CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP034179	Novosphingobium tardaugens NBRC 16725 chromosome, complete genome	3 crisprs	RT,csa3,DEDDh	1	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP034179_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034179_1

869524-869625

Orphan

Consensus_repeat	Method
GGTGGTGTCAAAAGGATGGCCCCACCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034179_1

>merge|CP034179|1|869524-869625|CRISPRCasFinder
GGTGGTGTCAAAAGGATGGCCCCACCCTTGACCGGCCCCCACCGAGTGGTCCGTGTTATTTGTTAGTGTAAAACGGTGGTGTCAAAAGGATGGCCCCACCCT

>CP034179|1|1|869524-869625|CRISPRCasFinder
GGTGGTGTCAAAAGGATGGCCCCACCCT	TGACCGGCCCCCACCGAGTGGTCCGTGTTATTTGTTAGTGTAAAAC
GGTGGTGTCAAAAGGATGGCCCCACCCT

Protein	Signature genes	Signature genes Name	Protein_function
CP034179.1\|AZI35244.1\|878629_884236_-\|autotransporter-domain-containing-protein	unknown	unknown	gnl\|CDD\|377133
CP034179.1\|AZI35237.1\|871007_871895_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319251
CP034179.1\|AZI35232.1\|864253_864457_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376498
CP034179.1\|AZI35233.1\|864536_866690_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
CP034179.1\|AZI35235.1\|869648_870371_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
CP034179.1\|AZI35240.1\|874790_875219_-\|DUF2924-domain-containing-protein	unknown	unknown	gnl\|CDD\|371394
CP034179.1\|AZI35236.1\|870375_871083_+\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
CP034179.1\|AZI35243.1\|877607_878129_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
CP034179.1\|AZI35228.1\|860481_861267_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|236110
CP034179.1\|AZI35227.1\|859405_860485_+\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
CP034179.1\|AZI35225.1\|857803_858541_+\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|376808
CP034179.1\|AZI35226.1\|858614_859409_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
CP034179.1\|AZI35231.1\|862845_863694_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181174
CP034179.1\|AZI35230.1\|862050_862836_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
CP034179.1\|AZI35234.1\|866831_869153_-\|arylsulfatase	unknown	unknown	gnl\|CDD\|293749
CP034179.1\|AZI35229.1\|861283_862054_+\|enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|181174
CP034179.1\|AZI35239.1\|873132_874794_-\|recombinase-family-protein	unknown	unknown	gnl\|CDD\|214861
CP034179.1\|AZI35242.1\|876016_877399_-\|DUF1254-domain-containing-protein	unknown	unknown	gnl\|CDD\|227659
CP034179.1\|AZI35241.1\|875215_875647_-\|DUF3489-domain-containing-protein	unknown	unknown	gnl\|CDD\|371839
CP034179.1\|AZI35238.1\|872311_872875_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|368446

Protein	Function_ID	Function_description	E-value
CP034179.1\|AZI35244.1\|878629_884236_-\|autotransporter-domain-containing-protein	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	2.06796e-42
CP034179.1\|AZI35237.1\|871007_871895_-\|hypothetical-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	1.18498e-15
CP034179.1\|AZI35232.1\|864253_864457_-\|hypothetical-protein	gnl\|CDD\|376498	pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I. This family includes GTP cyclohydrolase enzymes and a family of related bacterial proteins.	0.00483597
CP034179.1\|AZI35233.1\|864536_866690_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	1.29427e-58
CP034179.1\|AZI35235.1\|869648_870371_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.1887e-48
CP034179.1\|AZI35240.1\|874790_875219_-\|DUF2924-domain-containing-protein	gnl\|CDD\|371394	pfam11149, DUF2924, Protein of unknown function (DUF2924). This bacterial family of proteins has no known function.	2.18495e-48
CP034179.1\|AZI35236.1\|870375_871083_+\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	3.19798e-47
CP034179.1\|AZI35243.1\|877607_878129_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.31299e-23
CP034179.1\|AZI35228.1\|860481_861267_+\|SDR-family-oxidoreductase	gnl\|CDD\|236110	PRK07831, PRK07831, SDR family oxidoreductase.	4.7377e-129
CP034179.1\|AZI35227.1\|859405_860485_+\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	8.95764e-79
CP034179.1\|AZI35225.1\|857803_858541_+\|flavodoxin-family-protein	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	6.43297e-49
CP034179.1\|AZI35226.1\|858614_859409_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	7.23997e-65
CP034179.1\|AZI35231.1\|862845_863694_+\|enoyl-CoA-hydratase	gnl\|CDD\|181174	PRK07938, PRK07938, enoyl-CoA hydratase family protein.	1.21722e-63
CP034179.1\|AZI35230.1\|862050_862836_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	1.29219e-85
CP034179.1\|AZI35234.1\|866831_869153_-\|arylsulfatase	gnl\|CDD\|293749	cd16025, PAS_like, Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	0
CP034179.1\|AZI35229.1\|861283_862054_+\|enoyl-CoA-hydratase-family-protein	gnl\|CDD\|181174	PRK07938, PRK07938, enoyl-CoA hydratase family protein.	7.16547e-95
CP034179.1\|AZI35239.1\|873132_874794_-\|recombinase-family-protein	gnl\|CDD\|214861	smart00857, Resolvase, Resolvase, N terminal domain. The N-terminal domain of the resolvase family contains the active site and the dimer interface. The extended arm at the C-terminus of this domain connects to the C-terminal helix-turn-helix domain of resolvase.	4.17949e-45
CP034179.1\|AZI35242.1\|876016_877399_-\|DUF1254-domain-containing-protein	gnl\|CDD\|227659	COG5361, COG5361, Uncharacterized conserved protein [Function unknown].	2.1172e-63
CP034179.1\|AZI35241.1\|875215_875647_-\|DUF3489-domain-containing-protein	gnl\|CDD\|371839	pfam11994, DUF3489, Protein of unknown function (DUF3489). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 84 to 211 amino acids in length. This protein has a single completely conserved residue W that may be functionally important.	6.88116e-14
CP034179.1\|AZI35238.1\|872311_872875_-\|transcriptional-regulator	gnl\|CDD\|368446	pfam05443, ROS_MUCR, ROS/MUCR transcriptional regulator protein. This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti. This gene encodes a 15.5-kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid and is necessary for succinoglycan production. Sinorhizobium meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of alfalfa nodules. MucR from Sinorhizobium meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan.	7.25552e-59

>CP034179.1|AZI35234.1|866831_869153_-|arylsulfatase
MAHGYGAVTRSLAMAALAVANIHLLAFPVMAREPAFTGRIGKTYDESVPAWPAERNAPAGSPNVLIWMIDDLGFGQLGSYGGLIDTPNLDQLARQGLRYSNYHTTPICSASRAAFLTGRNPHRIHSGGHVALATGFPGYDARIPRAAGTIADNLRSAGYITYALGKWDHLPSEDASAAGPFTYWPSGQGFDRFYGFLWPDTNNFAPVLWSDHQPAPLTHDPEYHLTADLAEHAINWINARDAAAHKRPFLLYWATGATHAPHHAPEAYLKRYRGRFDMGWDKAREEVLRRQKALGIVPQGTTLPPRPESMPAWNSLSADQKRSYARAMEAFAAQLSHADAEFGRILAALKERGEFDNTLIVVTADNGASAEGGLDGLYDEHFLMSSRKPTLSENLKYYEAWGGPQTYPHYPMGWAVAGNTPFRYYKQTAYEGGTRVPLIVSWPKGIAAKGEIRTQYHHVTDLTPTILDSVKVAPAAIVHGEKQMSFDGASMVYSFGDARAPTNKQSQYYEMFGNRAVWAQGWKAVIPYSLKTWNFLNSSPITDKGWELYHVDQDINEQKNLAAAEPARLKSMLTLFDQLARANNVYPLTNISQAAQAKAALSTSDRVWTYKGAVPRIPMALAPPVNGPAFSLTANLELPTRANGVVMAVGGDQGGMSFYLLDGRPIFAIANINSTVKRIAAKASLPAGSVQLTLKFERASEGARIRIDANGSEIASGDIAGPLPVSFFSSSETMDIGSDSDSIVSPDYDGPNPLSGKIRQITIASTPIEEPAL
>CP034179.1|AZI35233.1|864536_866690_-|TonB-dependent-receptor
MGKIRLSLLAVTCSAIAVQSAYAQEVAAYAGGVEEIVVTAQKRAESLQDTPISMAALTSAALEAKGINDITDLRSVVPSLQVTPHPGSATTARVFIRGVGNNDDQITQDPSVAIYLDGVYIARSQGLSMEVAELERIEVLRGPQGSLYGRNATGGAINYITRAPDLGRFGVKQSLTYGNYDQFRARTRVNIPVGDTLAIELGYLHAQKDGFVKNPGTGIKRWGDQRRSAYRAAVRWAPTDAIDLRYTYDRSDMNDTPSYIVQSPFYPAMAERPIAGSPFVNNLRRNDVVAQGHNLTASWDVTDGLTLKSITGYRELENVLNQDYLTGANGPFPLLAVDFDQKQKQWTQEVQAVGKAMDGRLEYVFGAYYFDESASSFDLTRLVSRPRLNRTVTIDNKAYAVYGQMTFRPAFLDGLYVTPSLRWSRDERRATLQQTFVPAIGVPTVGPTGTGDRSFSNVSPGLIVGYDVTDDVNVYAKWARGYKSGGYSVRASSIARFEQGFDPETLDSFELGLKSSWLDNRLRLNIAGFVSKYKGIQVNLQTDPVNPGITDTFNAGKATIKGIELDITARPVRSLTFGVNYAYLDAGYDRIVDPITGNNIADRFSFVEAPRHTLTTNLQYEFPETPIGSLTAYVDYFMQSKKFTSTSDARYIIGHYGLLNARLTLSDIPIGFGSWRLSAFGKNLTDKKYYTAHFNGVLPAVFFGDPRTYGLELTFEY
>CP034179.1|AZI35232.1|864253_864457_-|hypothetical-protein
MGEDGSRPLDGVVRTPEGVANAYREFVAGGWPRFRVIRHMVGRAVLHPSALPGRDVSTANAFFTLFL
>CP034179.1|AZI35231.1|862845_863694_+|enoyl-CoA-hydratase
MGRAAVCSWTRWITLKSCRFTCQKGQDISPIILEDKRLMPIHADSRFPTVIADRVAEITIAANKANALSIEAVLVLAEHIERLGRSTEIGAIVLRNEGNSFCAGADIKEIGGDPSLIGASNRAWLRLARACHHCELPVVAAVDGHCIGGGIVLAASCDVIFLSETSSFSLPQIKKGGWGAGTFLMRLLGPLRIRAVMFTGRTLSAAEIAAGGQIEAVLPRADLRDAAFALAREIAEFPVEAIRVGKASLNGIELMDLESSYRLEHAATTELFVTRAAADLRK
>CP034179.1|AZI35230.1|862050_862836_+|SDR-family-oxidoreductase
MSAEALSLQGQVALITGAARGIGAASARLAAERGARVVIADRRMDEGEVLAAELNAQRPGCAIAITLDIGNEEDWQKGVAQAEAAFGKLDILVNNAGIIRVQPLREMTSETFRKVIDVNLVGTFLGVKYGQEAMVRAGGGSIVNLSSVQGLEGREGFTAYASSKFGVRGLTKSAALELGPLGIRVNAVIPGPTKTKMTERPGWTAEDYDRAYKGYPLGRMADPSEVAEMILFLASNAASFITGGDFAVDGGVTTGKPRLLG
>CP034179.1|AZI35229.1|861283_862054_+|enoyl-CoA-hydratase-family-protein
MSVTLNVTEGIAVVTMCNPPVNAITVSDTWSVDRHFQELGQREDVKVIILTSEGRGFNAGIDIKEMQGSKGDRAKEMEFVVGSGEACYEAFNRIYLTPQPVIAAVNGHCMGLGVGLVASCDLIVASKNAKFGLPEVDNGALGCASHLAKLVAPMKLREMSLTCRPATAAELHAWGSIAYLTEPEELLAKAMEIARNIAAKQQHVVRFAKSALNHLDVFEMHGNYRMEQGYTYQLNVMGEGSKARDAFVEGTRIITR
>CP034179.1|AZI35228.1|860481_861267_+|SDR-family-oxidoreductase
MTIAPPSRPEPRGLLKGKTVIVTAAAGSGIGYSTAETCADEGAQVLISDMHEGRLHQYADRLAERIGQPVLRKLCNVTDEAQVRNLVAYAQAEMGRIDIMVNNAGLGGSYRLVDMTDEQWSRILDVNLTGTFRCMRAVLPVMMAQKGGVVINLGSIVAWRAEALQTAYAATKAGILAMTRCAAMEVARDNVRINAVVPSLALHPNLVKVTDPDFLADLIERNEAFGRAAETWEIANGIAMLASDYSSYMTGEALSVSCRHP
>CP034179.1|AZI35227.1|859405_860485_+|nitronate-monooxygenase
MTAVRLVPHKALRTPFCEMAGIDYPVVQTGMGWVADARLTAATSSAGGLGIVGASTMNLTEMTAAIDQVLSLTDLPFGVNLRSDAPDVYERAKVMIDRGVKVASFALAPTEKLIKSFKDAGLLCVPSIGARRHAEKVVGWGADAVIVQGSEAGGHTGGVATSILIPQVIEAINVPVIAAGGFRDGRGLVAALAYGAQGVAMGTRFLVTKESPVPDQVKQVYLEARPEDTVLTDRIDGHSHRVLRTPFIDRMIAGGGGVRDLLLAMSSAVNLKRTTGMSLIDMVRQALAARRQHNYNLRQAVMAANTPMLLRKTMVDGEVEHGIISGGQVSGLITDAPSVEELILSVIREANMTLESLQA
>CP034179.1|AZI35226.1|858614_859409_+|SDR-family-oxidoreductase
MAGGSKSDLVGGPFRLDGRIALVTGGTRGTGRAIARDFAAAGASVFLTGRDGGEAQRVAREIAGEVGGNLVGLAYDAADGEGYRCLVAAMAEQTVRLDILVNNAAILKPHFVSRVEPDEFDLLFRVNTRSAFFLTRALQSLLKESGRASVVFLGAAGAHRPVEGIGVYCATKAAVRNFSMTLAREWAGDGIRVNMLTPGSIATEFILPKDEARREKFVADMASQNLLGRLADPLEIARCVRFLASDASSFVTASDLIVDGGFLS
>CP034179.1|AZI35225.1|857803_858541_+|flavodoxin-family-protein
MKAHIVHAHPEGGSFTAAMRDVVVEGLGAHGYEVSVSDLYAMNFNPLISKKDFMHPVEVPVAFTKEQRRGWKDRTLSDDIMEEVERVLAADLLVLTFPIYWFSMPAMMKGWVDRVLLAGPFYSGRDMYDRGGMAGKKALVVASLGGREHMFGLDSLHGPMADGMLRHIFQGTLGVVGYDVVAPFLAYHAPYVDEEARAVMLVQLREHVADLDRLPILPMPSLSGFDNRFRPLAASSSSDQDSSFT
>CP034179.1|AZI35235.1|869648_870371_+|IS6-family-transposase
MSKTPNPFKYFHSSPEVIRLVVMMYVRFPLSLRNVEDLLFERGIDLCHETVRLWWNRFGPLFAADIRRQRVQRMRGFRHWRWHLDEMYVRLNGEMVYLWRAVDHEGEVLESYVTKKRDKSAALRFMKKALKRHGQADKIVTDGLRSYPAAMKDLGNVERREMGRYLNNRAENSHLPFRRRERAMQRFRKIKSLQKFASVHASLTNHFNSERHLVDRQTFKLRRSAGWCQKDGPTLPTPLL
>CP034179.1|AZI35236.1|870375_871083_+|IS6-family-transposase
MSKTRNPFKYFHSSPEVIRLVVMMYVRFPLSLRNVEDLLSERGIDLCHETVRLWWNRFGPLFAADIRRQRVQRMRGFRHWRWHLDEMYVRLNGEMVYLWRAVDHEGEVLESYVTKKRDKSAAFRFMKKALKRHGQADKIVTDGLRSYPAAMKDLGNLERREIGRYLNNRAENSHLPFRRRERAMQRFRQMKSLQKFAAVHASLTNHFNSERHLVDRQTFKLRRSAAMAEWQSLMG
>CP034179.1|AZI35237.1|871007_871895_-|hypothetical-protein
MPVSEDLGLTPIPHPTLRQVPPSSLKPNPHNPRYLFDELPLQTLADSIRRVGVLVPLTVFRAKGSSHFTILDGQRRWICAQRLKLDLIPINEVAEPTLAENIVTMFQIHKLRKDWDLMPTALKLEVLMEELQERSDNALSELTGLDAAVVTRCKKLLWYDRNYQEMMLYADPEDRIKADFFIELYPILTDRLVSKADWFDLDKMIGAFLNKYQNRLSGFKSITDFRKIKQHISVARASGHDDEILMLLRGAVSPLRTALRFAKWAQARAETHPISDCHSAMAAERRSLNVCLSTR
>CP034179.1|AZI35238.1|872311_872875_-|transcriptional-regulator
MTQSMHDREELITLTSDIVAAHVSNNDVPIDQVSALITRVFDALSGLGAEPVVQQVPLEPAVSIRASIRPDHVACLECGRKMKMLKRHLGAEHGLTSEEYRARWGLPADHALVAPNYAAQRGAIAKQNGLGRIPTGRGNDATGRKAGRTSAAKNNSSAGAVKPAQPQTSKRRKLIQKLNKDAELKEG
>CP034179.1|AZI35239.1|873132_874794_-|recombinase-family-protein
MKAVRCAIYTRKSSEEGLEQGFNSLDAQREACAAYILSQVSEGWQLIPEDYDDGGLSGGTLERPALQRLLAHIAAGRIDIIVVYKVDRLTRSLLDFAKLVEAFDAAGTSFVSVTQSFNTTTSMGRLTLNMLLSFAQFEREVTAERIRDKIAASKARGMWMGGIPPLGYRPDGRSLAIEEDHAALVRDIFARYLKLTNVRLVADTLARDRLHTPQRVTGKGRRYGGCAFTRGQLYAILRNPIYAGDIAHKGTRYPGNHPAIIERETWEKVQQQLSDNVRGVRQNRQARASLLAGLLFDETGTPLIAVHTNKGRQRYRYYAQRAPNGADHAQSPTSIRLPAREIEQVVIRELTSLIDDPATLMERCCLPVTPDVYARIAGHSMMRQKQMLEWGNAQMRALVTRIVVHPDHIAIEIRAAALADLFGIDGSALMHTIRHNVPARLRRTGMVVRLVQDDGMTASSSLPDPVLIRLLVKAQRWWKELCSGTCDIAALARREQLSPSYITRVVRLAFLAPGIVDAITEGRLRAGVDSKALLATGAVPSDWREQEAKYLPG
>CP034179.1|AZI35240.1|874790_875219_-|DUF2924-domain-containing-protein
MTGKGKAAPYDVALLEDLSFGELKAAWGRHTGKPLPRVSAGLLRLALAWELQASVSGGISRATRQRLDQLAMDKTTTRPARPGMRLVREWNGTVHQVTIGEDGVISWQGKEWRSLSEVARAITGTRWSGPAFFGLKQKKVAA
>CP034179.1|AZI35241.1|875215_875647_-|DUF3489-domain-containing-protein
MTRLQKDKNPTVRDQAEPASGQKRRVRRMARTPADMKEVATPSARRQGDKAHQTVPSVLPKVSASPPDAGMPAPSTPKPATKLTLILTLLESEQGATSAQLMTATGWQPHTIRAALTGLRKRGHVIVRGKTGPDTCYRLEKSA
>CP034179.1|AZI35242.1|876016_877399_-|DUF1254-domain-containing-protein
MALFSALGATLLLSGVPAVAQSAARPNPSEITAQRDEALAYAAGLQGYIYGYPALDYMRMMREQTTMGLDPKGVYAPFNAFYFEDKLAEPGGMFAGRGPNTSTIYFSGWLDLSNGPVTLDAPDTQGRYYALTFADLYSEVQHTGRRTTGTKAQKILVTGPNWAGDVPSGVRVIRLNTHWGYFLGRVFVDGPKDLPRAKALMRQFRIEGAVTDPTTLDLPLQADLAAISAFKFINAFLRNNPRLPGEEALMAQFNQAGFGPKAVFDPSQLSEGARRGLERAVADGHAILVRAALARPMYKSWSPLLNPQAQGPFGFNYLNRAVVEANGILGNAAAESVYPSTLTDVNGDPLVGTRRYRLVFKAGQLPPNDAFWALNAYDLRTVDLIPNPLRRYMVSDRMSDLKYRADGAMEIRIQREAPAERDVNWLPINDGPVFLTFRIYQPGEDVLNGRYVLPGVEPLP
>CP034179.1|AZI35243.1|877607_878129_-|IS3-family-transposase
MGKPNFSDEFKRDAVAQITERGYPVAEVSVRLGVSQHSLYAWKRQLAKVVSGDASKDAEIRQLKRELARVLIHSDQGSQFTSMDWAAFIRAHNLEHSMSRRGNCHDNAVAESFFSSLKRERIRRRTYKTREQARQDVFDYIEMFYNPVRKLVRNGMLSPAQFERRQILKAESV
>CP034179.1|AZI35244.1|878629_884236_-|autotransporter-domain-containing-protein
MRRFLTVGVSGIALGAVPFAPAIAAPVPGVLDTTPPAPSVDLELELSDIAGGPVFGIDDATPVNVDTVAEGEIQQVGTATAVGGVADLLITNIGDVTIQAVATDNGGAEASAQMETGVAQSAQAANTGGVATVSLENTGSLGVVVDAVAAGTSADADARVDSYGIYQSAEGDGGASVSLTNSGTAAISVSASAEAVDADPASAYAYMETGVYQSADNSGEGAASVNLGSTGSFTLSTVATANSDEGSAEAYVESDGGIYQDAYSGEGDATVSLVNGASGTAIDAEAVLDINASAGAIGNTADADAYNSYAIYQSATAYDPEHGALASITNNGAINIKATANADAGEGSAEAYAYVYEPIYQTVQGYDGADATASIVNNGSLTLSAEAIAAGSGAADATAYLYYGISQSAEADSSGGNASVTFENSGAYDVSVDADAAGTDAYAYAYLYTAVEQQATADAGSASVALVNGSSGVVNLLATANATGAEATAYAYNYYAISQSASADGAGNIADAKLTNDGAMVISGEAIANGDDVYAKAYVSSAVYQTVEGDEGAAANALLDNNGSLSILASANALGATEANAYATVYNVIQQSADSEDGGLASLTIENSGTIDLTAVAKAITDDAAATGAYGYAYNYQAISQSADASDGSAKVVLTNSSTGVINIKAVADATDANDATAYAYVESAVSQHAYADLANRSADLTITNDGTISILADAGAVGEDAFASATVDYAIYQYAQGDEGANANVLIDNNGTLNIAVAANAMGGTEADASASVSSGITQYAYTYGGGDASIVFDNSGTVNVTVVADAAADDAEASAVMETAIYQYALADEGTASVSLTNSGTLNFGADAGAIGDSDASATASVSQAISQYADGADGNALTFTNTSTGVVNINAVATGTADEVDAYAGAWGLYQSSPQPGAVFTVTNAGKFNVLATAVANGATTDQATATASGIYIRPTGATGVVNITNSGSLNVSADATAKVYAEANAYGLDVSAGSAVTGTIINSGTIKAVAKANATGSDPADGGSAEATAVYISAGSTNSLALTNSGVIQADAVTDPEGNARATGVVLFGGAGDDQFTLTNAAGSIIARQSTDLGATYVWGTAIDTDNASTPALINLMGDGSTYSGVYPNVALKDPQFGYVYGNIEIKDGDAIVVSKGETWFDGAINTITNRGDNEEPLPGELEPAVIDLGTPDGSFTIKSDGLFFMLDDRYNFVTAKDYAGPSKVNVDSFTIEGKGVLALHLPGTSPAAVVLGDYPQVFANTVNLDPDGKGNEAILEVRQASANGLYSNAYHYEDVVVSLTGEEGLTGKFAQVRTQSVLLGAKDDYSDNDGTIDLDVTRIGFGDVAGLNINQTAVGDGIEGTYAPTLTGPYAGMLSSLFTIADPAEYALALDQLSADLYAGYLRSSTMAGARFNGLIYDMAECGKGSITNELCRTENGGPRIWLTGNYGRVDTDGDVEASGFTAEQYYIAAGVDFAVSPNFVLGVAGAYLENNMDFDLYDGRIDSSGWQGGIYANYDAGKFYVKGAISYSDLDGDSSRTVGFGQTPGFNGGKPFGGAITGDPDVNVWAAGAEAGVRFALSENATLTPYASLDYAHAKLKRFTEAGLPGANLTIAGSDEFFAGELGIELQAQMGNIAPYIRGGWQHNFGNDTAHFHAAFADAPAGTDFRVISEDFSSDAGVVEVGLAAQFSPNFNAHLGYQGRFSSDVEEHSGGLTLSYLFGGAEPAAPPPPPPPPPPPPPPPPPPQVVCNKGPYIVFFDWDKSDITPEASTILDSAVTAYGNCDVVPIMLAGYTDRSGSTQYNDGLSARRNTSVRGYLTSKGIPDERITSQAFGEANPRVPTADGVRELQNRRVEITYGPGSGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034179_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034179_2

1650376-1650567

Orphan

Consensus_repeat	Method
CAACCGGTGGCGCCGGCGGCAACGGCGGC	PILER-CR

2 spacers

The CRISPR arrays of CP034179_2

>merge|CP034179|2|1650376-1650567|PILER-CR
GGTGGCGCCGGTGGCAACGGCGGCGCGTTGACGTTAACCGAGGATGCGGCGTCGGTCATCAGCAACCGCGATAGCGGCACCGCCGCAGTGATCCTGAAGTCCACCGGTGGCAATGGCGGCAACGCTCAGTCCGCGTCTACCAATATCGATACCGCGCGCGGTGCAACCGGCGGCGCGGGCGGCAACGGCGGC

>CP034179|2|1|1650376-1650567|PILER-CR
GGTGGCGCCGGTGGCAACGGCGGCGCGTT	GACGTTAACCGAGGATGCGGCGTCGGTCATCAGCAACCGCGATAGCGGCACCGCCGCAGTGATCCTGAAGTCCACC
GGTGGCAATGGCGGCAACGCTCAGTCCGC	GTCTACCAATATCGATACCGCGCGCGGTGCAACCGGCGG
CGCGGGCGGCAACGGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP034179.1\|AZI35835.1\|1659702_1660392_-\|conjugal-transfer-protein-TrbF	unknown	unknown	gnl\|CDD\|184356
CP034179.1\|AZI35824.1\|1641053_1641308_-\|hypothetical-protein	unknown	unknown	unknown
CP034179.1\|AZI35823.1\|1639564_1640680_+\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|235035
CP034179.1\|AZI35838.1\|1662083_1662854_-\|P-type-conjugative-transfer-protein-TrbJ	unknown	unknown	gnl\|CDD\|184358
CP034179.1\|AZI35830.1\|1646627_1648157_+\|UbiD-family-decarboxylase	unknown	unknown	gnl\|CDD\|376697
CP034179.1\|AZI35826.1\|1643486_1643948_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240036
CP034179.1\|AZI35837.1\|1661753_1662062_-\|conjugal-transfer-protein-TrbK	unknown	unknown	gnl\|CDD\|275154
CP034179.1\|AZI35833.1\|1657308_1657542_-\|DUF2274-domain-containing-protein	unknown	unknown	gnl\|CDD\|370791
CP034179.1\|AZI35822.1\|1638197_1639445_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340878
CP034179.1\|AZI35832.1\|1656412_1657297_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP034179.1\|AZI38181.1\|1655836_1656055_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227647
CP034179.1\|AZI35836.1\|1660391_1661750_-\|P-type-conjugative-transfer-protein-TrbL	unknown	unknown	gnl\|CDD\|237537
CP034179.1\|AZI35839.1\|1662856_1665295_-\|conjugal-transfer-protein-TrbE	unknown	unknown	gnl\|CDD\|237536
CP034179.1\|AZI35831.1\|1648165_1649341_-\|hypothetical-protein	unknown	unknown	unknown
CP034179.1\|AZI38182.1\|1657544_1658666_-\|TrbI/VirB10-family-protein	unknown	unknown	gnl\|CDD\|225499
CP034179.1\|AZI35828.1\|1644631_1645093_-\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
CP034179.1\|AZI35827.1\|1643935_1644556_-\|6-phosphogluconolactonase	unknown	unknown	gnl\|CDD\|238694
CP034179.1\|AZI35825.1\|1641491_1642781_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379050
CP034179.1\|AZI35829.1\|1645186_1645750_-\|hypothetical-protein	unknown	unknown	unknown
CP034179.1\|AZI35834.1\|1658722_1659706_-\|P-type-conjugative-transfer-protein-TrbG	unknown	unknown	gnl\|CDD\|377058

Protein	Function_ID	Function_description	E-value
CP034179.1\|AZI35835.1\|1659702_1660392_-\|conjugal-transfer-protein-TrbF	gnl\|CDD\|184356	PRK13872, PRK13872, conjugal transfer protein TrbF; Provisional.	2.14753e-168
CP034179.1\|AZI35839.1\|1662856_1665295_-\|conjugal-transfer-protein-TrbE	gnl\|CDD\|237536	PRK13873, PRK13873, conjugal transfer ATPase TrbE; Provisional.	0
CP034179.1\|AZI35823.1\|1639564_1640680_+\|DNA-polymerase-IV	gnl\|CDD\|235035	PRK02406, PRK02406, DNA polymerase IV; Validated.	0
CP034179.1\|AZI35838.1\|1662083_1662854_-\|P-type-conjugative-transfer-protein-TrbJ	gnl\|CDD\|184358	PRK13874, PRK13874, conjugal transfer protein TrbJ; Provisional.	7.711e-109
CP034179.1\|AZI35830.1\|1646627_1648157_+\|UbiD-family-decarboxylase	gnl\|CDD\|376697	pfam01977, UbiD, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase. This family has been characterized as 3-octaprenyl-4- hydroxybenzoate carboxy-lyase enzymes. This enzyme catalyzes the third reaction in ubiquinone biosynthesis. For optimal activity the carboxy-lase was shown to require Mn2+.	4.90909e-74
CP034179.1\|AZI35826.1\|1643486_1643948_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240036	cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.22566e-23
CP034179.1\|AZI35837.1\|1661753_1662062_-\|conjugal-transfer-protein-TrbK	gnl\|CDD\|275154	TIGR04360, hypothetical_protein, conjugative transfer region protein TrbK. Members of this family regularly are encoded between the TrbJ and TrbL proteins essential for P-type conjugal transfer, and therefore are designated TrbK. Positional analogy to family TIGR04359 (the entry exclusion lipoprotein TrbK of IncP plasmid RP4), which is a lipoprotein and not homologous, suggests this protein may also be involved in entry exclusion. Members of this family are small, with a non-lipoprotein signal peptide and a conserved disulfide bond. [Mobile and extrachromosomal element functions, Plasmid functions].	4.59282e-19
CP034179.1\|AZI35833.1\|1657308_1657542_-\|DUF2274-domain-containing-protein	gnl\|CDD\|370791	pfam10038, DUF2274, Protein of unknown function (DUF2274). Members of this family of hypothetical bacterial proteins have no known function.	1.2036e-34
CP034179.1\|AZI35822.1\|1638197_1639445_-\|MFS-transporter	gnl\|CDD\|340878	cd17320, MFS_MdfA_MDR_like, Multidrug transporter MdfA and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as MdfA (also called chloramphenicol resistance pump Cmr), EmrD, MdtM, MdtL, bicyclomycin resistance protein (also called sulfonamide resistance protein), and the uncharacterized inner membrane transport protein YdhC. EmrD is a proton-dependent secondary transporter, first identified as an efflux pump for uncouplers of oxidative phosphorylation. It expels a range of drug molecules and amphipathic compounds across the inner membrane of E. coli. Similarly, MdfA is a secondary multidrug transporter that exports a broad spectrum of structurally and electrically dissimilar toxic compounds. These MDR transporters are drug/H+ antiporters (DHA) belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	5.303e-73
CP034179.1\|AZI35832.1\|1656412_1657297_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.37007e-46
CP034179.1\|AZI38181.1\|1655836_1656055_+\|hypothetical-protein	gnl\|CDD\|227647	COG5342, COG5342, Invasion protein B, involved in pathogenesis [General function prediction only].	1.56159e-05
CP034179.1\|AZI35836.1\|1660391_1661750_-\|P-type-conjugative-transfer-protein-TrbL	gnl\|CDD\|237537	PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional.	0
CP034179.1\|AZI38182.1\|1657544_1658666_-\|TrbI/VirB10-family-protein	gnl\|CDD\|225499	COG2948, VirB10, Type IV secretory pathway, VirB10 components [Intracellular trafficking and secretion].	5.15466e-77
CP034179.1\|AZI35828.1\|1644631_1645093_-\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	1.47097e-43
CP034179.1\|AZI35827.1\|1643935_1644556_-\|6-phosphogluconolactonase	gnl\|CDD\|238694	cd01400, 6PGL, 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate. 6PGL is thought to guard against the accumulation of the delta form of the lactone, which may be toxic through its reaction with endogenous cellular nucleophiles.	4.53382e-45
CP034179.1\|AZI35825.1\|1641491_1642781_-\|hypothetical-protein	gnl\|CDD\|379050	pfam13175, AAA_15, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	2.00223e-18
CP034179.1\|AZI35834.1\|1658722_1659706_-\|P-type-conjugative-transfer-protein-TrbG	gnl\|CDD\|377058	pfam03524, CagX, Conjugal transfer protein. This family includes type IV secretion system CagX conjugation protein. Other members of this family are involved in conjugal transfer to plant cells of T-DNA.	1.54484e-80

>CP034179.1|AZI35831.1|1648165_1649341_-|hypothetical-protein
MAEMEQKLADCVGGIYEAVTGTQSWQSVASQLGEIMDAQSVLLNLVAENGNVESLMPIGEADAVYASYYHRTDPYVARARADYADNRNFHIGRALPGEALVPDRAFIRSEYYNDFASRYERRYMIGGMLGVEQAAPLGLYRGSSHRPFENRDIQMLQILLPHFQRALELRARLGQGQRANWMSQIALDALPIGIVIVDAGLRIRFVNEIGQAQIAAPGSALCAVRSGPFVEGDKYVRARSRRENADMLSLVESAANGGSGGSMRVMDEGRLPWALLVSPTPARLMLDDAGPGLGRGLALIVFQPLHRKTTPPVELLCDVFGFSRAEAQVAIALSGGVSAEGVAQRRGVSLVTVRGQIRSILGKSECENLRDFERAMAMLATIKPQEDPMVG
>CP034179.1|AZI35830.1|1646627_1648157_+|UbiD-family-decarboxylase
MAHILSPPISEGNAKGRCGHDLLSATMALNDLRDYLQTLRSFGEIQDIALPVALDLEVSAIARRCYETGAPAPLFSNFSDHPQGFRLLGAPAGLSRQAGLRLARAAVSLGLPATSGGLDIVRAIAESLALPAIDPVRRTDAACFENVLIEEAVDLNLLPLPTQRRDDSPHRLSAWGCVVAQTPDGTWTEWSIAHLMPTGTRRMLGLCTPSRHLQTIVRSWADAERPMPFALALGVMPSIPFICCMPLPAHVNKAGRLGALLRRPLETVLCRTIALEAPASAEILIEGYLESNEILECRMGDRLGFHWAENVQKQFTCRVTAMSYRDKAILPVIGSGEPVDEYQTAYGIPAAAQFLHELRGAGLAVSDVWLPLEAAQHWIIVTVPRDWRRKSGVGGSDAFCRHIGERLFVHIFESAIPQIIVINDDVNPTANDEILWALATRCHPENGRVHCGHIENERVQTDKIVYNCLPPEEWGEALPIRASFRHGYPSHIVERVLSRWEAYGFREID
>CP034179.1|AZI35829.1|1645186_1645750_-|hypothetical-protein
MPSFFLAMIAAALASFGGRDQRLVAHLSGTLGATLPLLAVAWLAVVATSALAAIAGAALATTMPAAAKHMLVAFALVLGAVELLWQRPLREAEEPTRSAFAILIVLGALQLGDGARFLVLAVAVATGDPVLAALGGAVGSGAVLTAGWAMGPGLGNGLPLRAIRYTAAALMAGAGLIIGLSARGLLG
>CP034179.1|AZI35828.1|1644631_1645093_-|DNA-starvation/stationary-phase-protection-protein
MAKAGDNARKALVDELNGVLADHLALYIKTKSFHWHVAGPRFHDLHLLFDTQATAIFAVVDLIAERVRKNDADTLTSIGAIAGRTKVKDQDKTSLSAEKMVAELRDDNAALVARLKKLKQLAGDAGDNATDGLLDDWTDQAEQRVWFLSQTLK
>CP034179.1|AZI35827.1|1643935_1644556_-|6-phosphogluconolactonase
MNRLEIIDGADDAAIADWLHGYLAGALARSIGAVAIAVPGGSTPFPILQRLAQMPLDWPRVTVWPGDDRIVPEDHAASNIGRIRAVMAPAGAHCVPLAEQARPPHFALVWLGMGGDGHIASLFPNSDPRADDPSPVRHVRPDPLPPEAPFDRLSLTIPALLASDHVAFVIRGADKRALFTAAAAGQNDLPIARLLREATQPVTCFT
>CP034179.1|AZI35826.1|1643486_1643948_-|NUDIX-domain-containing-protein
MFHLIPAPLHRAALRLAHGLRKRWWRMARPDLVGCCMIGLDDRGRVLLVRHSYGTGLWALPGGAMRRGEDPAHAAAREWGEEIGCALADLRAVAVLDHTLHGAHNTVYLFAGRIAGEPVADGREIAEIGLFPPDALPPARSRTVDTRLALLTP
>CP034179.1|AZI35825.1|1641491_1642781_-|hypothetical-protein
MATLTIDNFSCIKTARFEMAPVTVLIGPQGSGKSVTTKLFYFCLDALSRQYIFAEKGQTLEEFQKDTAKHFKTWFPASAWGDSRFNITFQSGEFSVRLLRKMSKSKPTDEISVKFSDFFKAHYAGLLSSYEKMRTKEIDDEALTRRSEGAWRIREASHARLAKAMDSAYIQRQTFIPAGRAFYTSVGRLVAALDQGSSLDPINVRFARLFANFRDIVNRHGIFAAPKDTDAKAARDKVMGELFGGTIKFENDLEFIEAPDGRIIPFSALSSGQQELLPMWLMIDFYADRLPGSGAAGDLFYIEEPEAHLFPSAQSRLMDVLISHLVSKKKNRSLILTTHSPYILSNINNYIKAGELGRYRKNASAVADVVDRDLWLTSSGVKAYAIDDGHLVDIIDSDDGLINASYIDGVSNEASLTFSKLLDIEYPEG
>CP034179.1|AZI35824.1|1641053_1641308_-|hypothetical-protein
MGSVIVELKGKDLDHACQQVMATIAHADCQPWLEAKRGILIVCSRYPSFDTSVAKAKVAARKRGIRLSVVCDKADTEFEKVLTG
>CP034179.1|AZI35823.1|1639564_1640680_+|DNA-polymerase-IV
MSPDAPDSAEEDAIGLRKIIHVDMDAFYASVEQRDNPELRGRPVAVGGSASRGVVAAASYEARRFGVRSAMPSARAKRLCPDLVFVRPRFDAYRGVSRQIHAIFADYTALIEPLSLDEAYLDVTADLRGIGSATRIADLIRQRIRNDLQLTASAGVSYNKFLAKIASDQNKPDGVCVIRPGQGAQFVAGLPVRRFHGVGPRGAEKMARLGIETGADLAAKDIAFLKQHFGKFADYLYRAARGIDLRPVQPNRPRKSVGGERTFAQDISTGPALRETLDTIVDIVWDRIERADARGRTVTLKLRYADFALVTRARSVAQRVADKTEFAALGHALLDEMLPLPQPIRLMGLTLSALEGEPEERPKDTAQLSLL
>CP034179.1|AZI35822.1|1638197_1639445_-|MFS-transporter
MTTSGSVSSRPFPMGEREFVVMMALFQALQALAIDAMLPALGIMSRDLGVADSNQRQLVVGVFLLCAGLGSLFPGAIADRYGRRPVLFTCLGGYIVFSLAAALMRDFTALLVMRGLAGFMSAGMLVMSTTIIRDRFQGDKMARTQSLVGMVFMIVPMIAPTLGQAVLLVADWRWIFGIMAGLGGMLAVWAALRLPETLHPEYRQTIAVRVIAANMRTALMTRAATGYVFGMALIQGALFGYINSSQQLVAEHFGAGESFPLIFGGMALMMALANLTNSRIVERFGARRVSHTALFGFMLLGAVQLWLALRGGETLWEFAPVMTLNLCLMGFIGANFGSIALQPFARIAGAAASLQTFLRLVIGSALGAFIGQLYDGSAVPLAAALMIAGILALLLVLFSERGRLFQRRHGVVPQV
>CP034179.1|AZI38181.1|1655836_1656055_+|hypothetical-protein
MSFEAQVPILFHTCIPTSCLVDISHDAATLTALRATLARKVKVTADDDAAMSFRILLQGLGAALDWVAALSR
>CP034179.1|AZI35832.1|1656412_1657297_+|LysR-family-transcriptional-regulator
MNVQQLRYFVAASDFGSFRKAGAALGVQESTISRRIRDLEDDLGSALFRRHSGGVCLTIAGQRLLSRARKVLRYVSEGAEIVGAVGRVKDGHLRVGIYTSLASGFLLELLKSFGEQHGGVQLEIADGNPAEHVAAIRQFRLDIAFLTGTHDWPECETAHLWNERVFVVLPQGHTLAQKDEVIWSEIAHENFIVSDAPPGQEIHDYLVKRVGDLGRHPEIQTQFVGRDNLMPLVALGRGLTVTSEATTAAHVPGICYRPLVGEILPFSAVWSPKNDNPALRRFVSMAKSQARRRV
>CP034179.1|AZI35833.1|1657308_1657542_-|DUF2274-domain-containing-protein
MTKLKLGPITDDKPVKITVELPASLHRDLIEYGRLLAEGGAPVEPAKLIVPMLDRFIATDRGFAKARRPRTAGEPAS
>CP034179.1|AZI38182.1|1657544_1658666_-|TrbI/VirB10-family-protein
MRLRAEPPRVTRLSRKVLASVAAVALVGIGGTLIYALQTHTSGDGPKEELYSTTNRQAADGLAGLPKDYTGPVLGPALPGDLGRPILNAQNAGQPVTTPTVATPAPGVSEAEQRRRAEEEAARTSVVFFQARSGSAATSGAGAMSGLAGLDTTAQPGQATAQDKQLAFLNAAVDRRTVTPDRVTPPASPFILQAGSVISAALITGIRSDLPGQITAQVTENIYDSPTGRILLVPQGTRLIGQYDNNVQAGQRRVLLVWNRLILPNGRSIVLERQPGADGQGYAGLEDGVDYHWWDLAKAAGLSTLLSVGAELAIDDQDQLLRAIRNGGQDTINDAGQQIVRRQLNVAPTLTIRPGFPVTIVITRDLVLEPFRN
>CP034179.1|AZI35834.1|1658722_1659706_-|P-type-conjugative-transfer-protein-TrbG
MNPAFRIAVLPGFRKPAALALMLSATALAGCATMTKPPQIDYDASVPPLPAIPAAVVDDQPKPLHIPPAWTVARGGTAASTPTGRVENANTAARVEPRREGYYNAIQIYPWSEGALYQVYAVPGQITDIALEPGESLTGAGPIAAGDTARWIIGDTESGAGVTRRVHILVKPSRPDITTNLVVTTDRRTYMIELRSGEKPYMPSVAWSYPQPPAGQRQAIPATPVIPAVASRNYRYALTGGNPPWKPLTVYDDGRHVYVEFARGIVQGEMPPLFVIGPEGEAQIVNSRIYQHILIVDRLFGAAELRLGSGDKQQTVRIVRTDGRPQS
>CP034179.1|AZI35835.1|1659702_1660392_-|conjugal-transfer-protein-TrbF
MNLFKRPAAHYGKTPEPETPYQKAAQVWDERIGSARVQAKNWRYMAFGSLILSAGFASALVWQSARGTVVPWVVQVDHLGQAQAVAPADADYRPTDPQIAWHLGRFIEQVRSIPADPIIVRQNWLRAYEWTTDRGASALNDYARTNDPFTKVGRQQIAVEVSSVIRASPDSFRVAWIERRYENGQLAATERWTAILTIAIQPSRDAERLKANPLGIYVNAINWSRELSQ
>CP034179.1|AZI35836.1|1660391_1661750_-|P-type-conjugative-transfer-protein-TrbL
MGGVGVIDKFLGTFTRYIDSGFGLLSGEVAFIATTLIVIDVTLAALFWSWSADDDIIARLVKKTLFVGIFAYLIGNWQNLAQIIFDSFAGLGLKASGTSFSADDLMRPGKVAQTGLDAARPLLDAISPLMGWISVFENLIQIVCLLFAWALVILAFFILAIQLFVTLIEFKLSTLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVLAVIIGIGSTLFGEFTKGFGNTTPTVDDAMAIVLAALSLLGLGIFGPGIANGLVSGGPQLGAGAAIGTGLAVGGAAMAAGGGAMLAARGGAAMVSGGAAVARGGATAAGAASSAYSLGSMGQSGAAGVASGMGGVARAAGSAAVSPLRRAATRAAESMKSSFSEGAKAGFGATGGSSTMGTIGGGAEAASTPAASAGGGAPDWAKRMKRSQTMSHGVSAAAHAVRSGDSHGSGSSINLSESDR
>CP034179.1|AZI35837.1|1661753_1662062_-|conjugal-transfer-protein-TrbK
MDGKMLARLGAIIFVAVAVTATAIEMTRKEDASVSPPARVQQPAEDPLREGQRRCQQLGQAAASNPECLALWAETRDRFLGHAPASSVAPLAPASPAVSEGR
>CP034179.1|AZI35838.1|1662083_1662854_-|P-type-conjugative-transfer-protein-TrbJ
MKANSIRSRAMALAATMLAAAPLAISPMVATPAHAQWTVFDPSNYAQNILTAARTLQQINNQITSLQNEAQSLINQAKNLASLPYSSLQALQQNVQRTQQLLSQAQGIAFNVQQIDQMFAQKYANVSMSVTDAQLVTDARSRWQNTVGGLQDAMRVQAGVVGNIDTNRTQMSNLVSQSQSASGALQATQAGNQILALQSQQLSDLVALLAANGRAGALTEAERAAAAEQGREQRRRFLTPGTAYTPGNAQMFNNGN
>CP034179.1|AZI35839.1|1662856_1665295_-|conjugal-transfer-protein-TrbE
MMNLSEYRRTASRLADFLPWAALVAEGVVLNKDGSFQRTAKFRGPDLDSAVAAELVAVASRINNAFRRLGSGWSIFVEAQRSEAATYPNSLLPDPASGLVDAERKADFEEAGAHFVSGYYLTFLYLPPAEEAARAESWLYEGRERAGIDPNEILRTFTDRTDRVLALLDGFMPECAWLDDSETLTYLHSTVSTKRHRVRVPETPVYLDALLADQPLTGGLEPRLGGDHLRILTIVGFPTATTPGLLDDLNRLAFPYRWSTRAILIDKTDATRLLTKIRRQWFAKRKSIAAILKEVMTNEASALVDTDASNKAADADMALQELGADVAGMAYVTATITVWDADPRIADEKLRLAEKVIQGRDFTAMVETVNAVDAWLGSLPGHAYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPPLLYGKTEGSTPFRLSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYPQAQVFAFDFGGSIRAAALAMGGDWHDLGGGLTEGDDFSVSLQPLARIDDTYERAWAADWLVAILMREGITITPEVKEHIWTALTSLASAPVGERTITGLSVLLQSNDIKQALRPYCVGGAYGRLLDAEVEHLGHADVQAFEIEGLVGIGAAPAVLSYLFHRIGDRLDGRPTLLIIDEGWLALDDEGFAGQLREWLKTLRKKNASVIFATQSLSDIDNSNIAPAIIESCPTRLLLPNERAIEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVGLALCAASSKSDQSLIASLVAEHGRAGFLAAWLRARDTGWAADLIPNFPEAEKES

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034179_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034179_3

3231430-3231513

Orphan

Consensus_repeat	Method
GCATCGCGCAAAAAAGTGGGAACCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034179_3

>merge|CP034179|3|3231430-3231513|CRISPRCasFinder
GCATCGCGCAAAAAAGTGGGAACCGGTTTTTTGCACAAGCGATGCGTAGGGCAGGCGCGCATCGCGCAAAAAAGTGGGAACCGG

>CP034179|3|2|3231430-3231513|CRISPRCasFinder
GCATCGCGCAAAAAAGTGGGAACCGG	TTTTTTGCACAAGCGATGCGTAGGGCAGGCGC
GCATCGCGCAAAAAAGTGGGAACCGG

Protein	Signature genes	Signature genes Name	Protein_function
CP034179.1\|AZI37139.1\|3223683_3224049_+\|preprotein-translocase-subunit-YajC	unknown	unknown	gnl\|CDD\|235518
CP034179.1\|AZI38338.1\|3239617_3241531_+\|DNA-polymerase-III-subunit-gamma/tau	unknown	unknown	gnl\|CDD\|236382
CP034179.1\|AZI37144.1\|3228538_3229012_+\|hypothetical-protein	unknown	unknown	unknown
CP034179.1\|AZI37137.1\|3222294_3222732_-\|type-II-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|376496
CP034179.1\|AZI37149.1\|3232906_3233584_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|223816
CP034179.1\|AZI37154.1\|3238992_3239271_+\|ETC-complex-I-subunit	unknown	unknown	gnl\|CDD\|368126
CP034179.1\|AZI37151.1\|3235021_3235321_-\|chorismate-mutase	unknown	unknown	gnl\|CDD\|181719
CP034179.1\|AZI37145.1\|3228996_3229578_-\|uracil-DNA-glycosylase-family-protein	unknown	unknown	gnl\|CDD\|381683
CP034179.1\|AZI37148.1\|3232465_3232783_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377032
CP034179.1\|AZI37142.1\|3226679_3227873_-\|glycosyltransferase-family-4-protein	unknown	unknown	gnl\|CDD\|340828
CP034179.1\|AZI37150.1\|3233516_3234995_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|223715
CP034179.1\|AZI37155.1\|3241541_3241883_+\|YbaB/EbfC-family-nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|234669
CP034179.1\|AZI37146.1\|3229633_3231415_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223562
CP034179.1\|AZI37152.1\|3235386_3236397_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|182813
CP034179.1\|AZI37147.1\|3231682_3232396_+\|DUF541-domain-containing-protein	unknown	unknown	gnl\|CDD\|225516
CP034179.1\|AZI37140.1\|3224061_3225666_+\|protein-translocase-subunit-SecD	unknown	unknown	gnl\|CDD\|235615
CP034179.1\|AZI37138.1\|3222814_3223228_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371484
CP034179.1\|AZI37153.1\|3236506_3238936_+\|ATP-dependent-helicase-HrpB	unknown	unknown	gnl\|CDD\|273901
CP034179.1\|AZI37143.1\|3227869_3228442_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP034179.1\|AZI37141.1\|3225679_3226657_+\|protein-translocase-subunit-SecF	unknown	unknown	gnl\|CDD\|237275

Protein	Function_ID	Function_description	E-value
CP034179.1\|AZI37139.1\|3223683_3224049_+\|preprotein-translocase-subunit-YajC	gnl\|CDD\|235518	PRK05585, yajC, preprotein translocase subunit YajC; Validated.	4.41663e-35
CP034179.1\|AZI38338.1\|3239617_3241531_+\|DNA-polymerase-III-subunit-gamma/tau	gnl\|CDD\|236382	PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated.	0
CP034179.1\|AZI37137.1\|3222294_3222732_-\|type-II-3-dehydroquinate-dehydratase	gnl\|CDD\|376496	pfam01220, DHquinase_II, Dehydroquinase class II.	4.24443e-78
CP034179.1\|AZI37149.1\|3232906_3233584_+\|DNA-binding-response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.37277e-84
CP034179.1\|AZI37154.1\|3238992_3239271_+\|ETC-complex-I-subunit	gnl\|CDD\|368126	pfam04800, ETC_C1_NDUFA4, ETC complex I subunit conserved region. Family of pankaryotic NADH-ubiquinone oxidoreductase subunits (EC:1.6.5.3) (EC:1.6.99.3) from complex I of the electron transport chain initially identified in Neurospora crassa as a 21 kDa protein.	3.15291e-38
CP034179.1\|AZI37151.1\|3235021_3235321_-\|chorismate-mutase	gnl\|CDD\|181719	PRK09239, PRK09239, chorismate mutase; Provisional.	2.44476e-47
CP034179.1\|AZI37145.1\|3228996_3229578_-\|uracil-DNA-glycosylase-family-protein	gnl\|CDD\|381683	cd10033, UDG_like, uncharacterized family of the uracil-DNA glycosylase superfamily. Uracil-DNA glycosylases (UDGs) initiate repair of uracils in DNA. Uracil may arise from mis-incorporation of dUMP residues by DNA polymerase or via deamination of cytosine. Uracil in DNA mispaired with guanine is one of the major pro-mutagenic events, causing G:C->A:T mutations; thus, UDG is an essential enzyme for maintaining the integrity of genetic information. UDGs have been classified into various families on the basis of their substrate specificity, conserved motifs, and structural similarities. Although these families demonstrate different substrate specificities, often the function of one enzyme can be complemented by the other. UDG family 1 is the most efficient uracil-DNA glycosylase (UDG, also known as UNG) and shows a specificity for uracil in DNA. UDG family 2 includes thymine DNA glycosylase which removes uracil and thymine from G:U and G:T mismatches, and mismatch-specific uracil DNA glycosylase (MUG) which in Escherichia coli is highly specific to G:U mismatches but also repairs G:T mismatches at high enzyme concentration. UDG family 3 includes Human SMUG1 which can remove uracil and its oxidized pyrimidine derivatives from, single-stranded DNA and double-stranded DNA with a preference for single-stranded DNA. Pedobacter heparinus SMUG2, which is UDG family 3 SMUG1-like, displays catalytic activities towards DNA containing uracil or hypoxanthine/xanthine. UDG family 4 includes Thermotoga maritima TTUDGA, a robust UDG which like family 1, acts on double-stranded and single-stranded uracil-containing DNA. UDG family 5 (UDGb) includes Thermus thermophilus HB8 TTUDGB which acts on double-stranded uracil-containing DNA; it is a hypoxanthine DNA glycosylase acting on double-stranded hypoxanthine-containing DNA except for the C/I base pair, as well as a xanthine DNA glycosylase which acts on both double-stranded and single-stranded xanthine-containing DNA. UDG family 6 hypoxanthine-DNA glycosylase lacks any detectable UDG activity; it excises hypoxanthine. Other UDG families include one represented by Bradyrhizobium diazoefficiens Blr0248 which prefers single-stranded DNA and removes uracil, 5-hydroxymethyl-uracil or xanthine from it.	5.01277e-93
CP034179.1\|AZI37148.1\|3232465_3232783_+\|hypothetical-protein	gnl\|CDD\|377032	pfam03413, PepSY, Peptidase propeptide and YPEB domain. This region is likely to have an protease inhibitory function (personal obs:C Yeats). This model is likely to miss some members of this family as the separation from signal to noise is not clear. The name is derived from Peptidase & Bacillus subtilis YPEB.	0.00205057
CP034179.1\|AZI37142.1\|3226679_3227873_-\|glycosyltransferase-family-4-protein	gnl\|CDD\|340828	cd03798, GT4_WlbH-like, Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.	6.25624e-67
CP034179.1\|AZI37150.1\|3233516_3234995_+\|histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	4.73503e-40
CP034179.1\|AZI37155.1\|3241541_3241883_+\|YbaB/EbfC-family-nucleoid-associated-protein	gnl\|CDD\|234669	PRK00153, PRK00153, YbaB/EbfC family nucleoid-associated protein.	2.1898e-30
CP034179.1\|AZI37146.1\|3229633_3231415_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	2.49349e-155
CP034179.1\|AZI37152.1\|3235386_3236397_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|182813	PRK10888, PRK10888, octaprenyl diphosphate synthase; Provisional.	1.13662e-101
CP034179.1\|AZI37147.1\|3231682_3232396_+\|DUF541-domain-containing-protein	gnl\|CDD\|225516	COG2968, COG2968, Uncharacterized conserved protein [Function unknown].	1.05018e-47
CP034179.1\|AZI37140.1\|3224061_3225666_+\|protein-translocase-subunit-SecD	gnl\|CDD\|235615	PRK05812, secD, preprotein translocase subunit SecD; Reviewed.	0
CP034179.1\|AZI37138.1\|3222814_3223228_-\|hypothetical-protein	gnl\|CDD\|371484	pfam11351, GTA_holin_3TM, Holin of 3TMs, for gene-transfer release. This is a family of bacterial 3TM holins. In Rhodobacter capsulatus the protein is expressed just overlapping and downstream of a putative N-acetylmuramidase lysozyme (an endolysin) thought to be responsible for lysing a phage particle, RcGTA - a gene-transfer agent. A holin would be necessary for such an endolysin to access the peptidoglycan. Gene-transfer agents are bacteriophage-like genetic elements with the sole known function of horizontal gene transfer, serving an important role in microbial evolution. In order to be released from the cell these require the combined action of an endolysin and this holin.	1.06012e-24
CP034179.1\|AZI37153.1\|3236506_3238936_+\|ATP-dependent-helicase-HrpB	gnl\|CDD\|273901	TIGR01970, ATP-dependent_RNA_helicase_HrpB, ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. [Unknown function, Enzymes of unknown specificity].	0
CP034179.1\|AZI37143.1\|3227869_3228442_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	2.44941e-09
CP034179.1\|AZI37141.1\|3225679_3226657_+\|protein-translocase-subunit-SecF	gnl\|CDD\|237275	PRK13022, secF, protein translocase subunit SecF.	8.74411e-115

>CP034179.1|AZI37146.1|3229633_3231415_-|ABC-transporter-ATP-binding-protein
MAPPPILSWESLGLIQGAGWLFQDINLHIAPRDRIALIGRNGAGKTTLLKLIANRIEADAGTRTVQPGTRVVMLEQEPDFSGFDTLLDFAIAGEHAPAQHEVEAIAGQIGIDLSRSAASASGGERRRTALARALASEPDLLLLDEPTNHLDLGAIDWLEDWLGRYNGAFVVISHDRTFLTRLTRATLWLDQGSLRRREIGFGGYEAWEEQVFAEQARAAERLDAKLKIEAHWLERGVTARRKRNQGRLEKLYEMRAQRASMLSPTGNAKLALSNDDSKTKSVIVAEHVTKRFGDRTIIKDFSLRIQRGDRIGVVGSNGAGKSTLLKLLTGELSPDEGTVTLAKTLTGIVIDQQRSLISPEKTVRQILAEGGDWIDVQGVRKHIQGYLKEFLFDPGIVDMKVGVLSGGERSRLLLAREFSRKSNLLVLDEPTNDLDLETLDLLQEVIADYDGTVLIVSHDRDFLDRTVTVTLGLDGSGAVDIVAGGYADWEAKRKQRVAPTKVKAARVEIAPPPPPKKTKLSYKDQRDFDLLPDRIAELEAHIARDEAALSDPALYTSDPKKFASLTAAIDKARVEKDAAEERWLELAEMVEAL
>CP034179.1|AZI37145.1|3228996_3229578_-|uracil-DNA-glycosylase-family-protein
MTDLHRAIAACRLCEAFLPHGVRPVVQFSATSRLVIVGQAPGSKVHASGIPWNDASGARLCEWTGLSHEDLHDPAHVAIVPMGFCYPGKGKSADLPPRPECAPQWHAKVMAAMPEKCLTLLVGSHAQGYYLRGRDRLSMTDRVRNFTAYAPDFLPLPHPSWRSTIWMRQNPWFESTVLPHLRERIAGILQGIR
>CP034179.1|AZI37144.1|3228538_3229012_+|hypothetical-protein
MRRELAERELADNSVNGAGRLCQRRRKVTVNLAESPLGWLHARGHIDDRLFAAGEALRSDFERAQLAPRTTMRWEPVRVRGGGEAGLTPTERQIAAKARFDGALATAGRGLADILWRVVCAGESVPHAEKALNWPVRSGKLVLRLALDRVADFYRIP
>CP034179.1|AZI37143.1|3227869_3228442_-|XRE-family-transcriptional-regulator
MINRIRDIRKEKGMTLADVAAACAPATTAQTIGRLETGMRNLSLGWMNRIAAALGVDPEMLVRGEDAAPAQIVARLTESGAEALANPRDAILPSDLAGGDALLCLAVDSSAGEYRAGDQLWLRQIAPEDSVQAINRDVLVPRKGGRFAFGRLIDRSGTLVGLLPPGIGQRQIVIDNPPWLAVAHMLVRKL
>CP034179.1|AZI37142.1|3226679_3227873_-|glycosyltransferase-family-4-protein
MIASRRVLSLSTLYPNALSPRFGTFVARSLEALAARGDWDVTVVNPIGIPPIAFGPYRALRDAALDGVEGGVQVYRPRFTLIPRVGGRFNPGAIVRAALPLVRRLHAEKPFDVIDAQFFYPDGPAIARIAAALNVPYSIKARGADISFWGRKPYALRMMREAADGATGLLAVSRALADDMATIGLPSDRMSLHYTGLDRTLFHPRNRAETRRHLASLHGTALPASGRLLATVGALIPRKGQAYVIRALPDLPDAHLLLVGKGQDESLLRDLAKELGVAERVHFLGSLDHTALPLVLAACDAMVLPSASEGLANAWVEALACGTPLVITEAGGARELVKDDSAGLIVPRDSRAIAAAVRDLLSSPRDPAVVAAHAAPFSWENNAAALAAWYESLAGAH
>CP034179.1|AZI37141.1|3225679_3226657_+|protein-translocase-subunit-SecF
MKLLKLVPDNTNIHFLKWQWPFFISNILAMIGAVVLLFTHGLNLGVDFVGGQMIRATFVESTVAPVADLRESVGKLGYGEPIIQQFGKPNEVSIRMKLPEGAEDHAELADAMANKITGTLKQTYPGVRIDGVDSVSGKVSGELFKTGMLALLLAMVGISIYIWVRFEWQFGVGALFALVQDLLLTIGMFSLTQMEFDLNIVAALLTLLGYSLNDKIVVYDRIRENLKKYRKMPMPELLDLSVNETLSRTVATSLAVLIMLFSLLLLGPDVIFGFTAAITLGIFVGTYSSIFMSAPILIWLGVTQSSFVPADSGSDSPKKAAIDEA
>CP034179.1|AZI37140.1|3224061_3225666_+|protein-translocase-subunit-SecD
MLEFPPWKRAWLWFVTLALSVAALPSLVSVAGGSWPSFLPNPQVHLGLDLAGGSHILLEADSKQVAVQRLEAMEESVRGALRNAEPRVRVGDFSSRDGRLSFMVEDLGQVDAAREAILPLTSGAGMTGQRDWRIQVVDGQRFILTPSQAGIDKAVTDAMDSATEVVRKRIDALGTREPTIIRQGATRIVVQVPGLQDPEQLKELLGQTAKLEFKLVDTTALPSDIAQGIAPPGSEIVPYAEAQPGQPGFIAVKRLGGIKGDNLTNAQQGFSQQGNQPVVNITFNQQGGSRFAKLTTENVNRPFAIILDGKVLSAPNINEPILGGSAQISGNFTVESATQLAISLRSGALPVDLKVIEERTVGPDLGADSIVKGAIAMLVGTVALMTFIVLSYGRFGVYACWALFLNILMIIGVMGIAGTTLTLPGIAGFVLTIGAAVDANVLINERIREERRRGRRVVQSVELGYKEASRAIFDANITNVIAAVLMFLFGSGPVRGFAVVLMIGIVTSVFTAVTMTRMWVANWLRKARPTDLNL
>CP034179.1|AZI37139.1|3223683_3224049_+|preprotein-translocase-subunit-YajC
MTGIAPLLKGVSMLDILSAAASAGGDAPPVWISWLPILGMIVIFWFLIIRPQMRQQKEHKAKVAGMKKGDMVVTAGGLVGKVIKVDDHYAELELGQNVRVKAVKSTIGDIIPPGGSSPAND
>CP034179.1|AZI37138.1|3222814_3223228_-|hypothetical-protein
MGILEAIIGPLSSIIDKIIPDKEARDKAKLELIRLQGSQELETIQARLSAIVAEAHSPDPWTSRARPSFLYVMYVMILWAIPMGLLAAADLHTAQAVANGINAYLNGLPEPLYALFGTGYLGYTAARQWGKAKGIDK
>CP034179.1|AZI37137.1|3222294_3222732_-|type-II-3-dehydroquinate-dehydratase
MANPVVYVLNGPNLNLLGTREPEIYGSTTLDDIAGMLEDRAMELGLEVDVRQSNHEGHLIDWLHEAQAEGARAVLLNAGAYTHTSIALHDAIKAIRTPVIEVHISEPKEREPFRHISYVGMVAVDCVSGHGAKSYILALEKVPNL
>CP034179.1|AZI37147.1|3231682_3232396_+|DUF541-domain-containing-protein
MIRFALPLLAVAAMASPAMAADVQIQAQGPVVELSVSEVVKARPDIANVGSGVSTLAPTAVAAMQQNAKAMDAVIARIKALGIAKDDIQTAGINLSAQYDYDQAARKQVFRGYQASNTVNVTLRDVAKVGQVLDALVAAGATDINGPVLAIDDETTAKAQARKAAMERARTQALEYAKLAGYADIRLLDISESINIGRPMMLEKAVAADAIMNTSTPVEPGLVGTGVNVTVTYEMVR
>CP034179.1|AZI37148.1|3232465_3232783_+|hypothetical-protein
MRKALVLVLSGAFGCTLSLSPVSALTAHAQDHDDQGQVRKEMRAGNVRSLREIEGAVLPQMRGMQYLGPEYDAGAMAYRLKFIRDGRVVFVDIDARSGRVIKRSN
>CP034179.1|AZI37149.1|3232906_3233584_+|DNA-binding-response-regulator
MRILIVEDEPTLGQQLKSTLEQTGYAVDLSTDGEDGHFMGSTEDYDAVILDLGLPEIDGLSVLGMWRREGRHFPVLVLTARDSWSDKVAGLDAGADDYLAKPFQTEELIARLRALIRRASGNTSSELIAGDVRLDTRSGRVTLAGEPVKLTAQEYKLLSYLMHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGADVITTIRGLGYSLDDPAEHPRG
>CP034179.1|AZI37150.1|3233516_3234995_+|histidine-kinase
MSSQRSVALDTVSTIPPNIRAADAARAGAPAEQQTADGKAPGREPTPHTGSLFRRMMFIAAGWISILLLVGGVALDRTLAGLIEKNFDDQLEYMLTAMIGTAEIGPDGEVFFNRPLGDQRFLEPNSGLYWQITGDGHEDFPSRSLWDRSLKVDRDQGHKAHFYNSNQFAGEPLRVIERSIVLPGSTTRWWFTVAAARDGLDEQIAQIRSILLWSFVVLGLGLFVLATLQTWYGLVPLRRVRRAIQHMRTTGTNCVTDPLPAEVQPMVEELNALLAHNEKQAEEARTHAGNLAHALKTPLTVVTNAANAHAPDLAETVLREAKVMRRQVDHHLARARAVGRRAAGQARANVWDSANAVERAVSRLYEESRFDVAGNRAAIVAIERQDLDEILGNLLENAAKYGGGSVFLTVDTEPTAPLCTITVEDDGPGIPLAERTRMFDRGARLDTGKPGTGLGLAIVRDVVEIYGGAVSLDDSEDLGGMMVSLRLPRAAV
>CP034179.1|AZI37151.1|3235021_3235321_-|chorismate-mutase
MTQTPAEDPVLASFRKSIDNIDAALIHMLAERFRITKAVGEHKARTQLPPADPGREQRQVERLRRLAEEADLDPEFSEKFLRFIIDEVIRHHEQAKAAK
>CP034179.1|AZI37152.1|3235386_3236397_+|polyprenyl-synthetase-family-protein
MSAEVVPLPRKEPSLAPILSLTATAMNAVNTVILDRMQSEIPLIPALAGHLISGGGKRMRPMLTLAGADLVGYQGTRHHKLAAAVEFIHTATLLHDDVVDGSETRRGKEAANLVFGNPATVLVGDFLFSRAFELMVEDGSLKVLKILAGASSIIAQGEVDQLVSQRVIETSEDRYLHIIGAKTAVLFAAASRIAAVVAERDEAEERALDDYGRNLGIAFQLVDDAIDYDSDAAEMGKDRGDDFREGKMTLPVILAYARGNDEERRFWQEAIAGFRNEDEDLAHAIELIRKHDSVNATRERARHFAERAVDALSIFPDGKARAAMTEAARFAVSRGY
>CP034179.1|AZI37153.1|3236506_3238936_+|ATP-dependent-helicase-HrpB
MSDLPIHAVLPDLLTALRDQTSAVLIAPPGAGKTTAVAPALLGEAWCSGTVILLSPRRVAARAAAERMAELLGEKPGETVGYLTRLDSKRSAKTRILVVTEAIFVAQICDDPELRGVSAVLFDEAHERHLDSDLGLALALESQAVLRDDLRICVMSATIDGARFARLLGEGASVIESAGKAYPLAIRWLGASPDKRTEEAMASAILAAWRDEEGDILAFLPGVREIERTKERLVERLPDVPILPLHGQVEPAGQRAAIRRDPQGRRRLVLATAIAETSLTLDGVSVVVDAGLSRRAEFDLAAGVSHLVTVRASRAAAAQRAGRAARQGPGVAYRLWEEAAHAGRAEFDPPEITTVDLAPLTLSLAQWGAGDPQAMPWLDCPPDAALAAARRRLQALDALDRDGRITERGRQIASLPMDPAQAAMVLFGAEHRAAQDAAGLALLMQERGLGGRGEDLAQRLARWQGDRSPRAQASRKLAEGWARRAQKMIGAGVGEAPPLGVLLAMALPDNVARRRDPSGENWLSAGGRGYILDPVSPLASAEWLVIGDAQGQAKGARIMAGIALSDDDVDQWLGERMERRSLLRWNEGEGRVEARLERRLGAITLASGPDGKPDAAAVTALLVGKAKERLSLLLPPVLMARAQYAGLDALSPERLADDADEWLAPLLQGRRDLNLSKAALTDALLARLDWNDRQRLDKLAPREFTSPAGTNHPIDYAHEGGPAVEVRVQALFGLDRHPIIGGTPLLLLLTSPAGRPIQATRDLAGFWRGSWRDVVKDMKGRYPKHRWPDEPWNEAPSLKTRNAFDNSRR
>CP034179.1|AZI37154.1|3238992_3239271_+|ETC-complex-I-subunit
MSARIYQRPKNAMQSGKALCDQWILEFVPAEARKPDPLMGWAGSGDTQVQVQLSFPNKDDAQAYAAKYGITARVYASPAKRLKIQAYADNFK
>CP034179.1|AZI38338.1|3239617_3241531_+|DNA-polymerase-III-subunit-gamma/tau
MGDSLDMFGDEPEREGEDALETKPTAAELEEAGQGSMFDASPPAASPSDEPEAAPEIAPETVAAPVAAPEPAQPIPPQPASLAAPSASPVQSSAQAGQPYRVLARKYRPQTFAELIGQEAMVRTLANAIERDRLAHAFLMTGVRGVGKTSTARLIAKALNCIGPDGQGGPTIDPCGQCEPCLAIAEGRHIDVIEMDAASHTGVDDVREIIEAVRYAAVSARYKIYIIDEVHMLSRNAFNALLKTLEEPPAHVKFLFATTEVDKLPVTVLSRCQRFDLRRIPTGMLQEHFAGICAKEGVEAEAEALHLIAGAAEGSVRDGLSILDQAIAHADLDSGGHVVAERVRDMLGLADKSVQRDLFAAILGGDAATLLDGMDRQYALGVEPLALMRSLMDLVHRITVAQIGRSGADAPTAEERAALEDWAEKLGAAQLHRLWQLLLKGHDEVRGAPDPQVAAQMALLRMLHAADLPDPGSLVKKLEELAAQGVAVQASSTPSGGEGDAPSAPPAAKLDWDALVHQVDIGGHLRIAQLMRDWVRVIDLAPGKLIFSLVPGLAVDPVSEMRDALYKSTGVKWTVEQGVGEGAPSLRELSDARKAEDEAALMRDPLVEAAMAAFPDAEIVKEDGDRQGETRQWTKRA
>CP034179.1|AZI37155.1|3241541_3241883_+|YbaB/EbfC-family-nucleoid-associated-protein
MKSMEEMLQAAQQAAETIQKQMNDAQAKLDSLEVEGVSGGGLVKIRCSAKGRILGIAIDDSLIVREDKHILEDLVTAAFNDARAKADQVANDEMGKMQQGLGLPPGFNFPGFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP034179_1	1.1\|869552\|46\|CP034179\|CRISPRCasFinder	869552-869597	46	CP034179.1	821996-822041	0	1.0
CP034179_1	1.1\|869552\|46\|CP034179\|CRISPRCasFinder	869552-869597	46	CP034179.1	2254062-2254107	0	1.0

1. spacer 1.1|869552|46|CP034179|CRISPRCasFinder matches to position: 821996-822041, mismatch: 0, identity: 1.0

tgaccggcccccaccgagtggtccgtgttatttgttagtgtaaaac	CRISPR spacer
tgaccggcccccaccgagtggtccgtgttatttgttagtgtaaaac	Protospacer
**********************************************

2. spacer 1.1|869552|46|CP034179|CRISPRCasFinder matches to position: 2254062-2254107, mismatch: 0, identity: 1.0

tgaccggcccccaccgagtggtccgtgttatttgttagtgtaaaac	CRISPR spacer
tgaccggcccccaccgagtggtccgtgttatttgttagtgtaaaac	Protospacer
**********************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

813101 : 923830

Streptococcus_phage(36.84%)

transposase,integrase

attL 815293:815329|attR 840198:840234

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZI35198.1\|813101_814262_+\|transposase	IS110 family transposase	NA	NA	NA	NA
815293:815329	attL	NA	NA	NA	NA
AZI35199.1\|815336_817775_-	TonB-dependent receptor	NA	NA	NA	NA
AZI35200.1\|817814_819188_-	alkaline phosphatase family protein	NA	NA	NA	NA
AZI35201.1\|819263_819953_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZI35202.1\|820838_822006_+\|transposase	IS3 family transposase	NA	NA	NA	NA
AZI35203.1\|822298_823189_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZI35204.1\|823347_824175_+	sterol desaturase family protein	NA	NA	NA	NA
AZI35205.1\|824455_825088_-\|integrase	integrase	A0A0A8WE94	Clostridium_phage	2.4e-10	30.9
AZI35206.1\|825297_826110_+	arylamine N-acetyltransferase	NA	NA	NA	NA
AZI38117.1\|826966_828496_-	hypothetical protein	NA	NA	NA	NA
AZI35207.1\|828552_829836_-	ATP-binding protein	NA	NA	NA	NA
AZI35208.1\|829832_833897_-	hypothetical protein	NA	NA	NA	NA
AZI35209.1\|833893_835081_-	ATP-binding protein	NA	NA	NA	NA
AZI35210.1\|835325_835877_-	transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	8.6e-20	47.3
AZI35211.1\|836134_837796_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	1.0e-87	48.9
AZI35212.1\|837792_838221_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	6.5e-15	34.7
AZI35213.1\|838217_838649_-	DUF3489 domain-containing protein	NA	NA	NA	NA
AZI35214.1\|839028_840153_+	Fic family protein	NA	NA	NA	NA
AZI35215.1\|840320_841028_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	5.5e-19	31.6
840198:840234	attR	NA	NA	NA	NA
AZI35216.1\|841158_842247_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AZI35217.1\|842668_843400_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZI35218.1\|846455_848744_+	arylsulfatase	NA	NA	NA	NA
AZI35219.1\|848791_851146_+	arylsulfatase	NA	NA	NA	NA
AZI38118.1\|851197_852288_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.9e-53	39.6
AZI35220.1\|852833_853541_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	3.8e-20	30.7
AZI35221.1\|853636_854158_+	hypothetical protein	NA	NA	NA	NA
AZI35222.1\|854808_855516_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	5.5e-19	31.6
AZI35223.1\|855658_856681_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZI35224.1\|856982_857516_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZI35225.1\|857803_858541_+	flavodoxin family protein	NA	NA	NA	NA
AZI35226.1\|858614_859409_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	3.7e-16	32.7
AZI35227.1\|859405_860485_+	nitronate monooxygenase	NA	NA	NA	NA
AZI35228.1\|860481_861267_+	SDR family oxidoreductase	NA	NA	NA	NA
AZI35229.1\|861283_862054_+	enoyl-CoA hydratase family protein	NA	NA	NA	NA
AZI35230.1\|862050_862836_+	SDR family oxidoreductase	NA	NA	NA	NA
AZI35231.1\|862845_863694_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZI35232.1\|864253_864457_-	hypothetical protein	NA	NA	NA	NA
AZI35233.1\|864536_866690_-	TonB-dependent receptor	NA	NA	NA	NA
AZI35234.1\|866831_869153_-	arylsulfatase	NA	NA	NA	NA
AZI35235.1\|869648_870371_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	1.1e-19	32.1
AZI35236.1\|870375_871083_+\|transposase	IS6 family transposase	NA	NA	NA	NA
AZI35237.1\|871007_871895_-	hypothetical protein	NA	NA	NA	NA
AZI35238.1\|872311_872875_-	transcriptional regulator	A0A1P8VVG0	Erythrobacter_phage	1.5e-19	46.5
AZI35239.1\|873132_874794_-	recombinase family protein	K4ICM1	Acidithiobacillus_phage	5.9e-88	48.7
AZI35240.1\|874790_875219_-	DUF2924 domain-containing protein	K4I3X1	Acidithiobacillus_phage	5.0e-15	34.7
AZI35241.1\|875215_875647_-	DUF3489 domain-containing protein	NA	NA	NA	NA
AZI35242.1\|876016_877399_-	DUF1254 domain-containing protein	NA	NA	NA	NA
AZI35243.1\|877607_878129_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.3e-29	58.1
AZI35244.1\|878629_884236_-	autotransporter domain-containing protein	NA	NA	NA	NA
AZI35245.1\|884502_884922_-\|transposase	IS5 family transposase	NA	NA	NA	NA
AZI35246.1\|884928_885297_-\|transposase	transposase	NA	NA	NA	NA
AZI35247.1\|886181_886889_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	5.5e-19	31.6
AZI38119.1\|887622_888723_-	(2Fe-2S)-binding protein	NA	NA	NA	NA
AZI35248.1\|888966_889485_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
AZI35249.1\|889521_890076_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
AZI35250.1\|890119_891475_-	phosphotransferase family protein	NA	NA	NA	NA
AZI38120.1\|891471_892398_-	hypothetical protein	NA	NA	NA	NA
AZI35251.1\|892637_893375_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZI35252.1\|893458_894511_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZI35253.1\|894507_895416_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
AZI35254.1\|895447_897811_-	TonB-dependent receptor	NA	NA	NA	NA
AZI35255.1\|898085_898793_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	1.4e-19	31.2
AZI35256.1\|899018_900041_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZI35257.1\|900570_901338_-	SDR family oxidoreductase	NA	NA	NA	NA
AZI35258.1\|901582_902665_-	alpha/beta hydrolase	NA	NA	NA	NA
AZI35259.1\|903111_905622_-	TonB-dependent receptor	NA	NA	NA	NA
AZI35260.1\|906518_907244_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZI35261.1\|907300_908326_+\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	6.3e-16	29.3
AZI35262.1\|908780_909740_+	alpha/beta hydrolase	NA	NA	NA	NA
AZI35263.1\|910690_911719_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZI35264.1\|911852_912191_+	hypothetical protein	NA	NA	NA	NA
AZI35265.1\|912183_912837_+	Dabb family protein	NA	NA	NA	NA
AZI38121.1\|912934_913915_+	NADP-dependent oxidoreductase	NA	NA	NA	NA
AZI35266.1\|914601_915363_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZI35267.1\|915714_918225_-	TonB-dependent receptor	NA	NA	NA	NA
AZI35268.1\|918337_919648_-	class A beta-lactamase-related serine hydrolase	NA	NA	NA	NA
AZI35269.1\|919629_920589_-	alpha/beta hydrolase	NA	NA	NA	NA
AZI35270.1\|921051_921615_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZI35271.1\|921822_922740_+	SGNH/GDSL hydrolase family protein	A0A160DD06	Gordonia_phage	3.9e-09	26.9
AZI35272.1\|923122_923830_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.1e-18	31.1

DBSCAN-SWA_2

3638890 : 3668122

Hokovirus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZI37484.1\|3638890_3640147_-\|transposase	IS701 family transposase	NA	NA	NA	NA
AZI37485.1\|3641132_3641360_+	hypothetical protein	NA	NA	NA	NA
AZI37486.1\|3641484_3642741_-\|transposase	IS701 family transposase	NA	NA	NA	NA
AZI37487.1\|3642919_3644176_-\|transposase	IS701 family transposase	NA	NA	NA	NA
AZI37488.1\|3644354_3645611_-\|transposase	IS701 family transposase	NA	NA	NA	NA
AZI37489.1\|3645789_3647046_-\|transposase	IS701 family transposase	NA	NA	NA	NA
AZI37490.1\|3647594_3649976_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.3e-169	36.4
AZI37491.1\|3650272_3651286_+	universal stress protein	NA	NA	NA	NA
AZI37492.1\|3651289_3659701_+	cellobiose phosphorylase	NA	NA	NA	NA
AZI37493.1\|3659812_3660049_+	hypothetical protein	NA	NA	NA	NA
AZI37494.1\|3660103_3660430_+	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
AZI37495.1\|3660502_3662059_-	aminoglycoside phosphotransferase	NA	NA	NA	NA
AZI37496.1\|3662063_3662558_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AZI37497.1\|3663101_3664925_+	PAS domain-containing sensor histidine kinase	A0A1V0SL97	Klosneuvirus	1.8e-18	36.1
AZI37498.1\|3664914_3665529_+	DNA-binding response regulator	NA	NA	NA	NA
AZI37499.1\|3665591_3666023_+	response regulator	NA	NA	NA	NA
AZI37500.1\|3666070_3666481_+	globin	NA	NA	NA	NA
AZI37501.1\|3667364_3668122_-\|transposase	IS5 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP034179

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection