CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP027742	Pseudomonas chlororaphis subsp. aurantiaca strain 464 chromosome, complete genome	1 crisprs	DinG,csa3,cas3,RT,PD-DExK,DEDDh,WYL	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027742_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027742_1

424724-424826

Orphan

Consensus_repeat	Method
GCGCCGGGCCCGGTGTAAAGAGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027742_1

>merge|CP027742|1|424724-424826|CRISPRCasFinder
GCGCCGGGCCCGGTGTAAAGAGGGGAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGAGGGCCGCGCTGATTGCGCTGGGCCCGGTGTAAAGAGGG

>CP027742|1|1|424724-424826|CRISPRCasFinder
GCGCCGGGCCCGGTGTAAAGAGGG	GAAGCCCCGGCCTGCCTGTACCAAGGTTCCCAAAAGCGTGAGGGCCGCGCTGATT
GCGCTGGGCCCGGTGTAAAGAGGG

Protein	Signature genes	Signature genes Name	Protein_function
CP027742.1\|AZD39497.1\|428346_429759_-\|putative-MFS-type-transporter	unknown	unknown	gnl\|CDD\|340927
CP027742.1\|AZD39489.1\|422337_422751_+\|Rhodanese-related-sulfurtransferase-YibN	unknown	unknown	gnl\|CDD\|238089
CP027742.1\|AZD39484.1\|416228_416894_+\|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain	unknown	unknown	gnl\|CDD\|223904
CP027742.1\|AZD39486.1\|417891_419202_-\|Carboxyl-terminal-protease	unknown	unknown	gnl\|CDD\|223864
CP027742.1\|AZD39485.1\|416966_417725_-\|Putative-periplasmic-protein-YibQ	unknown	unknown	gnl\|CDD\|377404
CP027742.1\|AZD39501.1\|433977_434772_+\|Enoyl-CoA-hydratase/isomerase-family-protein	unknown	unknown	gnl\|CDD\|236162
CP027742.1\|AZD39488.1\|420656_422186_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|235463
CP027742.1\|AZD39493.1\|424285_424660_+\|hypothetical-protein	unknown	unknown	unknown
CP027742.1\|AZD39487.1\|419233_420520_-\|Murein-hydrolase-activator-EnvC	unknown	unknown	gnl\|CDD\|227278
CP027742.1\|AZD39500.1\|432720_433908_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	unknown	unknown	gnl\|CDD\|367110
CP027742.1\|AZD39492.1\|423765_424221_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	unknown	unknown	gnl\|CDD\|223297
CP027742.1\|AZD39499.1\|430966_432688_+\|Acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173843
CP027742.1\|AZD39503.1\|436330_437533_+\|Acetyl-CoA-acetyltransferase	unknown	unknown	gnl\|CDD\|181242
CP027742.1\|AZD39496.1\|427984_428296_-\|hypothetical-protein	unknown	unknown	unknown
CP027742.1\|AZD39494.1\|425469_426906_-\|Nitrogen-regulation-protein-NtrC	unknown	unknown	gnl\|CDD\|273818
CP027742.1\|AZD39490.1\|422752_423007_+\|Glutaredoxin-3-(Grx3)	unknown	unknown	gnl\|CDD\|274017
CP027742.1\|AZD39495.1\|426902_427988_-\|Nitrogen-regulation-protein-NtrB	unknown	unknown	gnl\|CDD\|226370
CP027742.1\|AZD39491.1\|423063_423546_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	unknown	unknown	gnl\|CDD\|180234
CP027742.1\|AZD39498.1\|429954_430854_-\|Transcriptional-regulator,-LysR-family	unknown	unknown	gnl\|CDD\|176139
CP027742.1\|AZD39502.1\|434768_436295_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	unknown	unknown	gnl\|CDD\|236211

Protein	Function_ID	Function_description	E-value
CP027742.1\|AZD39497.1\|428346_429759_-\|putative-MFS-type-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.46288e-153
CP027742.1\|AZD39489.1\|422337_422751_+\|Rhodanese-related-sulfurtransferase-YibN	gnl\|CDD\|238089	cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.	6.79697e-24
CP027742.1\|AZD39484.1\|416228_416894_+\|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain	gnl\|CDD\|223904	COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms].	3.35917e-21
CP027742.1\|AZD39486.1\|417891_419202_-\|Carboxyl-terminal-protease	gnl\|CDD\|223864	COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane].	1.95839e-143
CP027742.1\|AZD39485.1\|416966_417725_-\|Putative-periplasmic-protein-YibQ	gnl\|CDD\|377404	pfam04748, Polysacc_deac_2, Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).	3.09419e-92
CP027742.1\|AZD39501.1\|433977_434772_+\|Enoyl-CoA-hydratase/isomerase-family-protein	gnl\|CDD\|236162	PRK08138, PRK08138, enoyl-CoA hydratase; Provisional.	8.15551e-159
CP027742.1\|AZD39488.1\|420656_422186_-\|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase	gnl\|CDD\|235463	PRK05434, PRK05434, 2,3-bisphosphoglycerate-independent phosphoglycerate mutase.	0
CP027742.1\|AZD39495.1\|426902_427988_-\|Nitrogen-regulation-protein-NtrB	gnl\|CDD\|226370	COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms].	1.36849e-164
CP027742.1\|AZD39500.1\|432720_433908_+\|L-carnitine-dehydratase/bile-acid-inducible-protein-F	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	1.36141e-149
CP027742.1\|AZD39492.1\|423765_424221_-\|tRNA-(cytidine(34)-2'-O)-methyltransferase	gnl\|CDD\|223297	COG0219, CspR, Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis].	1.05147e-88
CP027742.1\|AZD39499.1\|430966_432688_+\|Acyl-CoA-dehydrogenase	gnl\|CDD\|173843	cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product. AidB is one of several genes involved in the SOS adaptive response to DNA alkylation damage, whose expression is activated by the Ada protein. Its function has not been entirely elucidated; however, it is similar in sequence and function to acyl-CoA dehydrogenases. It has been proposed that aidB directly destroys DNA alkylating agents such as nitrosoguanidines (nitrosated amides) or their reaction intermediates.	9.43643e-148
CP027742.1\|AZD39503.1\|436330_437533_+\|Acetyl-CoA-acetyltransferase	gnl\|CDD\|181242	PRK08131, PRK08131, 3-oxoadipyl-CoA thiolase.	0
CP027742.1\|AZD39502.1\|434768_436295_+\|3-hydroxyacyl-CoA-dehydrogenase-PaaC	gnl\|CDD\|236211	PRK08268, PRK08268, 3-hydroxy-acyl-CoA dehydrogenase; Validated.	0
CP027742.1\|AZD39494.1\|425469_426906_-\|Nitrogen-regulation-protein-NtrC	gnl\|CDD\|273818	TIGR01818, Nitrogen_assimilation_regulatory_protein, nitrogen regulation protein NR(I). This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	0
CP027742.1\|AZD39490.1\|422752_423007_+\|Glutaredoxin-3-(Grx3)	gnl\|CDD\|274017	TIGR02181, GRX_bact, Glutaredoxin, GrxC family. Glutaredoxins are thioltransferases (disulfide reductases) which utilize glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system. Glutaredoxins utilize the CXXC motif common to thioredoxins and are involved in multiple cellular processes including protection from redox stress, reduction of critical enzymes such as ribonucleotide reductase and the generation of reduced sulfur for iron sulfur cluster formation. Glutaredoxins are capable of reduction of mixed disulfides of glutathione as well as the formation of glutathione mixed disulfides. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides. [Energy metabolism, Electron transport].	9.3713e-50
CP027742.1\|AZD39487.1\|419233_420520_-\|Murein-hydrolase-activator-EnvC	gnl\|CDD\|227278	COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning].	9.03093e-101
CP027742.1\|AZD39491.1\|423063_423546_+\|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)	gnl\|CDD\|180234	PRK05751, PRK05751, preprotein translocase subunit SecB; Validated.	4.26189e-83
CP027742.1\|AZD39498.1\|429954_430854_-\|Transcriptional-regulator,-LysR-family	gnl\|CDD\|176139	cd08448, PBP2_LTTR_aromatics_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.42197e-89

>CP027742.1|AZD39493.1|424285_424660_+|hypothetical-protein
MLRVFGSLAIFGVMVGLMIGRLTTPDPTELQEVQVQPNALVVWFNNEPKVHGEHIDGAVALLFEAEGRAQKGQLKINDKDANWRVRATEEGLLLNVVAARALHGEWSGSEVDGRWRLELQLREE
>CP027742.1|AZD39492.1|423765_424221_-|tRNA-(cytidine(34)-2'-O)-methyltransferase
MFHVILFQPEIPPNTGNVIRLCANSGCHLHLIEPLGFEMDDKRLRRAGLDYHEYATLQRHADLASCLESLGHPRLFAFTTKGSRPFHDASFAEGDAFLFGPESRGLPAEVLDALPAEQRLRLPMREGCRSLNLSNTVAVAVYEAWRQLGFK
>CP027742.1|AZD39491.1|423063_423546_+|Protein-export-protein-SecB-(maintains-pre-export-unfolded-state)
MTDQQNTAATEDESAPQFSLQRIYVRDLSFEAPKSPAIFRQQWEPSVGLDLNTRQKALEEGFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIKNLDDASMSHTLGAFCPNILFPYAREALDSLVTRGSFPALMLAPVNFDALYAQELQRLQAAGEGTVQ
>CP027742.1|AZD39490.1|422752_423007_+|Glutaredoxin-3-(Grx3)
MAAVVVYSSDYCPYCSRAKHLLENKGVAFEEIKVDGKPQVRAEMAQKAGRTSVPQIWIGSTHVGGCDDLFALERAGKLDALLAA
>CP027742.1|AZD39489.1|422337_422751_+|Rhodanese-related-sulfurtransferase-YibN
MVAHLIQFATEHYLLVGAFVILLALLIAHELSRGGRSLSTRELTALVNSEQGVVIDIRPSKDFAAGHIVGALNIPQDKLAARVGELEKHKAKTIILVDALGQHAGTHARELMKSGFTAAKLSGGVGSWKADNLPLVK
>CP027742.1|AZD39488.1|420656_422186_-|2,3-bisphosphoglycerate-independent-phosphoglycerate-mutase
MTTTPKPLVLMILDGFGHSESHESNAIYAAKKPVLDRLCASVPNGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDGEFFENPTICAAVDKAVAADKAVHILGLLSDGGVHSHQDHLVAMAELAFKRGAEKIYLHAFLDGRDTPPKSATSSIELLDETFKTLGKGRIASLIGRYFAMDRDNRWDRVAQAYNLIVDGKGEFNAATAQEGLQAAYERGESDEFVKATTLGEPVKVEDGDAVVFMNFRADRARELSRVFVEDDFKEFARTRQPKLAGFVMLTQYAASIPAPSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGGREEPFPGEERILIPSPKVATYDLQPEMSAPEVTDRIVDAIENQRYDVIVVNYANGDMVGHSGVFDAAVKAVECLDLCVGRIVDALEKVGGEALITADHGNVEQMSDAATGQAHTAHTSEPVPFIYVGKRNLKVREGGVLADVAPTMLKLLGLPQPAEMTGTSILV
>CP027742.1|AZD39487.1|419233_420520_-|Murein-hydrolase-activator-EnvC
MLRALITLALICLLQPAFADERAQTQQQLDATRQDIAELKKLLGKLQEEKSGVQKDLRGTETEMGKLEKQVDALQKELKKSESELQRLDEEKKKLQSARIEQQRLIAIQARAAYQNGRQEYLKLLLNQQNPEKFARTLTYYDYLSQARLEQLKNFNETLRQLANVEKEISLQQAQLLVQKSSLDTQREELDKVRKERQVALAKLNDDVKARGDKLKAREQDQADLGKVLKTIEETLARQAREAEEARQKALIAQQEAEKKRLREAQASADDSPRKPPRAAPGPLVSSAGASYGGPFASSRGKLPWPVDGRLLARFGESRGDDARTKWDGVMISASAGSQVHAVHGGRVVFADWLRGAGLLVILDHGNGYLSLYGHNQTLLKEAGDVVKAGESISTVGSSGGQGAPALYFAIRQQGRPSDPAQWCRAQG
>CP027742.1|AZD39486.1|417891_419202_-|Carboxyl-terminal-protease
MLHLSRLTSLALTIALVIGAPLAFAAETAQSTAATTTKAPLPLEELRTFAEVMDRIKAAYVEPVDDKTLLENAIKGMLSNLDPHSAYLGPEDFAELQESTSGEFGGLGIEVGAEDGIIKVVSPIDDTPASKAGIQAGDLIVKINGQPTRGQSMTEAVDKMRGKIGQKITLTLVRDGGAPFDVTLARATIQVKSVKSQLLESGYGYIRITQFQVKTGEEVSKALAKLRKDNGKKLNGIILDLRNNPGGVLQSAVEVVDHFITKGLIVYTKGRIANSELRFSATGKDESEAVPMVVLINGGSASASEIVAGALQDQKRAVLMGTTSFGKGSVQTVLPLNNDRALKITTALYFTPNGRSIQAQGIVPDIEVRRAKITNEAQDNEYFKEADLQGHLGNGNGGADKPTASGSKPKPMPQDDDYQLAQALSLLKGLSITRSK
>CP027742.1|AZD39485.1|416966_417725_-|Putative-periplasmic-protein-YibQ
MIGLLCLLAFTSIQAAEPAARKAYLSLIIDDLGQNLPRDRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKIVILHMPMDPATGPFAWHPELPIEELERRLNAAFKAVPYTSGINNHMGSRMTSQPQAMSWLMAELQRRHKFFVDSRTSAKTVAAAEAQKIGLASVSRDVFLDDERTEDAISHQLQTAIDLARKQGSAVVIGHPYPQTLAVLERELPRLKAQGIDWIDIELMISVRSNRAMSGHGKDGVYR
>CP027742.1|AZD39484.1|416228_416894_+|ABC-type-amino-acid-transport/signal-transduction-system,-periplasmic-component/domain
MLLTENFPPYNMAKNGKNFAQGENINGIAVDIVREMFKRAGINYSLTLRFPWERIYKLALEQPGYGVFVTARLPDREPLFKWVGPIGPDDWILLARDDSKIALQSLEQARKYRIGAYKGDAIAETLAKQGLKPQVVLKDQDNARKLVGGQIDLWATGDPAGRYLARQEGVTGLKTVLRFHSTQLYLALNKEVPDETVARLQAALDQLREEGVVEEIMGRYL
>CP027742.1|AZD39494.1|425469_426906_-|Nitrogen-regulation-protein-NtrC
MSRSETVWIVDDDRSIRWVLEKALQQEGMTTQSFDSADGVMSRLARQQPDVIISDIRMPGASGLDLLARIREQHPRLPVIIMTAHSDLDSAVASYQGGAFEYLPKPFDVDEAVSLVKRANQHAQEQQGLEVIPALARTPEIIGEAPAMQEVFRAIGRLSHSNITVLINGESGTGKELVAHALHRHSPRAASPFIALNMAAIPKDLMESELFGHEKGAFTGAANLRRGRFEQADGGTLFLDEIGDMPADTQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATHQNLETLVHAGKFREDLFHRLNVIRIHIPRLSDRREDIPTLAKHFLSRAAQELAVEPKLLKSETEEYLKNLPWPGNVRQLENTCRWITVMASGREVHISDLPPELLSLPQDSAPVTNWEQALRQWADQALARGQSSLLDSAVPSFERIMIETALKHTAGRRRDAAVLLGWGRNTLTRKIKELGMKVDGGDDDDSDEG
>CP027742.1|AZD39495.1|426902_427988_-|Nitrogen-regulation-protein-NtrB
MTISDQLHRLLLDNLTTATILLNADLRLEYMNPAAEMLLAISGQRSHGQFISELFTESAEALSSLRQAVEQAHPFTKREAMLTALTGQTLTVDYAVTPILSNGDTLLLLEVHPRDRLLRITKEEAQLSKQETSKMLVRGLAHEIKNPLGGIRGAAQLLARELPDENLKDYTNVIIEEADRLRNLVDRMLGSNKLPSLAMCNVHEVLERVSSLVEAESQGCITLVRDYDPSIPDVLIDREQMIQAVLNIVRNAMQAISSQNELRLGRICLRTRTMRQFTIGHVRHRLVTKIEIIDNGPGIPAELQETIFFPMVSGRPDGTGLGLAITQNIISQHQGLIECDSHPGHTTFSIFLPLEQGAPST
>CP027742.1|AZD39496.1|427984_428296_-|hypothetical-protein
MRRKFSARRAAGHSLAQPWINRTILVHQAAPSSIRSPFWFESTQRSRQNAAKENFKRLFQGSSASFRSLGLVFAFSRYQRLIRARNPGPARDCLVSKEVNIYP
>CP027742.1|AZD39497.1|428346_429759_-|putative-MFS-type-transporter
MNAAQHAAAHEKARKAGIASFIGTTIEWYDFYAYGIAAALVFGKVFFPADLPAGTATLLSFLTLWAGFIARPVGGIIFGHLGDKIGRKTTLVITLIMMGVATTCIGLLPSYLQIGIWAPIALVVLRIIQGIAVGGEWGGAILIASESAPKGKGILYAAFAQQGSPAGNLLATLVFFGLSALPAPDFLLWGWRIPFLLSAALVLVGMVIRLKLEESDDMKRLIQQKKTVKLPILEVLRKHWQIVLLGAGVLPIIHVTYFKSTFALSWATKELGYSQSTFLSVIVISLVVQFITQPLGAVLVSRMDMRKAVMLMLLPEFLLMPAMFFAVETGTYWIAVLGMCLATVPHSMFYGAVGGILARAFPTKVRYSGLSISYQLCSLLVGGATPVLAQGILNNTGSIVGVAIASACYALVSLVCMLLLLKRIGHNAADLSTAEQADADELAREPRATPLIEGPTMLPPSIDKDAQPAH
>CP027742.1|AZD39498.1|429954_430854_-|Transcriptional-regulator,-LysR-family
MDLKQLRYFVAVAEELHFGRAAARLFISQPALSFDIKKLEGQLDVQLLTRNNKSVSLTNAGQVLLDEARYLLLRAEQARRLTLRSAQGFVGRLSIGFVNSILHRGLPQAVRTFEQDHPDTEIVLMEMNSAEQAQALQRGQIDIGFVHWSHFPESIRGEPVLAEPFLCCLPQGHRLAGESRIDLAQLANDDFILFPRNVSPHYHDLIIARCVAAGFSPRIRHETRLWQTVVAMVAYEMGVALVPQTLAGTWKEGVHYCEISGDGALSEIHAIRHTDKPSAAAESFLTTLKALQKPVAPGL
>CP027742.1|AZD39499.1|430966_432688_+|Acyl-CoA-dehydrogenase
MTALPEPAQDTLNIPDSRGLNLFDCDAGLAALLKVYLPPQLFAQWLPTLRQLGGRAGGELDVLALSADKNPPQLLPRTRRGEDLQSIHKHPDFIALERAAYAELGLASMSHCAEPVLPLVKYALTFLFVQAEFGLCCPVSMTDSLTRTLRKFGSPELVARYLPSLASRDFDRLFQGAMFMTEQAAGSDVSRTETRARLENGEWRLFGDKWFCSNPDADLAMVLARPEDAPEGMKGVSLFLLPKLRPDGSRNAYRILRLKDKLGSRSMASGEISLDGATAYLIGEVGRGFQQMADMINMSRLSNGVRAAGLMRRGVNEALYVARHRRAFGRHLIEMPLMQRQLLKMMLPAEQARSMFMQIATLLPKADAGDEAARKCVRILTPLIKFRACRDARRVTGDAMEVRGGVGYIEEWSDARLVRDAHLGSIWEGTSNIVALDIARAVTREQALEPLRHYLAGLLAETDLPAASQRLFETVLQRAVAAIEKVAQERRDDQVRLAGSALYHTATAIFMAWEASRQAPDYRRLALAHLLLQHKLLPRDPLRPEPALEPELLALLANESPLSKADAMQLLPA
>CP027742.1|AZD39500.1|432720_433908_+|L-carnitine-dehydratase/bile-acid-inducible-protein-F
MNHSKGALAGLKVIDLSRVLGGPYCSQALADHGAEVIKLEPLSGDETRGWGPPFEGADASYFRGVNRNKQGIAVDLSRPAGITLLMRLLEDADVLIENFKPGTLERWGIGYAEVLSQRFPTLIHCAVSGFGSDGPLGGLPGYDAVIQAMAGLMSVNGEAESGPLRIGLPIVDMVTGLNALAGILLALNERHRSGLGQSLDITLYDCGVSLLHPHLANYFAAGKTPLRTGNAHPNIAPYDSYRTGTEPIFLAVGNDRQFAKLCEQLDAGALLDDPRFTDNGRRSVNREALKQVLEARLAEHDGTLLAQRLIRLGVPCGSIASIDKVVEHPHTRHRGLLVEIGDYRGVGSPVKLSRTPASYRSAPPALGANTREVLEGLGLDDQTIESLFEHGIVRE
>CP027742.1|AZD39501.1|433977_434772_+|Enoyl-CoA-hydratase/isomerase-family-protein
MSPESVSPQPLVLLEHPAPGVALLRLNRLQALNALNMALREELAEHFRRLDACPQTRVVVLTGGDTVFAAGADLGELVNASALQLYARHAERHWQAISACRKPVIAAVNGYALGGGCELAMHCDLIVAGHSARFAQPEIKVGVMPGAGGTQRLLRAIGKFQALRLLLTGCQVPADEALRLGLVSEVVADSETLPRALALATSIAGMPPLAVAQIKEVLLAGMDLPLEQALVLERKAFQLLFGSHDQREGMQAFLEKRKPEYQGK
>CP027742.1|AZD39502.1|434768_436295_+|3-hydroxyacyl-CoA-dehydrogenase-PaaC
MTAQPLQRIGLVGTGAMGRGIAQVMAMAGLKVFLFDARPGAAGTAREQLATIYAQQIEKARITPQDAAAAMLNLEVVDNLEALCDCQLVIEAIVENLEAKQQLFRQLEEVLAPSAILASNTSSLSITAIASVCRHPERVAGLHFFNPVPRMRIVEVVDGLATRVGARLQELVRAIGYYPARAKDSPGFIVNHAGRAFGTEALRILSEGVAPAWRIDALLRDSAGFAMGPFELLDLIGLDVSVPVMESIYRQFYEEPRYRPHPVLRLMQAGGHLGRKSGQGFYLYDEPGDTRRPPQAVPHCAELPPVWIVADDEVGRLRLLDLLERLGAQVENGLRPSTSALCLVAPLGDDATEAALRHATDPSRTVAIDTLTTLDSQRCLMLNPATREDMQHAAHALFSADGGTVTIIRDSCGFIVQRTLASIVNLACDIAQQGIASVADIDAAVRLGLGYPLGPLEWGDQLGPERLLQILERLHALTGDPRYRPSGWLRRRALLGLSLRQPENPLPA
>CP027742.1|AZD39503.1|436330_437533_+|Acetyl-CoA-acetyltransferase
MLDAYIYSGLRTPFGRHGGSLASMRPDDLVGPLLVRLLETSGLPVEALEEVILGCTNQAGEDSRNLARNALLSAGLPWRVPGQTVNRLCASGLSAVIDAARAITCGEGRLYLAGGVESMSRAPFIMAKAESAYSRTLDVADSTIGARFANPKLVERYGNHSMPETGDNLARRFAISREDADRFAAASQARYQEALLAGVLDDEIMAVEVPIGRKGQSLTVCDDEHPRPRSDLAALSRLPTLFAEGVVTAGNASGINDGAAVLLLGSREIGMEHGVAPMARILSSASVGVEPQFMGIGPHRAILLALQRARIGLEQLDLIEINEAFAPQVLACLKALNLDFDDPRVNPNGGAIAIGHPLGASGARLVLSACRNLQRNQQRYAVVSLCVGVGQGVAMVIERV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1328924 : 1418409

Pseudomonas_phage(42.0%)

tRNA,plate,tail,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD40302.1\|1328924_1330277_+\|protease	Intramembrane protease RasP/YluC, implicated in cell division based on FtsL cleavage	NA	NA	NA	NA
AZD40303.1\|1330351_1332739_+	Outer membrane protein assembly factor YaeT	NA	NA	NA	NA
AZD40304.1\|1332784_1333288_+	Outer membrane chaperone Skp, precursor	NA	NA	NA	NA
AZD40305.1\|1333291_1334347_+	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase	NA	NA	NA	NA
AZD40306.1\|1334456_1334897_+	3-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZD40307.1\|1334893_1335670_+	Acyl-ADP--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZD40308.1\|1335672_1336803_+	Lipid-A-disaccharide synthase	NA	NA	NA	NA
AZD40309.1\|1336814_1337447_+	Ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.7e-27	38.9
AZD40310.1\|1337516_1341041_+	DNA polymerase III alpha subunit	A0A2L1IZ23	Streptomyces_phage	6.2e-196	38.0
AZD40311.1\|1341181_1342129_+	Acetyl-coenzyme A carboxyl transferase alpha chain	NA	NA	NA	NA
AZD40312.1\|1342248_1343577_+\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZD40313.1\|1343622_1343766_+	hypothetical protein	NA	NA	NA	NA
AZD40314.1\|1343851_1345483_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	6.9e-158	53.5
AZD40315.1\|1345488_1346334_+	2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-49	42.8
AZD40316.1\|1346491_1347781_+	Enolase	A0A1X9I5Z8	Streptococcus_phage	9.0e-137	59.2
AZD40317.1\|1347953_1348232_+	Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage	NA	NA	NA	NA
AZD40318.1\|1348228_1348936_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZD40319.1\|1349101_1349998_-	Transcriptional regulator, LysR family, in formaldehyde detoxification operon	NA	NA	NA	NA
AZD40320.1\|1350104_1351217_+	S-(hydroxymethyl)glutathione dehydrogenase	E3SJ82	Synechococcus_phage	8.3e-30	27.2
AZD40321.1\|1351305_1352151_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AZD40322.1\|1352203_1352677_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AZD40323.1\|1352673_1353732_+\|tRNA	tRNA pseudouridine(13) synthase	NA	NA	NA	NA
AZD40324.1\|1353719_1354469_+	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.4e-68	52.6
AZD40325.1\|1354468_1355146_+	Protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.9e-43	52.0
AZD40326.1\|1355355_1356189_+	Murein hydrolase activator NlpD	A0A0S2SXL7	Bacillus_phage	6.3e-06	33.3
AZD40327.1\|1356295_1357300_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZD40328.1\|1357801_1358125_-	4Fe-4S dicluster domain	NA	NA	NA	NA
AZD40329.1\|1358267_1360847_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	1.8e-27	23.5
AZD40330.1\|1361043_1361769_+	Transcriptional regulator	B5TK58	Pseudomonas_phage	3.8e-124	90.6
AZD40331.1\|1362508_1363090_+	hypothetical protein	NA	NA	NA	NA
AZD40332.1\|1363192_1363540_+	Holin	B5TK61	Pseudomonas_phage	7.7e-51	87.7
AZD40333.1\|1363706_1364471_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	3.4e-06	25.8
AZD40334.1\|1364693_1365218_+	hypothetical protein	NA	NA	NA	NA
AZD40335.1\|1365221_1365830_+\|plate	Baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	1.8e-47	59.0
AZD40336.1\|1365843_1366176_+\|plate	Baseplate assembly protein W	A0A2H4JI46	uncultured_Caudovirales_phage	2.1e-37	69.1
AZD40337.1\|1366172_1367168_+\|plate	Phage-related baseplate assembly protein	A0A2H4JC04	uncultured_Caudovirales_phage	3.1e-108	62.3
AZD40338.1\|1367164_1367899_+\|tail	Phage tail fiber	A0A2H4JDK0	uncultured_Caudovirales_phage	1.3e-39	50.9
AZD40339.1\|1367895_1368426_+\|tail	Phage tail fiber	A2I2X8	Vibrio_virus	5.3e-51	63.1
AZD40340.1\|1368578_1369196_+	hypothetical protein	NA	NA	NA	NA
AZD40341.1\|1369366_1369549_-	hypothetical protein	NA	NA	NA	NA
AZD40342.1\|1369541_1369763_+	hypothetical protein	NA	NA	NA	NA
AZD40343.1\|1369765_1370932_+\|tail	Major tail sheath protein	B0ZSG8	Halomonas_phage	1.4e-125	57.5
AZD40344.1\|1370931_1371438_+	hypothetical protein	Q6R4W3	Vibrio_virus	2.1e-25	36.9
AZD40345.1\|1371565_1372147_+	hypothetical protein	B0ZSH0	Halomonas_phage	9.1e-28	39.4
AZD40346.1\|1372143_1372269_+	hypothetical protein	NA	NA	NA	NA
AZD40347.1\|1372275_1374546_+\|tail	Phage tail length tape-measure protein	A2I2Y1	Vibrio_virus	1.0e-34	35.1
AZD40348.1\|1374545_1374929_+\|tail	Unclassified tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	4.7e-33	53.5
AZD40349.1\|1374921_1375134_+\|tail	P2-like prophage tail protein X	A0A2H4JGD9	uncultured_Caudovirales_phage	3.9e-21	68.6
AZD40350.1\|1375143_1376163_+\|tail	Phage tail protein D	A0A2H4JH05	uncultured_Caudovirales_phage	2.7e-104	56.5
AZD40351.1\|1376344_1376929_+	hypothetical protein	B5TK65	Pseudomonas_phage	3.1e-76	72.5
AZD40352.1\|1376925_1377108_+	Mu-like prophage FluMu protein GP38	B5TK66	Pseudomonas_phage	6.5e-25	93.3
AZD40353.1\|1377107_1378604_+\|tail	Bacteriophage tail sheath protein	B5TK67	Pseudomonas_phage	7.8e-257	90.8
AZD40354.1\|1378670_1379018_+\|tail	Phage tail tube protein	B5TK68	Pseudomonas_phage	2.9e-58	93.9
AZD40355.1\|1379014_1379311_+\|tail	Phage small tail protein E	B5TK69	Pseudomonas_phage	2.3e-43	94.9
AZD40356.1\|1379441_1381517_+\|tail	Phage tail length tape-measure protein	B5TK70	Pseudomonas_phage	1.7e-36	47.9
AZD40357.1\|1381503_1382742_+\|tail	Phage tail/DNA circulation protein	B5TK71	Pseudomonas_phage	5.7e-181	75.7
AZD40358.1\|1382745_1383786_+\|tail	Prophage tail protein	B5TK72	Pseudomonas_phage	1.9e-161	82.7
AZD40359.1\|1383850_1384360_+\|plate	Prophage baseplate assembly protein V	B5TK73	Pseudomonas_phage	4.4e-79	89.3
AZD40360.1\|1384359_1384758_+	Bacteriophage protein GP46	B5TK74	Pseudomonas_phage	1.7e-65	89.4
AZD40361.1\|1384747_1385788_+	Phage FluMu protein gp47	B5TK75	Pseudomonas_phage	2.3e-167	87.3
AZD40362.1\|1385775_1386375_+\|tail	Prophage tail protein	B5TK76	Pseudomonas_phage	8.5e-106	91.5
AZD40363.1\|1386386_1387244_+\|tail	Prophage tail fiber protein	B5TK77	Pseudomonas_phage	1.5e-23	76.4
AZD40364.1\|1387248_1387890_+	hypothetical protein	B5TK78	Pseudomonas_phage	8.2e-38	62.1
AZD40365.1\|1388088_1388220_-	hypothetical protein	NA	NA	NA	NA
AZD40366.1\|1388273_1389827_+\|tail	Prophage tail fiber protein	A4PE45	Ralstonia_virus	1.8e-38	54.2
AZD40367.1\|1389828_1390299_+	hypothetical protein	A0A2H4EXG4	Aeromonas_phage	4.2e-07	35.0
AZD40368.1\|1390693_1391776_+\|tail	Prophage tail fiber protein	B5TK79	Pseudomonas_phage	4.2e-111	56.6
AZD40369.1\|1391783_1392386_+	Tail fiber assembly protein	B5TK80	Pseudomonas_phage	5.3e-47	49.2
AZD40370.1\|1392407_1392971_+	Lytic enzyme	B5TK83	Pseudomonas_phage	9.9e-88	83.3
AZD40371.1\|1392952_1393489_+	hypothetical protein	B5TK84	Pseudomonas_phage	3.4e-61	71.9
AZD40372.1\|1393571_1394072_+	Nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.1e-73	87.3
AZD40373.1\|1394155_1395208_+	RecA protein	A0A0S2MVG1	Bacillus_phage	4.4e-113	60.9
AZD40374.1\|1395216_1395684_+	Regulatory protein RecX	NA	NA	NA	NA
AZD40375.1\|1395729_1396845_-	Decarboxylase family protein	NA	NA	NA	NA
AZD40376.1\|1397327_1397522_+	hypothetical protein	NA	NA	NA	NA
AZD40377.1\|1397523_1397946_-	Putative NADPH-quinone reductase (modulator of drug activity B)	NA	NA	NA	NA
AZD40378.1\|1398135_1398846_+	putative conserved protein YfiP, contains DTW domain	NA	NA	NA	NA
AZD40379.1\|1399181_1399832_+	Transcriptional regulator, LuxR family	NA	NA	NA	NA
AZD40380.1\|1399907_1400270_+	Diacylglycerol kinase	NA	NA	NA	NA
AZD40381.1\|1400266_1401193_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZD40382.1\|1401326_1402106_+	Ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZD40383.1\|1402178_1402907_-	S-adenosylmethionine-dependent methyltransferase YaeB	NA	NA	NA	NA
AZD40384.1\|1402995_1403766_-	Rhamnolipid biosynthesis 3-oxoacyl-ACP reductase RhlG	NA	NA	NA	NA
AZD40385.1\|1403899_1404361_-	Uncharacterized protein YehS	Q9EYF4	Enterobacteria_phage	8.5e-37	51.3
AZD40386.1\|1404427_1405138_-	Ribosomal large subunit pseudouridine synthase F	NA	NA	NA	NA
AZD40387.1\|1405220_1405694_-	Acetyltransferase	NA	NA	NA	NA
AZD40388.1\|1405799_1407137_-	Ribosomal protein S12p Asp88 methylthiotransferase	NA	NA	NA	NA
AZD40389.1\|1407469_1409371_+	Kup system potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	1.2e-76	35.0
AZD40390.1\|1409574_1410870_-	Alanylphosphatidylglycerol hydrolase, periplasmic	NA	NA	NA	NA
AZD40391.1\|1410869_1413518_-	Alanylphosphatidylglycerol synthase	NA	NA	NA	NA
AZD40392.1\|1414456_1415521_+	DNA polymerase IV	NA	NA	NA	NA
AZD40393.1\|1415722_1416676_-	putative lipoprotein	NA	NA	NA	NA
AZD40394.1\|1416693_1418409_-\|tRNA	Prolyl-tRNA synthetase, bacterial type	NA	NA	NA	NA

DBSCAN-SWA_2

2026104 : 2062770

Pseudomonas_virus(45.16%)

integrase,tail,capsid,head,terminase,plate

attL 2025968:2025992|attR 2064028:2064052

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2025968:2025992	attL	NA	NA	NA	NA
AZD40962.1\|2026104_2027271_-\|integrase	Phage integrase	A0A2H4JGM5	uncultured_Caudovirales_phage	6.7e-139	60.9
AZD40963.1\|2027567_2027741_-	hypothetical protein	NA	NA	NA	NA
AZD40964.1\|2027733_2028993_-	hypothetical protein	R9TRT5	Rhizobium_phage	2.8e-175	72.6
AZD40965.1\|2028989_2029211_-	hypothetical protein	NA	NA	NA	NA
AZD40966.1\|2029207_2029858_-	Phage protein	A0A0U1SZL2	Pseudomonas_phage	7.7e-44	48.6
AZD40967.1\|2029873_2030131_-	hypothetical protein	NA	NA	NA	NA
AZD40968.1\|2030194_2030413_-	Phage protein	Q9ZXI5	Pseudomonas_virus	3.3e-15	71.4
AZD40969.1\|2030405_2031011_-	hypothetical protein	NA	NA	NA	NA
AZD40970.1\|2031013_2031277_-	hypothetical protein	NA	NA	NA	NA
AZD40971.1\|2031357_2031654_-	hypothetical protein	NA	NA	NA	NA
AZD40972.1\|2031675_2031816_-	hypothetical protein	NA	NA	NA	NA
AZD40973.1\|2031861_2034651_-	Phage protein	A0A2H4J936	uncultured_Caudovirales_phage	0.0e+00	65.4
AZD40974.1\|2034657_2034891_-	hypothetical protein	NA	NA	NA	NA
AZD40975.1\|2034965_2035334_-	hypothetical protein	A0A2H4J947	uncultured_Caudovirales_phage	1.7e-08	50.0
AZD40976.1\|2035330_2035621_-	hypothetical protein	NA	NA	NA	NA
AZD40977.1\|2035623_2035815_-	hypothetical protein	NA	NA	NA	NA
AZD40978.1\|2035813_2036032_+	hypothetical protein	NA	NA	NA	NA
AZD40979.1\|2036048_2036525_-	Phage protein	A0A2H4JG61	uncultured_Caudovirales_phage	1.0e-53	64.7
AZD40980.1\|2036565_2036817_-	hypothetical protein	NA	NA	NA	NA
AZD40981.1\|2037128_2037335_+	hypothetical protein	NA	NA	NA	NA
AZD40982.1\|2037670_2038570_+	hypothetical protein	NA	NA	NA	NA
AZD40983.1\|2038566_2039211_+	Permease of the drug/metabolite transporter (DMT) superfamily	NA	NA	NA	NA
AZD40984.1\|2039262_2039718_+	hypothetical protein	NA	NA	NA	NA
AZD40985.1\|2039723_2041028_-	hypothetical protein	Q9ZXJ8	Pseudomonas_virus	1.3e-186	78.3
AZD40986.1\|2041024_2041465_-	Phage tape measure	A0A2H4JG54	uncultured_Caudovirales_phage	1.2e-59	76.7
AZD40987.1\|2041471_2044207_-\|tail	Phage tail length tape-measure protein	A4PE52	Ralstonia_virus	1.1e-184	45.0
AZD40988.1\|2044199_2044316_-\|tail	Phage tail protein GpE, GpE'	Q9ZXK1	Pseudomonas_virus	5.4e-09	78.4
AZD40989.1\|2044324_2044654_-\|tail	Phage tail fiber	Q9ZXK2	Pseudomonas_virus	1.0e-28	63.3
AZD40990.1\|2044713_2045229_-\|tail	Phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	5.3e-72	76.0
AZD40991.1\|2045285_2046455_-\|tail	Phage tail sheath monomer	Q9ZXK4	Pseudomonas_virus	5.5e-165	73.3
AZD40992.1\|2046936_2048439_-\|tail	Phage tail fiber protein	A0A2H4JF09	uncultured_Caudovirales_phage	1.8e-83	77.7
AZD40993.1\|2048435_2049053_-\|tail	Phage tail fiber	A0A2H4JAU2	uncultured_Caudovirales_phage	1.2e-81	71.2
AZD40994.1\|2049052_2049964_-\|plate	Baseplate assembly protein J	Q9ZXK8	Pseudomonas_virus	4.3e-117	72.1
AZD40995.1\|2049960_2050305_-\|plate	Phage baseplate assembly protein	Q9ZXK9	Pseudomonas_virus	4.1e-36	65.5
AZD40996.1\|2050301_2050892_-\|plate	Baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	1.2e-54	65.8
AZD40997.1\|2051014_2051716_+	hypothetical protein	NA	NA	NA	NA
AZD40998.1\|2051718_2052177_-\|tail	Phage tail completion protein	Q9ZXL2	Pseudomonas_virus	2.2e-45	64.0
AZD40999.1\|2052173_2052650_-\|tail	Phage tail protein	A0A2H4J906	uncultured_Caudovirales_phage	1.8e-45	64.4
AZD41000.1\|2052746_2053190_-	Phage spanin Rz LysB	NA	NA	NA	NA
AZD41001.1\|2053186_2053393_-	hypothetical protein	NA	NA	NA	NA
AZD41002.1\|2053389_2054235_-	Putative phage-encoded peptidoglycan binding protein	Q9ZXL6	Pseudomonas_virus	6.4e-99	69.6
AZD41003.1\|2054231_2054555_-	Holin, phage lambda	A0A2H4JFM8	uncultured_Caudovirales_phage	6.1e-26	54.8
AZD41004.1\|2054594_2054807_-\|tail	Phage tail protein	Q9ZXL9	Pseudomonas_virus	5.8e-25	80.6
AZD41005.1\|2054806_2055286_-\|head	Phage head completion-stabilization protein	Q9ZXM1	Pseudomonas_virus	1.4e-47	62.3
AZD41006.1\|2055390_2056098_-\|terminase	Phage terminase, endonuclease subunit	A0A2H4J948	uncultured_Caudovirales_phage	7.8e-74	64.4
AZD41007.1\|2056109_2057117_-\|capsid	Phage major capsid protein	A0A077KEQ8	Ralstonia_phage	3.2e-121	63.6
AZD41008.1\|2057161_2058040_-\|capsid	Phage capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	1.6e-76	57.6
AZD41009.1\|2058191_2059952_+\|terminase	Phage terminase, ATPase subunit	Q9ZXM5	Pseudomonas_virus	4.8e-298	83.6
AZD41010.1\|2059951_2061004_+\|capsid	Phage-related capsid packaging protein	A0A2H4J922	uncultured_Caudovirales_phage	4.6e-163	83.4
AZD41011.1\|2061072_2061975_-	hypothetical protein	NA	NA	NA	NA
AZD41012.1\|2062071_2062770_-	Gifsy-2 prophage protein	A0A2H4J991	uncultured_Caudovirales_phage	9.6e-109	80.0
2064028:2064052	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2239275 : 2355163

113

uncultured_Caudovirales_phage(59.09%)

integrase,plate,tail,portal,terminase,tRNA,protease

attL 2259837:2259853|attR 2321319:2321335

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD41152.1\|2239275_2239884_-\|protease	SOS-response repressor and protease LexA	A0A2H4JG58	uncultured_Caudovirales_phage	1.1e-12	55.4
AZD41153.1\|2240136_2240844_+	putative transcriptional regulator for fatty acid degradation FadQ, TetR family	NA	NA	NA	NA
AZD41154.1\|2241036_2242047_+	beta-N-acetylglucosaminidase	NA	NA	NA	NA
AZD41155.1\|2242058_2242802_+	S-methyl-5'-thioinosine phosphorylase	NA	NA	NA	NA
AZD41156.1\|2242908_2245602_-	DNA/RNA helicase, SNF2 family	V9XTV7	Choristoneura_murinana_nucleopolyhedrovirus	6.0e-50	30.8
AZD41157.1\|2245613_2246177_-	hypothetical protein	NA	NA	NA	NA
AZD41158.1\|2246187_2249637_-	Transcription-repair coupling factor	NA	NA	NA	NA
AZD41159.1\|2249987_2251451_+	NADPH-dependent glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZD41160.1\|2251577_2252876_-	putative MFS-type transporter	Q6JIH2	Burkholderia_virus	3.1e-68	37.9
AZD41161.1\|2253235_2254213_+	FAD:protein FMN transferase	NA	NA	NA	NA
AZD41162.1\|2254414_2255809_+	Soluble pyridine nucleotide transhydrogenase	NA	NA	NA	NA
AZD41163.1\|2255851_2256574_-	Glycerophosphoryl diester phosphodiesterase	A0A292GJA3	Xanthomonas_phage	7.8e-05	40.4
AZD41164.1\|2256635_2257223_-	hypothetical protein	NA	NA	NA	NA
AZD41165.1\|2257317_2258568_+	Lipoprotein releasing system transmembrane protein LolC	NA	NA	NA	NA
AZD41166.1\|2258560_2259259_+	Lipoprotein-releasing system ATP-binding protein LolD	G9BWD6	Planktothrix_phage	1.3e-36	41.1
AZD41167.1\|2259323_2260568_+	Lipoprotein releasing system transmembrane protein LolE	NA	NA	NA	NA
2259837:2259853	attL	NA	NA	NA	NA
AZD41168.1\|2260630_2261992_-	Copper sensory histidine kinase CusS	B5LWN8	Feldmannia_species_virus	2.1e-06	22.7
AZD41169.1\|2261991_2262672_-	Copper-sensing two-component system response regulator CusR	NA	NA	NA	NA
AZD41170.1\|2262827_2263382_+	Copper tolerance protein	NA	NA	NA	NA
AZD41171.1\|2263450_2264281_+	NADPH-dependent 7-cyano-7-deazaguanine reductase	A0A2I7SAX1	Vibrio_phage	1.6e-38	37.4
AZD41172.1\|2264329_2264593_-	Chromosome segregation ATPase	NA	NA	NA	NA
AZD41173.1\|2264706_2265327_-	Phosphonoacetaldehyde phosphonohydrolase-related protein	NA	NA	NA	NA
AZD41174.1\|2265529_2266213_+	Outer-membrane-phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
AZD41175.1\|2266272_2266572_-	hypothetical protein	NA	NA	NA	NA
AZD41176.1\|2266786_2268031_+	Serine phosphatase RsbU, regulator of sigma subunit	NA	NA	NA	NA
AZD41177.1\|2268030_2268513_+	Serine-protein kinase RsbW	NA	NA	NA	NA
AZD41178.1\|2268587_2269514_-	Transaldolase	A0A127KNC6	Cyanophage	1.2e-13	33.5
AZD41179.1\|2269703_2270723_-\|tRNA	tRNA-dihydrouridine(20/20a) synthase	NA	NA	NA	NA
AZD41180.1\|2270825_2271923_+\|integrase	Phage integrase family protein	L7TP61	Pseudomonas_virus	2.8e-155	73.5
AZD41181.1\|2272698_2272971_-	hypothetical protein	A0A2K8HN48	Pseudomonas_phage	5.9e-22	60.7
AZD41182.1\|2272967_2274689_-	C-5 cytosine-specific DNA methylase family protein	Q5QF27	Pseudomonas_virus	1.7e-215	54.9
AZD41183.1\|2274685_2275705_-	hypothetical protein	NA	NA	NA	NA
AZD41184.1\|2275701_2276238_-	Phage hydrolase, HD superfamily	A0A1W6JP41	Morganella_phage	6.0e-18	38.6
AZD41185.1\|2276234_2276456_-	hypothetical protein	NA	NA	NA	NA
AZD41186.1\|2276452_2276872_-	hypothetical protein	NA	NA	NA	NA
AZD41187.1\|2276917_2277241_-	transcriptional regulator, putative	NA	NA	NA	NA
AZD41188.1\|2277396_2277681_-	DNA-binding protein Roi-related protein	NA	NA	NA	NA
AZD41189.1\|2277693_2278284_-	hypothetical protein	NA	NA	NA	NA
AZD41190.1\|2278280_2278457_-	hypothetical protein	NA	NA	NA	NA
AZD41191.1\|2278656_2279904_+	hypothetical protein	NA	NA	NA	NA
AZD41192.1\|2279890_2280622_-	repressor protein c2	A5VW98	Enterobacteria_phage	1.9e-30	38.7
AZD41193.1\|2281294_2281813_+	hypothetical protein	NA	NA	NA	NA
AZD41194.1\|2282022_2284242_+	DNA primase, phage associated	A0A2D1GN57	Marinobacter_phage	7.6e-192	47.4
AZD41195.1\|2284234_2284594_+	hypothetical protein	NA	NA	NA	NA
AZD41196.1\|2285133_2285478_+	Holin	A0A2H4J893	uncultured_Caudovirales_phage	5.3e-44	81.5
AZD41197.1\|2285623_2286223_+	hypothetical protein	A0A2H4JG15	uncultured_Caudovirales_phage	7.6e-62	67.9
AZD41198.1\|2286227_2288249_+\|terminase	terminase, large subunit, putative	A0A2H4J898	uncultured_Caudovirales_phage	0.0e+00	82.6
AZD41199.1\|2288250_2288457_+	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	7.6e-22	73.5
AZD41200.1\|2288456_2289938_+\|portal	phage portal protein, lambda family	A0A2H4JFL5	uncultured_Caudovirales_phage	5.7e-244	84.6
AZD41201.1\|2289934_2291080_+\|protease	Prophage Clp protease-like protein	A0A2H4JDI2	uncultured_Caudovirales_phage	1.1e-138	70.3
AZD41202.1\|2291076_2291418_+	hypothetical protein	A0A2H4JF15	uncultured_Caudovirales_phage	2.1e-45	85.6
AZD41203.1\|2291582_2292578_+	Phage protein	A0A2H4J890	uncultured_Caudovirales_phage	1.3e-167	87.9
AZD41204.1\|2292580_2292901_+	hypothetical protein	A0A2H4J879	uncultured_Caudovirales_phage	4.5e-37	67.6
AZD41205.1\|2292897_2293563_+	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	1.1e-82	69.1
AZD41206.1\|2293555_2294086_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	6.7e-54	57.1
AZD41207.1\|2294082_2294664_+\|plate	Baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	2.3e-55	69.8
AZD41208.1\|2294721_2294961_+	hypothetical protein	NA	NA	NA	NA
AZD41209.1\|2294965_2295292_+\|plate	Phage baseplate assembly protein	A0A2H4JA09	uncultured_Caudovirales_phage	4.1e-30	60.4
AZD41210.1\|2295288_2296173_+\|plate	Baseplate assembly protein J	A0A2H4JFK9	uncultured_Caudovirales_phage	6.7e-107	68.4
AZD41211.1\|2296174_2296780_+\|tail	Phage tail fiber	A0A2H4JDH5	uncultured_Caudovirales_phage	2.9e-77	69.7
AZD41212.1\|2296776_2298279_+\|tail	Phage tail fiber protein	A0A2H4JF09	uncultured_Caudovirales_phage	2.3e-83	77.7
AZD41213.1\|2298275_2298626_-	hypothetical protein	NA	NA	NA	NA
AZD41214.1\|2298737_2299898_+\|tail	Phage tail sheath monomer	A0A2H4J869	uncultured_Caudovirales_phage	2.0e-167	76.8
AZD41215.1\|2299909_2300419_+\|tail	Phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	5.8e-63	68.3
AZD41216.1\|2300434_2300755_+	hypothetical protein	A0A2H4J873	uncultured_Caudovirales_phage	5.3e-22	57.0
AZD41217.1\|2300904_2303391_+	Phage protein	A0A2H4JG00	uncultured_Caudovirales_phage	4.4e-79	41.0
AZD41218.1\|2303403_2304249_+	Phage protein U	A0A2H4J875	uncultured_Caudovirales_phage	1.9e-114	73.2
AZD41219.1\|2304223_2304430_+\|tail	Phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	4.5e-22	74.6
AZD41220.1\|2304915_2305965_+	Phage protein D	A0A2H4JBF6	uncultured_Caudovirales_phage	1.3e-146	77.1
AZD41221.1\|2306017_2306572_+	Lytic enzyme	B5TK83	Pseudomonas_phage	3.5e-77	77.6
AZD41222.1\|2306562_2307099_+	hypothetical protein	B5TK84	Pseudomonas_phage	3.2e-51	61.8
AZD41223.1\|2307268_2308243_+	hypothetical protein	NA	NA	NA	NA
AZD41224.1\|2308271_2308958_-	Gifsy-2 prophage protein	A0A2H4J991	uncultured_Caudovirales_phage	2.8e-100	73.7
AZD41225.1\|2308986_2309358_-	hypothetical protein	NA	NA	NA	NA
AZD41226.1\|2309667_2310537_+	hypothetical protein	A0A2H4JE36	uncultured_Caudovirales_phage	8.2e-33	34.9
AZD41227.1\|2310682_2311267_+	hypothetical protein	NA	NA	NA	NA
AZD41228.1\|2311673_2312312_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AZD41229.1\|2312406_2313261_+	Transcriptional regulator	NA	NA	NA	NA
AZD41230.1\|2313313_2313802_-	hypothetical protein	NA	NA	NA	NA
AZD41231.1\|2314059_2315622_+	Two-component transcriptional response regulator, LuxR family	NA	NA	NA	NA
AZD41232.1\|2315625_2316216_-	Acetyltransferase	NA	NA	NA	NA
AZD41233.1\|2316403_2317240_+	N-hydroxyarylamine O-acetyltransferase	NA	NA	NA	NA
AZD41234.1\|2317252_2317675_-	hypothetical protein	NA	NA	NA	NA
AZD41235.1\|2317736_2318156_-	hypothetical protein	NA	NA	NA	NA
AZD41236.1\|2318396_2319935_+	Xanthine/uracil permease family protein	NA	NA	NA	NA
AZD41237.1\|2319990_2321148_-	putative MFS-type transporter	NA	NA	NA	NA
AZD41238.1\|2321175_2321364_+	hypothetical protein	NA	NA	NA	NA
2321319:2321335	attR	NA	NA	NA	NA
AZD41239.1\|2322054_2322288_+	hypothetical protein	NA	NA	NA	NA
AZD41240.1\|2322294_2322489_-	hypothetical protein	NA	NA	NA	NA
AZD41241.1\|2322623_2323820_-	aromatic-amino-acid aminotransferase	NA	NA	NA	NA
AZD41242.1\|2324155_2326171_+	Excinuclease ABC subunit B	NA	NA	NA	NA
AZD41243.1\|2326303_2327854_-	Inner-membrane proton/drug antiporter (MSF type) of tripartite multidrug efflux system	NA	NA	NA	NA
AZD41244.1\|2327843_2328905_-	Membrane fusion component of MSF-type tripartite multidrug efflux system	NA	NA	NA	NA
AZD41245.1\|2329141_2330623_+\|tRNA	Glutamyl-tRNA synthetase	NA	NA	NA	NA
AZD41246.1\|2331556_2332096_+	Transcriptional regulator, AcrR family	NA	NA	NA	NA
AZD41247.1\|2332125_2332959_+	Putative hydrolase	NA	NA	NA	NA
AZD41248.1\|2333007_2333445_+	4-hydroxybenzoyl-CoA thioesterase domain protein	NA	NA	NA	NA
AZD41249.1\|2333544_2334504_+\|tRNA	tRNA-dihydrouridine(16) synthase	NA	NA	NA	NA
AZD41250.1\|2334625_2335072_+	Small heat shock protein	A0A1D8KN82	Synechococcus_phage	2.2e-18	37.0
AZD41251.1\|2335257_2335956_+\|tRNA	putative tRNA ligase	NA	NA	NA	NA
AZD41252.1\|2335952_2338637_+	Putative molecular chaperone, DnaJ family	NA	NA	NA	NA
AZD41253.1\|2338633_2340325_-	Chaperone protein HscC	M4R062	Micromonas_pusilla_virus	1.8e-76	38.5
AZD41254.1\|2340433_2343712_-	Sensory box/GGDEF family protein	A0A127AWB9	Bacillus_phage	3.8e-14	31.2
AZD41255.1\|2343793_2344684_-	Cys regulon transcriptional activator CysB	NA	NA	NA	NA
AZD41256.1\|2344829_2346248_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AZD41257.1\|2346258_2346903_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZD41258.1\|2346982_2347132_-	hypothetical protein	NA	NA	NA	NA
AZD41259.1\|2347130_2348213_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AZD41260.1\|2348267_2349380_+	Aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZD41261.1\|2349563_2350574_+	Aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZD41262.1\|2350776_2353368_+	putative type IV pilus assembly FimV-related transmembrane protein	NA	NA	NA	NA
AZD41263.1\|2353448_2354108_-	Xaa-Pro aminopeptidase	NA	NA	NA	NA
AZD41264.1\|2354308_2355163_+\|tRNA	tRNA pseudouridine(38-40) synthase	NA	NA	NA	NA

DBSCAN-SWA_4

2391596 : 2397555

Pseudomonas_phage(50.0%)

integrase

attL 2390918:2390931|attR 2398539:2398552

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2390918:2390931	attL	NA	NA	NA	NA
AZD41306.1\|2391596_2391899_+	Integration host factor alpha subunit	A0A0H3UZA0	Geobacillus_virus	1.8e-11	38.9
AZD41307.1\|2391879_2392236_+	Transcriptional regulator, MerR family	NA	NA	NA	NA
AZD41308.1\|2392473_2393355_-\|integrase	Phage integrase family protein	A0A059VF45	Pseudomonas_phage	1.3e-115	68.5
AZD41309.1\|2393522_2393924_-	hypothetical protein	A0A059VFY6	Pseudomonas_phage	1.3e-44	69.3
AZD41310.1\|2393962_2394541_-	hypothetical protein	NA	NA	NA	NA
AZD41311.1\|2394576_2394930_+	hypothetical protein	J7HXL1	Pseudomonas_phage	5.7e-17	45.8
AZD41312.1\|2395242_2395557_-	hypothetical protein	NA	NA	NA	NA
AZD41313.1\|2395810_2396017_-	Gifsy-2 prophage protein	A0A2H4J991	uncultured_Caudovirales_phage	1.3e-21	72.7
AZD41314.1\|2396334_2397555_-	hypothetical protein	A0A2H4JA46	uncultured_Caudovirales_phage	7.9e-50	38.9
2398539:2398552	attR	NA	NA	NA	NA

DBSCAN-SWA_5

4408524 : 4414782

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZD43087.1\|4408524_4408917_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	6.7e-59	84.6
AZD43088.1\|4408920_4409283_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	5.6e-44	74.2
AZD43089.1\|4409282_4409582_+\|tRNA	tRNA 5-methylaminomethyl-2-thiouridine synthase subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.4e-32	69.7
AZD43090.1\|4409578_4409914_+\|tRNA	tRNA 2-thiouridine synthesis protein TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	1.9e-46	82.0
AZD43091.1\|4409910_4410912_+	Anthranilate phosphoribosyltransferase like	A0A2H4JBY5	uncultured_Caudovirales_phage	3.2e-166	85.1
AZD43092.1\|4411000_4412008_+	Glutathione S-transferase, omega	NA	NA	NA	NA
AZD43093.1\|4412106_4413501_-	Precorrin-2 oxidase	NA	NA	NA	NA
AZD43094.1\|4413501_4414782_-\|tRNA	Seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.6e-101	54.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage