.1\|3114213_3114555_-	hypothetical protein	NA	NA	NA	NA
AZF05605.1\|3114750_3115311_+	beta-Ig-H3/fasciclin	NA	NA	NA	NA
AZF05606.1\|3115454_3115667_-	hypothetical protein	NA	NA	NA	NA
AZF05607.1\|3115969_3116743_-\|tail	Phage tail assembly protein	A0A1B0VP68	Pseudomonas_phage	8.6e-143	92.0
AZF05608.1\|3116745_3117498_-\|tail	Phage minor tail protein	A0A1B0VNE0	Pseudomonas_phage	5.6e-139	91.2
AZF05609.1\|3117509_3117848_-\|tail	Phage minor tail protein	A0A1B0VMG7	Pseudomonas_phage	1.5e-54	83.9
AZF05610.1\|3117847_3120904_-\|tail	Phage tail length tape-measure protein 1	A0A1B0VMG8	Pseudomonas_phage	3.2e-172	38.8
AZF05611.1\|3120931_3121174_-	hypothetical protein	A0A2H4J4F7	uncultured_Caudovirales_phage	4.4e-21	57.3
AZF05612.1\|3121251_3121632_-	hypothetical protein	A0A1B0VMH4	Pseudomonas_phage	1.2e-25	51.2
AZF05613.1\|3121634_3122306_-	hypothetical protein	A0A0H5BBY3	Pseudomonas_phage	1.5e-45	44.2
AZF05614.1\|3122374_3122794_-	hypothetical protein	A0A1B0VMI0	Pseudomonas_phage	1.1e-62	88.3
AZF05615.1\|3122790_3123348_-	hypothetical protein	A0A1B0VMI1	Pseudomonas_phage	3.6e-50	53.4
AZF05616.1\|3123383_3123755_-	phage-related conserved hypothetical protein	A0A1B0VRJ4	Pseudomonas_phage	1.5e-60	94.3
AZF05617.1\|3123770_3123956_-	hypothetical protein	NA	NA	NA	NA
AZF05618.1\|3123991_3124495_-	phage-related conserved hypothetical protein	A0A1B0VND3	Pseudomonas_phage	4.1e-77	86.1
AZF05619.1\|3124554_3125166_-	hypothetical protein	A0A1B0VMF7	Pseudomonas_phage	8.5e-93	89.2
AZF05620.1\|3125191_3126154_-	putative phage protein	A0A1B0VMF8	Pseudomonas_phage	9.3e-179	100.0
AZF05621.1\|3126166_3126895_-	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	2.2e-124	97.5
AZF05622.1\|3127406_3128501_-	Phage protein	A0A1B0VMF3	Pseudomonas_phage	1.8e-186	93.9
AZF05623.1\|3128475_3129894_-	structural protein	A0A1B0VMH0	Pseudomonas_phage	1.6e-259	92.1
AZF05624.1\|3129890_3131192_-\|terminase	Phage terminase	A0A1B1P9C9	Acinetobacter_phage	1.0e-148	59.7
AZF05625.1\|3131178_3131640_-	Phage protein	A0A0S2SY97	Pseudomonas_phage	1.4e-47	75.6
AZF05626.1\|3131671_3132295_-	hypothetical protein	A0A1B0VRJ1	Pseudomonas_phage	3.0e-114	96.6
AZF05627.1\|3132260_3132734_-	hypothetical protein	A0A1B0VNC4	Pseudomonas_phage	2.8e-35	51.6
AZF05628.1\|3132730_3132922_-	hypothetical protein	NA	NA	NA	NA
AZF05629.1\|3132971_3133316_-	hypothetical protein	A0A193GYR7	Enterobacter_phage	2.3e-07	39.2
AZF05630.1\|3133312_3133651_-	hypothetical protein	A0A088FVG2	Escherichia_phage	2.0e-19	47.3
AZF05631.1\|3133770_3133947_-	hypothetical protein	NA	NA	NA	NA
AZF05632.1\|3134192_3134474_-	hypothetical protein	NA	NA	NA	NA
AZF05633.1\|3134642_3135320_-	hypothetical protein	NA	NA	NA	NA
AZF05634.1\|3135316_3135916_-	NinG recombination protein	A0A0U1VZM0	Pseudomonas_phage	1.9e-68	65.8
AZF05635.1\|3135912_3136383_-	hypothetical protein	A0A2H4J106	uncultured_Caudovirales_phage	5.0e-53	61.5
AZF05636.1\|3136379_3137138_-	hypothetical protein	NA	NA	NA	NA
AZF05637.1\|3137134_3137923_-	hypothetical protein	A0A1B0VMD9	Pseudomonas_phage	1.5e-94	67.6
AZF05638.1\|3137909_3138887_-	Primosomal protein I	A0A1B0VME0	Pseudomonas_phage	1.6e-117	74.8
AZF05639.1\|3138888_3139737_-	Phage antirepressor protein	A0A2H4J111	uncultured_Caudovirales_phage	6.3e-54	69.4
AZF05640.1\|3139868_3140489_-	hypothetical protein	NA	NA	NA	NA
AZF05641.1\|3140543_3140771_-	Cro repressor-like protein	A0A127KNT2	Pseudomonas_phage	6.9e-08	40.9
AZF05642.1\|3140877_3141522_+	Putative cI prophage repressor protein	K7PH71	Enterobacterial_phage	2.6e-52	53.1
AZF05643.1\|3141940_3142819_+	hypothetical protein	M9NYX6	Enterobacteria_phage	2.9e-38	33.1

DBSCAN-SWA_4

3145861 : 3159769

uncultured_Caudovirales_phage(38.46%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZF05648.1\|3145861_3146299_+	hypothetical protein	A0A1B0VMC3	Pseudomonas_phage	2.9e-63	80.7
AZF05649.1\|3146295_3146481_+	hypothetical protein	NA	NA	NA	NA
AZF05650.1\|3146477_3146672_+	hypothetical protein	Q9MC67	Pseudomonas_phage	1.2e-05	44.4
AZF05651.1\|3146828_3147647_+	hypothetical protein	U6C6J0	Ralstonia_phage	6.3e-67	51.7
AZF05652.1\|3147643_3149269_+\|tail	Phage tail length tape-measure protein	A0A2H4J6P1	uncultured_Caudovirales_phage	4.4e-197	70.0
AZF05653.1\|3149265_3149508_+	hypothetical protein	A0A2H4J1H1	uncultured_Caudovirales_phage	7.6e-13	57.5
AZF05654.1\|3149504_3149975_+	hypothetical protein	A0A2H4J101	uncultured_Caudovirales_phage	9.8e-73	88.0
AZF05655.1\|3150044_3150284_+	hypothetical protein	NA	NA	NA	NA
AZF05656.1\|3150323_3150494_-	hypothetical protein	NA	NA	NA	NA
AZF05657.1\|3150601_3150706_-	hypothetical protein	NA	NA	NA	NA
AZF05658.1\|3151029_3152037_+	Nucleoid-associated protein ndpA	L7TI92	Pseudomonas_virus	1.5e-123	64.8
AZF05659.1\|3152091_3152589_-	hypothetical protein	NA	NA	NA	NA
AZF05660.1\|3152819_3153053_+	hypothetical protein	NA	NA	NA	NA
AZF05661.1\|3153124_3153268_+	hypothetical protein	NA	NA	NA	NA
AZF05662.1\|3153492_3153735_-	hypothetical protein	A0A2H4J1H6	uncultured_Caudovirales_phage	2.3e-25	63.8
AZF05663.1\|3153861_3154173_+	hypothetical protein	NA	NA	NA	NA
AZF05664.1\|3154176_3154878_+	Phage protein	A0A059VF56	Pseudomonas_phage	2.7e-58	55.5
AZF05665.1\|3154950_3155529_-	hypothetical protein	NA	NA	NA	NA
AZF05666.1\|3155644_3156115_+	SAM-dependent methyltransferase	A0A0N7IRF6	Acinetobacter_phage	5.0e-61	66.2
AZF05667.1\|3156151_3156370_+	hypothetical protein	A0A2H4J1L2	uncultured_Caudovirales_phage	1.2e-20	73.6
AZF05668.1\|3156372_3156588_+	hypothetical protein	NA	NA	NA	NA
AZF05669.1\|3156588_3157623_+	Mobile element protein	C8CLF4	Xylella_phage	1.3e-93	54.7
AZF05670.1\|3158059_3158806_-	hypothetical protein	NA	NA	NA	NA
AZF05671.1\|3158839_3159769_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	2.8e-07	31.1

DBSCAN-SWA_5

3551561 : 3557779

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZF06015.1\|3551561_3551954_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.5e-55	83.7
AZF06016.1\|3551955_3552306_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.6e-38	69.4
AZF06017.1\|3552305_3552584_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.8e-26	59.6
AZF06018.1\|3552580_3552916_+\|tRNA	tRNA 2-thiouridine synthesis protein TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	2.8e-42	74.8
AZF06019.1\|3552912_3553914_+	Anthranilate phosphoribosyltransferase like	A0A2H4JBY5	uncultured_Caudovirales_phage	1.5e-166	85.7
AZF06020.1\|3554002_3554998_+	Glutathione S-transferase, omega	NA	NA	NA	NA
AZF06021.1\|3555103_3556498_-	Precorrin-2 oxidase	NA	NA	NA	NA
AZF06022.1\|3556498_3557779_-\|tRNA	Seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	9.1e-97	53.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage