CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP024690	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-6-12K, complete sequence	0 crisprs	NA	0	0
CP024691	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-7-9K, complete sequence	0 crisprs	NA	0	0
CP024692	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-8-8K, complete sequence	0 crisprs	NA	0	0
CP024685	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-1-490K, complete sequence	0 crisprs	cas14j,csa3	0	32
CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	0 crisprs	csa3	0	0
CP024686	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-2-313K, complete sequence	0 crisprs	csa3	0	1
CP024684	Bacillus wiedmannii bv. thuringiensis strain FCC41 chromosome, complete genome	1 crisprs	cas3,csa3,cas14k,WYL,DinG,c2c9_V-U4,cas14j,DEDDh	3	11
CP024689	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-5-125K, complete sequence	0 crisprs	RT,csa3	0	1
CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	0 crisprs	csa3,RT	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

194692 : 200453

Streptococcus_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24263.1\|194692_195280_-	GTP cyclohydrolase I FolE	A0A1W7AF02	Streptococcus_virus	6.3e-45	47.4
AZJ24264.1\|195323_196040_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	7.7e-53	43.7
AZJ24265.1\|196032_196524_-	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	3.1e-61	71.1
AZJ24266.1\|196523_197189_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	4.8e-65	56.3
AZJ24267.1\|197201_197990_-	multidrug transporter permease	NA	NA	NA	NA
AZJ24268.1\|197992_198784_-	ABC transporter permease	NA	NA	NA	NA
AZJ24269.1\|198780_199779_-	ATPase	A0A2R8FG22	Brazilian_cedratvirus	6.1e-16	27.8
AZJ24270.1\|199796_200453_-	hypothetical protein	D5GVF5	Campylobacter_virus	4.9e-06	24.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP024684

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP024684_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP024684_2

1798768-1798894

Orphan

Consensus_repeat	Method
CGTAGGGACGTTTTTTATTTAGGTCCTAACTTTGTTGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP024684_2

>merge|CP024684|2|1798768-1798894|CRISPRCasFinder
CGTAGGGACGTTTTTTATTTAGGTCCTAACTTTGTTGTGGCTTCATAACTAGGGTGGTACCGCGATAATTTATCGTCCCTACGTATTTGCGTAGGGACGTTTTTTATTTAGGTCCTAACTTTGTTGT

>CP024684|2|2|1798768-1798894|CRISPRCasFinder
CGTAGGGACGTTTTTTATTTAGGTCCTAACTTTGTTGT	GGCTTCATAACTAGGGTGGTACCGCGATAATTTATCGTCCCTACGTATTTG
CGTAGGGACGTTTTTTATTTAGGTCCTAACTTTGTTGT

Protein	Signature genes	Signature genes Name	Protein_function
CP024684.1\|AZJ19972.1\|1789807_1791067_+\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
CP024684.1\|AZJ19970.1\|1787609_1788593_-\|ketoacyl-ACP-synthase-III	unknown	unknown	gnl\|CDD\|237245
CP024684.1\|AZJ19984.1\|1803504_1804401_+\|chromosome-condensation-regulator	unknown	unknown	gnl\|CDD\|227511
CP024684.1\|AZJ19986.1\|1804837_1804933_+\|hypothetical-protein	unknown	unknown	unknown
CP024684.1\|AZJ19983.1\|1802698_1803340_+\|elongation-factor-G-binding-protein	unknown	unknown	gnl\|CDD\|319974
CP024684.1\|AZJ19971.1\|1788766_1789324_+\|cobalamin-biosynthesis-protein-CbiN	unknown	unknown	gnl\|CDD\|239632
CP024684.1\|AZJ19969.1\|1786256_1787525_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341042
CP024684.1\|AZJ19977.1\|1796682_1798317_-\|polysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|240529
CP024684.1\|AZJ19975.1\|1794215_1795133_+\|cysteine-synthase-A	unknown	unknown	gnl\|CDD\|273465
CP024684.1\|AZJ19980.1\|1801472_1801736_+\|hypothetical-protein	unknown	unknown	unknown
CP024684.1\|AZJ19981.1\|1801901_1802588_+\|DUF421-domain-containing-protein	unknown	unknown	gnl\|CDD\|225205
CP024684.1\|AZJ19987.1\|1804969_1805506_-\|peptide-methionine-(S)-S-oxide-reductase	unknown	unknown	gnl\|CDD\|376578
CP024684.1\|AZJ23603.1\|1795213_1795726_+\|GNAT-family-acetyltransferase	unknown	unknown	gnl\|CDD\|226489
CP024684.1\|AZJ19976.1\|1795819_1796644_+\|cytoplasmic-protein	unknown	unknown	gnl\|CDD\|379078
CP024684.1\|AZJ19985.1\|1804605_1804806_+\|hypothetical-protein	unknown	unknown	unknown
CP024684.1\|AZJ19974.1\|1792993_1794205_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|341031
CP024684.1\|AZJ19973.1\|1791108_1792749_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
CP024684.1\|AZJ19982.1\|1802598_1802715_+\|hypothetical-protein	unknown	unknown	unknown
CP024684.1\|AZJ19978.1\|1799064_1800402_+\|sodium-dependent-transporter	unknown	unknown	gnl\|CDD\|271367
CP024684.1\|AZJ19979.1\|1800441_1801146_-\|polysaccharide-deacetylase	unknown	unknown	gnl\|CDD\|200580

Protein	Function_ID	Function_description	E-value
CP024684.1\|AZJ19972.1\|1789807_1791067_+\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
CP024684.1\|AZJ19970.1\|1787609_1788593_-\|ketoacyl-ACP-synthase-III	gnl\|CDD\|237245	PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.	0
CP024684.1\|AZJ19984.1\|1803504_1804401_+\|chromosome-condensation-regulator	gnl\|CDD\|227511	COG5184, ATS1, Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell division and chromosome partitioning / Cytoskeleton].	5.22111e-21
CP024684.1\|AZJ19983.1\|1802698_1803340_+\|elongation-factor-G-binding-protein	gnl\|CDD\|319974	cd16342, FusC_FusB, Fusidic acid resistance protein (FusC/FusB). The fusidic acid resistance protein FusC (FusB) mediates resistance to the antibiotic fusidic acid. Its C-terminal domain, which contains a zinc-binding site, interacts with EF-G with high affinity, promoting the dissociation of stalled ribosome#EF-G#GDP complexes that form in the presence of fusidic acid, thus allowing the ribosomes to resume translation.	1.67631e-109
CP024684.1\|AZJ19971.1\|1788766_1789324_+\|cobalamin-biosynthesis-protein-CbiN	gnl\|CDD\|239632	cd03577, NTR_TIMP_like, NTR domain, TIMP-like subfamily; TIMPs, or tissue inibitors of metalloproteases, are essential regulators of extracellular matrix turnover and remodeling. They form complexes with matrix metalloproteases (MMPs) and inactivate them irreversibly by non-covalently binding their active zinc-binding sites. This group contains domains similar to the TIMP NTR domain, which binds MMPs. Members of this group may or may not function as MMP inhibitors.	5.65203e-25
CP024684.1\|AZJ19969.1\|1786256_1787525_+\|MFS-transporter	gnl\|CDD\|341042	cd17489, MFS_YfcJ_like, Escherichia coli YfcJ, YhhS, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli membrane proteins, YfcJ and YhhS, Bacillus subtilis uncharacterized MFS-type transporter YwoG, and similar proteins. YfcJ and YhhS are putative arabinose efflux transporters. YhhS has been implicated glyphosate resistance. YfcJ-like arabinose efflux transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.77044e-35
CP024684.1\|AZJ19977.1\|1796682_1798317_-\|polysaccharide-biosynthesis-protein	gnl\|CDD\|240529	cd13124, MATE_SpoVB_like, Stage V sporulation protein B, also known as Stage III sporulation protein F, and related proteins. The integral membrane protein SpoVB has been implicated in the biosynthesis of the peptidoglycan component of the spore cortex in Bacillus subtilis. This model represents a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.11615e-132
CP024684.1\|AZJ19975.1\|1794215_1795133_+\|cysteine-synthase-A	gnl\|CDD\|273465	TIGR01139, Cysteine_synthase, cysteine synthase A. This model distinguishes cysteine synthase A (CysK) from cysteine synthase B (CysM). CysM differs in having a broader specificity that also allows the use of thiosulfate to produce cysteine thiosulfonate. [Amino acid biosynthesis, Serine family].	6.68446e-163
CP024684.1\|AZJ19981.1\|1801901_1802588_+\|DUF421-domain-containing-protein	gnl\|CDD\|225205	COG2323, COG2323, Predicted membrane protein [Function unknown].	1.86427e-63
CP024684.1\|AZJ19987.1\|1804969_1805506_-\|peptide-methionine-(S)-S-oxide-reductase	gnl\|CDD\|376578	pfam01625, PMSR, Peptide methionine sulfoxide reductase. This enzyme repairs damaged proteins. Methionine sulfoxide in proteins is reduced to methionine.	3.85366e-94
CP024684.1\|AZJ23603.1\|1795213_1795726_+\|GNAT-family-acetyltransferase	gnl\|CDD\|226489	COG3981, COG3981, Predicted acetyltransferase [General function prediction only].	1.77624e-57
CP024684.1\|AZJ19976.1\|1795819_1796644_+\|cytoplasmic-protein	gnl\|CDD\|379078	pfam13228, DUF4037, Domain of unknown function (DUF4037). This presumed domain is functionally uncharacterized. This domain family is found in bacteria and eukaryotes, and is approximately 100 amino acids in length. There is a single completely conserved residue P that may be functionally important.	1.81242e-12
CP024684.1\|AZJ19974.1\|1792993_1794205_+\|MFS-transporter	gnl\|CDD\|341031	cd17478, MFS_FsR, Fosmidomycin resistance protein of the Major Facilitator Superfamily of transporters. Fosmidomycin resistance protein (FsR) confers resistance against fosmidomycin. It shows sequence similarity with the bacterial drug-export proteins that mediate resistance to tetracycline and chloramphenicol. This FsR family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.72832e-103
CP024684.1\|AZJ19973.1\|1791108_1792749_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
CP024684.1\|AZJ19978.1\|1799064_1800402_+\|sodium-dependent-transporter	gnl\|CDD\|271367	cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain. SLC6 proteins (also called the sodium- and chloride-dependent neurotransmitter transporter family or Na+/Cl--dependent transporter family) include neurotransmitter transporters (NTTs): these are sodium- and chloride-dependent plasma membrane transporters for the monoamine neurotransmitters serotonin (5-hydroxytryptamine), dopamine, and norepinephrine, and the amino acid neurotransmitters GABA and glycine. These NTTs are widely expressed in the mammalian brain, involved in regulating neurotransmitter signaling and homeostasis, and the target of a range of therapeutic drugs for the treatment of psychiatric diseases. Bacterial members of the SLC6 family include the LeuT amino acid transporter. An arrangement of 12 transmembrane (TM) helices appears to be as a common topological motif for eukaryotic and some prokaryotic and archaeal NTTs. However, this subfamily which contains the majority of bacterial members and some archaeal members, appears to contain only 11 TMs; for example the functional Fusobacterium nucleatum tyrosine transporter Tyt1.	0
CP024684.1\|AZJ19979.1\|1800441_1801146_-\|polysaccharide-deacetylase	gnl\|CDD\|200580	cd10956, CE4_BH1302_like, Putative catalytic NodB homology domain of uncharacterized BH1302 protein from Bacillus halodurans and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase BH1302 from Bacillus halodurans. Although its biological function is unknown, BH1302 shows high sequence homology to the catalytic NodB homology domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both BH1302 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	3.70269e-113

>CP024684.1|AZJ19977.1|1796682_1798317_-|polysaccharide-biosynthesis-protein
MSTSKVLKGTALLSGATMISRILGFIYFFPFQLLVGTQGVALYGYAYSWYGILLSFSTAGIPIAVSKFVAKHNALGDYSTSKKLYNSSVKLMLFMGFLGFLTLFIGAPYISQFIIRSKTPDPQFIADVTLTMRALSFALIIVPAMSVTRGYFQGFQHMKPSAVSQVVEQIARVVFILVGSFIVSKLLGGSVASSVAVATFGAVIGALASVSILMLYWKKYNRLKPPEGELKSRASNIPLKNIYMELLRYAIPIVFVGIAIPLYTLVDQYTVADVLRAMGEPLETANAVFAYITNYAQKLIMIPASLATGFSLTIIPAITKSYTSGKLEELQEQIAKIFQVLLFFTIPAAFGLASIAYDAFRMVYVNPEIALGGSQYLISFAPSAILSAIFTVSAAILQGIDYQRKTMIAFSVGILVKVLVNTPLLHLFGGHGAVLGTILGYLVSNVIMLYCIIKFAKFKIGETAKTVLLITIYSAAMSAVVIALKAILKWMIPGQSYMESLLIVFICGAVGGIVYLLFVLTSGLASHILGDRLQRLPILGKLVK
>CP024684.1|AZJ19976.1|1795819_1796644_+|cytoplasmic-protein
MGLKEKAIEMSEIYRRNPKVETIILAGSVARKLEDEHSDIELHILWSMPPEDEDRKGPINNIGGTILSYHPYEEEEWSETYLTKEGIKLEISNFLTETVEKVISDVVDQYDISYEKQCIVSSVHDGVSLYGEEKVHELKDRVVAYPEDLAKRMISENLWLSNRWHNREALLKRKDWLMLYDVICEVQRNIFGVLFGLNKMYVHHPAFKWMPHNVERMIIKPENLYERMANTLIGKPEYSAQELEVLIEELLHLVQQYAPELHITEQQKRIQYAK
>CP024684.1|AZJ23603.1|1795213_1795726_+|GNAT-family-acetyltransferase
MKLLKPTNEYSEQIIEYREAFLHTDEKPHGSSSLQNFDSLDKWFEKVSIQEVEENLQGNRVPSSQFLSFEKGELIGFVNIRHRLNQELLLESGHIGYSVHPNKRRQGYATKQLQLALDEAQKLGLQKVLITCDKVNIASAKTIQKVGGMLEDEVVSVHTGEIVQRYWIEI
>CP024684.1|AZJ19975.1|1794215_1795133_+|cysteine-synthase-A
MKLCENVTELIGDTPVVRLSKFIPEDAADVYVKLEMFNPSRSVKDRAAYNLLHVAEENGLIKPGDTIIEPTSGNTGIGLAMNAAAKGYKAILIMPDNMSKERINLLKAYGAEVVLTPAEQRMPGAIAKALELQKQIPNSFIPQQFENPANPNIHRYTTALEIYEQMDGELDAFVATAGTGGTITGTGETLKEKLPNLYIAVVEPKGSPVLSGGVPGPHKLVGTSPGFIPKNLNTELYNEIIQIADEEALTTMRNLARQEGLLVGPSSGASVYAAIMIAKRLGAGKKVLCIAPDTGERYLSMGLFE
>CP024684.1|AZJ19974.1|1792993_1794205_+|MFS-transporter
MQAVSKKNTMETPTIYRILFAISFGHFLNDSMQAVVPALFPILEKTMNLSYMQVGWIAFALNMTSSIMQPVFGMYSDKKPSPFLLPLGMFSSMLGMIGLAFAPNFIIVIISVLFIGLGSAVFHPEGARVAYMAAGAKRGLAQAIYQVGGNTGNSLAPIFTALIFVPLGQIGSLGFTAFAAVGIVLLIFVSNWYRNELATGAVRRKKRAALEAENAIVSTHIKFVILLLVFLTFVRSWYGAGIGNFYQFYLIEHYGLSIKNAQYFVFAFMIAGVLGTFFGGPLADRFGKKTIIVFSMLGSAPLALLLPHVSLMWVVPLFLCIGFISSSSFSVIVVYAQELVPGKVGMVSGLIVGLAFGLGALGSVVLGKLADIYSLQFIMLLCSCLPLIGLTSWLLPSDKKTIE
>CP024684.1|AZJ19973.1|1791108_1792749_-|peptide-ABC-transporter-substrate-binding-protein
MKKKTKGIVALSITLSMFLTACGQKQEATTTGEKKKESSKQVLNIVEAGEISTLDSSIATDGFSYAALNNVMEGLYMPGPDNKPVPAAAESYKLSEDGKTYTFTLHDSKWSNGDPVTAHDFEYAWKRAVNPETASEYAHIMFDIKNAEKINKKELPIDSFGVKAIDDKTLEVQLEHPVPYFLGLMGFATFYPQNKKVVEAQGKNYGLEAANVVYNGPFQLSEWKHDTSYKMSKNPNYWDNKNVKLSEINVNIVKDTSTAVNLFESKQVDRITINSEFVDKYQKNPSLKKMERPSMTFFRFSQKNPLLANKNARKAISLAFDKQGIATTILNNGSIPANAFVPKGFVKGPDNKDFRSTSNVKVGTNVKEAKTLWETAKKETNLQNASLSIITTDESNDKKISEFLKGELEKNLPGLKITLQPLPVKAFLDREGNGDYEISLSTWGPDYPDPTTFLNMFVTDGPFNKMSYSNKQYDELIEKTSSTLATDLPARWKAFQDAEKVLLEDDAAIAPIFQSGLVYLERPTVKGVVIRPFAGIYSYKWASITE
>CP024684.1|AZJ19972.1|1789807_1791067_+|GTPase-HflX
MEELLQRAVLVGVNLGNEDDFAYSMEELTNLAEACDVEVIGQVTQNLQRVNPSHYIGKGKIEEVAAYVNEVDANMVIFNDELSPSQIRNLEADLDCKVIDRTILILDIFAQRAKTKEAQLQVEVAHLQYMMPRLIGLRESLGRQSGGVGTKNKGVGEKKLELDRRKIEEQISVLNKDLEALVAQRQTQRKQRKKNEVPVVALVGYTNAGKSTTMNAMLEIYNGTEEKQVFEKDMLFATLETSVRNIDLPDNKSFLLTDTVGFVSKLPHHLVKAFRSTLEEVAEADLLIHVVDYANPNYEQLIDITNETLKKIGVENIPTIYAYNKSDMVDVEIPKVQEDRVYLSAKKHVGIEELVEMIRSHIYKEYTKCEMLIPYDQGQVVSYFNNHAHVLSTSYENEGTKLEVECKTSDYEKYKRFAI
>CP024684.1|AZJ19971.1|1788766_1789324_+|cobalamin-biosynthesis-protein-CbiN
MRFLKRIVYVLSLVLICSFIYFILPEKSYACECMKASPEERLQKTDVVFEGKVLEVQEKDGKMEILFEVKKIWKGTSSSQIIIYTSFSSCTFPFGEGGEYLVFASNRGEGKLETSMCSGTKRLDEAGADKVVLSQIAKESVPTKKVDLKGGKLNGLSWWQVVTLSIGLLLIVAVVISIVRRTRKK
>CP024684.1|AZJ19970.1|1787609_1788593_-|ketoacyl-ACP-synthase-III
MHSKSRITAIGTYVPNQILSNNDLEKMIDTNDEWIVQRTGMKERRIASKDEYSSHLAIQAIENLCTTFKKNLEDIDCIIVATTTADYVFPSVACQIQQHFSIPHTIAFDLNATCAGFTYGLHVGNSLITSGSHEKVLVVATETLSKVTDYTDRTTCILFGDGAGAILLERDENKPSFIAAHMGTNGAGGIHLYRTNLSTTMNGTPLQTNEKIVQNGREVYKWATSTVPAGIKELLHTANMQMDDIDWFIPHSANLRMIESICEKSQIPTQKTLTSVEFMGNTSSVSIPLALDLARKEGKLNNGDTLLLYGFGGGLTHLGLIVEWDLN
>CP024684.1|AZJ19969.1|1786256_1787525_+|MFS-transporter
MIDTADASISNRMYTEEDQQKLYKRTLIIVSISQMFGGAGLAAGITVGALLAQQMLGTDAYAGLPAAMFTMGSAVAAFFVGKLSQKHGRRIGLSAGFIVGGLGAIGVVGAALTNSIILLLVSLLIYGAGTATNLQARYAGTDLANKKQRATAISITMVMTTFGAVAGPNLVGVMGRFAHSIGIPELAGPFILSAAAFILAGLVLFVMLRPDPLLIANMIETYKQEHTYKGQPVIEEATENKRGITVGAIVMILTQIVMVAIMTMTPVHMGHHGHGLSAVGLVIGFHVGAMYLPSLVTGMLIDKIGRTTMSIAGGVILLAAGVIAAIAPSDSLILLIVALSLLGLGWNLGLISGTAQIVDATIPSTRAKTQGKIDVFIALAGASGGAMSGMVVANSSYAALSLAGGVLAFMLIPVVIWARTGK
>CP024684.1|AZJ19978.1|1799064_1800402_+|sodium-dependent-transporter
MNSQQWTSKLGFVLAAAGSAIGLGAIWKFPYMAGIGGGGAFFLIFIGFTLLIGLPLLLAEFVIGRSTQKEAVDAYREIAPKTLWPWLGKLGIITCFILLSFYSVVGGWILLYLWNAITGRLWEGNGAYEATFGEIISNPYLAVGAQLLFILITIFIVSKGVQNGVEKVNKYFMPALFVLFFVLIVRALTLDGAGEGVRFFLQPDFSHVTSEVILYAMGQSFFSLSVGVAVMVTYSSYLPKEESLPRSAFSIVALTLVITLLAGLAIFPVVFAFGLEPSQGPGLLFIVLPAIFSKMAFGKVFFVIFLLLFFFATITSAISMLEISVASLTSKGKGKREKTALIVGLLIFVVGVPSALSFGILSDLKIFGKTIFDLADYAVSNVLMPLGVLLVSIFVPLKMKKDVLMKELGVSKNKGYKLFVLWLFLLRFIAPIAIIIVFLNVLGII
>CP024684.1|AZJ19979.1|1800441_1801146_-|polysaccharide-deacetylase
MKKKIIITIVTLFIITVALFETYKLMNARSFQLFGNLTNRVETNEKVIALTFDDGPTNNVKQILPLLDTYNAKATFFLIGNELEKNLSLGEAIVQSGHQLGNHTYSHNRMVFKTPSFIKEEIEKTNSLIRQTGFTDTIDFRPPNGKKLIGLPYYLNKNNIETITWDLEPDTFYKSAADKIEYVNKNVQPGSIILLHSMYDESNENLQTIEGILDSLSKKGYQFVTVNELQKRAK
>CP024684.1|AZJ19980.1|1801472_1801736_+|hypothetical-protein
MKYVKAATVLPESLITEIQKYIQGETIYIPKQETKHYKWGTRSGGRKQLDERNKAIKEAFKSGISIHQLAEEHFLSGETIKKIVYSK
>CP024684.1|AZJ19981.1|1801901_1802588_+|DUF421-domain-containing-protein
MNHIGQITIELLIGFFVLLIATKILGKTQISQLTPFDFISAIVLGELVGNSIYDPKIKVWSILYSVFVWVILIYSIEVITQKIRGTRRFFEGYPSIIIRNGKIDREQLSSNHLDINQLQQMLRQQKDIFSIREVEYMILEPNGNISVLKKSKYESPTINDLSLKHKPVYLPISLISDGKVVKDNLREAGFDEGWLYKQIKQRGITKFEDVLYAEWKTDDGFFCQEMER
>CP024684.1|AZJ19982.1|1802598_1802715_+|hypothetical-protein
MYVIFVSKLSFTYQKAESLYTIRLDQQFVWSDKDGSFY
>CP024684.1|AZJ19983.1|1802698_1803340_+|elongation-factor-G-binding-protein
MEAFIRSDQYNFIKSQAYILANGHATANDRGVIQALKSLAIEKIIHVFENLTDEQKELIDTVLTVQNREDAESFLLKINPYVIPFQEVTAQTLKKLFPKAKKLKLPDMEELNMKELSYLSWIDKGSSRKFIIAKNDKNKFVGLQGTFQSLNKKSICSLCHGHEEVGMFLVEIKGDVPGTFVKKGNYICKDGVACNQNMKSLDKLNDFIERLQK
>CP024684.1|AZJ19984.1|1803504_1804401_+|chromosome-condensation-regulator
MNYISPKEEMLKVKRWPKDTIAAGRGHTVALKSDGTVVAVGRNKEGECNVSGWCDIEAVAAGNVHMATNTGNAHTIALKSDNTVEAVGWNKHDQCDVNDWHNIVSVAAGWRCTIGLKPDGTVVAVGRNKEEECNISSWRDIVVVTAGDWHTVGLKMDGTVTTVGNNRYGQCNVSGWRGMVELAAGYLHTVGLKSDGKVMAVGNNKLGQCDVGSWKDIMAIAAGTNHTIGLKSDGTVVAVGWNEYGQCNVSDWRDIVAIAAGCAHTVGLKLDGTVVAVGDNTYGQCDVGSWRNIRLPGK
>CP024684.1|AZJ19985.1|1804605_1804806_+|hypothetical-protein
MLKKFLLSLPDVLLVCIVIYITYTTTFSFVQMLEISIAIGIVGGLVIKICKDVFTYIRWTIKQRKS
>CP024684.1|AZJ19986.1|1804837_1804933_+|hypothetical-protein
MNKKKSRVKNEIALWTLTAVVLIIAWYFFQR
>CP024684.1|AZJ19987.1|1804969_1805506_-|peptide-methionine-(S)-S-oxide-reductase
MSEKTYELATFAGGCFWCMVKPFDELPGIHKVLSGYAGGHVENPTYEQVKAGTSGHLEVVQITFDPSIFPYEKLLDLYWPQIDPTDDGGQFFDRGPSYRTAIFYHNETQKELAEKSKQALAESGMFKEPIVTEIRPAAPFYEAEEYHQHFYKKNPEKYATEQKESGREDFIKENWQKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP024684_4	4.1\|4754174\|28\|CP024684\|CRISPRCasFinder	4754174-4754201	28	NZ_CP049158	Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence	992786-992813	5	0.821
CP024684_4	4.1\|4754174\|28\|CP024684\|CRISPRCasFinder	4754174-4754201	28	NZ_CP049318	Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence	997466-997493	5	0.821
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	173507-173537	6	0.806
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	173453-173483	7	0.774
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253842-253872	7	0.774
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	10569-10599	7	0.774
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	828-858	7	0.774
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP048642	Streptomyces aureoverticillatus strain HN6 plasmid unnamed, complete sequence	58950-58980	7	0.774
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	882-912	8	0.742
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NC_014332	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence	65285-65335	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NC_012577	Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence	63230-63280	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP015778	Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence	64821-64871	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP018905	Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence	65139-65189	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP023003	Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence	95022-95072	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_AP019733	Bacillus anthracis strain PCr plasmid PCr-pXO2	6039-6089	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_AP018445	Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence	64794-64844	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP029325	Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence	53080-53130	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NC_012655	Bacillus anthracis str. A0248 plasmid pXO2, complete sequence	65864-65914	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NC_007323	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence	64821-64871	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP010854	Bacillus anthracis strain A1144 plasmid pXO2, complete sequence	64969-65019	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP007617	Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence	40377-40427	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP008848	Bacillus anthracis strain HYU01 plasmid pX02, complete sequence	64705-64755	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP006744	Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence	64737-64787	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_AP014835	Bacillus anthracis strain Shikan-NIID plasmid pXO2	64807-64857	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP029807	Bacillus anthracis strain London_499 plasmid pX02, complete sequence	64946-64996	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NC_017727	Bacillus anthracis str. H9401 plasmid BAP2, complete sequence	64800-64850	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009314	Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence	71642-71692	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP014178	Bacillus anthracis strain Stendal plasmid pXO2, complete sequence	64821-64871	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009475	Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence	87303-87353	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009900	Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence	49835-49885	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009339	Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence	84078-84128	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009695	Bacillus anthracis strain RA3 plasmid pXO2, complete sequence	38975-39025	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009462	Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence	92402-92452	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009698	Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence	61986-62036	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009542	Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence	64528-64578	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP010320	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence	35703-35753	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009329	Bacillus anthracis strain K3 plasmid 2, complete sequence	4264-4314	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009326	Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence	64484-64534	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP009979	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence	8637-8687	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP001972	Bacillus anthracis str. A16 plasmid pXO2, complete sequence	64815-64865	9	0.824
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NZ_CP047133	Bacillus anthracis str. BF1 plasmid pXO2, complete sequence	64724-64774	9	0.824
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	8681-8711	9	0.71
CP024684_5	5.1\|4754522\|31\|CP024684\|CRISPRCasFinder	4754522-4754552	31	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	275032-275062	10	0.677
CP024684_2	2.1\|1798806\|51\|CP024684\|CRISPRCasFinder	1798806-1798856	51	NC_002146	Bacillus anthracis plasmid pXO2, complete sequence	65292-65342	12	0.765

1. spacer 4.1|4754174|28|CP024684|CRISPRCasFinder matches to NZ_CP049158 (Caballeronia sp. SBC1 plasmid pSBC1_2, complete sequence) position: , mismatch: 5, identity: 0.821

accagttgctcctgttgtccccgcactt	CRISPR spacer
tcgagttgctcctgttgtccactcacat	Protospacer
 * ***************** * *** *

2. spacer 4.1|4754174|28|CP024684|CRISPRCasFinder matches to NZ_CP049318 (Caballeronia sp. SBC2 plasmid pSBC2-2, complete sequence) position: , mismatch: 5, identity: 0.821

accagttgctcctgttgtccccgcactt	CRISPR spacer
tcgagttgctcctgttgtccactcacat	Protospacer
 * ***************** * *** *

3. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.806

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
gacaccttgaggtcctgttgggccctcttct	Protospacer
 *****************.****** ..**.

4. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 7, identity: 0.774

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
gacaccttgaggtcctgttgggccttcttct	Protospacer
 *****************.*****. ..**.

5. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 7, identity: 0.774

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
tactccttgaggtcctgtcgggccttcttct	Protospacer
.** ********************. ..**.

6. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
gacaccttgaggtcctgttggtccctcttct	Protospacer
 *****************.** *** ..**.

7. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 7, identity: 0.774

cacaccttgaggtcctgtcgggcccatctcc-	CRISPR spacer
gacaccttgaggtcctgtt-ggtccatcaatt	Protospacer
 *****************. **.*****  .

8. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP048642 (Streptomyces aureoverticillatus strain HN6 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.774

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
ctgatcttgaggtcctgtcggagccatcccg	Protospacer
*  *.****************. *****.*

9. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 8, identity: 0.742

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
gacaccttgaggtcctgttggtccttcttct	Protospacer
 *****************.** **. ..**.

10. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NC_014332 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

11. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NC_012577 (Bacillus anthracis str. CDC 684 plasmid pX02, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

12. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP015778 (Bacillus anthracis strain Tangail-1 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

13. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP018905 (Bacillus anthracis strain Tyrol 4675 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

14. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP023003 (Bacillus anthracis strain 14RA5914 plasmid pX02, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

15. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_AP019733 (Bacillus anthracis strain PCr plasmid PCr-pXO2) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

16. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_AP018445 (Bacillus anthracis strain CZC5 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

17. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP029325 (Bacillus anthracis strain 17OD930 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

18. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NC_012655 (Bacillus anthracis str. A0248 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

19. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NC_007323 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

20. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP010854 (Bacillus anthracis strain A1144 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

21. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP007617 (Bacillus anthracis strain 2000031021 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

22. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP008848 (Bacillus anthracis strain HYU01 plasmid pX02, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

23. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP006744 (Bacillus anthracis str. SVA11 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

24. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_AP014835 (Bacillus anthracis strain Shikan-NIID plasmid pXO2) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

25. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP029807 (Bacillus anthracis strain London_499 plasmid pX02, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

26. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NC_017727 (Bacillus anthracis str. H9401 plasmid BAP2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

27. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009314 (Bacillus anthracis str. Turkey32 strain 35 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

28. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP014178 (Bacillus anthracis strain Stendal plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

29. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009475 (Bacillus anthracis strain Pasteur plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

30. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009900 (Bacillus anthracis strain 2002013094 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

31. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009339 (Bacillus anthracis strain Ohio ACB plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

32. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009695 (Bacillus anthracis strain RA3 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

33. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009462 (Bacillus anthracis strain SK-102 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

34. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009698 (Bacillus anthracis strain BA1035 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

35. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009542 (Bacillus anthracis strain BA1015 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

36. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP010320 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

37. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009329 (Bacillus anthracis strain K3 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

38. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009326 (Bacillus anthracis strain Vollum 1B plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

39. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP009979 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

40. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP001972 (Bacillus anthracis str. A16 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

41. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NZ_CP047133 (Bacillus anthracis str. BF1 plasmid pXO2, complete sequence) position: , mismatch: 9, identity: 0.824

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtccctacatgatgt	Protospacer
  *****.******************** ***************.*. *

42. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 9, identity: 0.71

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
tactccttgaggtcctgttgggccttctggc	Protospacer
.** **************.*****. ..  *

43. spacer 5.1|4754522|31|CP024684|CRISPRCasFinder matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 10, identity: 0.677

cacaccttgaggtcctgtcgggcccatctcc	CRISPR spacer
aactccttgaggtcctgtcggtccttctggg	Protospacer
 ** ***************** **. ..

44. spacer 2.1|1798806|51|CP024684|CRISPRCasFinder matches to NC_002146 (Bacillus anthracis plasmid pXO2, complete sequence) position: , mismatch: 12, identity: 0.765

ggcttcataactagggtggtaccgcgataatttatcgtccctacgtatttg	CRISPR spacer
ttcttcacaactagggtggtaccgcgatcatttatcgtcctacatgatgta	Protospacer
  *****.******************** ***********.     ** *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

469644 : 509010

Bacillus_phage(70.0%)

capsid,head,integrase,portal,tail,terminase

attL 469637:469653|attR 509070:509086

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
469637:469653	attL	NA	NA	NA	NA
AZJ18663.1\|469644_470769_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.9e-187	85.3
AZJ18664.1\|472229_472877_-	class D sortase	NA	NA	NA	NA
AZJ18665.1\|472936_473491_-	cell wall anchor protein	NA	NA	NA	NA
AZJ18666.1\|473965_474310_-	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	1.9e-33	63.1
AZJ18667.1\|474811_475975_+	hypothetical protein	NA	NA	NA	NA
AZJ18668.1\|478033_478384_-	transcriptional regulator	A0A142LP08	Marinitoga_camini_virus	3.8e-05	42.7
AZJ18669.1\|478651_478855_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZJ18670.1\|478936_479731_+	DNA-binding protein	R4IFK0	Staphylococcus_phage	1.2e-75	55.1
AZJ18671.1\|479797_480148_+	DNA-binding protein	A0A1B0T6C2	Bacillus_phage	6.2e-56	91.4
AZJ23562.1\|480147_480312_+	hypothetical protein	A0A0U3B230	Bacillus_phage	1.3e-16	75.9
AZJ18672.1\|480518_481268_+	replication protein	A0A1B0T6C0	Bacillus_phage	8.5e-71	77.5
AZJ18673.1\|481206_482082_+	hypothetical protein	Q2I8C8	Bacillus_phage	5.3e-64	46.2
AZJ18674.1\|482098_482401_+	hypothetical protein	NA	NA	NA	NA
AZJ18675.1\|482403_482607_+	hypothetical protein	NA	NA	NA	NA
AZJ18676.1\|482603_482828_-	hypothetical protein	Q9T1I9	Lactobacillus_phage	3.0e-16	62.9
AZJ18677.1\|482908_483103_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.4e-20	78.1
AZJ18678.1\|483127_483301_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	6.8e-24	93.0
AZJ18679.1\|483315_483570_+	hypothetical protein	A0A1B0T6B9	Bacillus_phage	6.7e-36	84.5
AZJ18680.1\|483932_484154_+	glyoxalase	A0A1B0T6B5	Bacillus_phage	7.1e-26	95.2
AZJ18681.1\|484195_484603_+	hypothetical protein	A0A0S2MVF6	Bacillus_phage	7.6e-74	98.5
AZJ18682.1\|484822_485257_+	hypothetical protein	A0A0K2CNV8	Brevibacillus_phage	5.4e-17	60.3
AZJ18683.1\|485485_485797_+	hypothetical protein	D2XR52	Bacillus_phage	9.1e-35	71.8
AZJ23563.1\|486948_487071_+	DUF3983 domain-containing protein	NA	NA	NA	NA
AZJ18684.1\|487186_487357_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	9.4e-10	76.8
AZJ18685.1\|487384_487867_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	6.5e-72	83.8
AZJ18686.1\|487866_488409_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	7.8e-90	92.2
AZJ18687.1\|488623_488869_+	hypothetical protein	H0USV5	Bacillus_phage	2.3e-33	95.9
AZJ18688.1\|489277_489565_+	hypothetical protein	H0USV6	Bacillus_phage	1.5e-44	93.7
AZJ18689.1\|489599_489827_+	hypothetical protein	NA	NA	NA	NA
AZJ18690.1\|489872_490187_+	hypothetical protein	A0A0A7AQ61	Bacillus_phage	1.5e-13	48.9
AZJ18691.1\|490187_490403_+	hypothetical protein	A0A1B1P862	Bacillus_phage	2.3e-21	72.9
AZJ18692.1\|490535_490793_+	hydrolase	NA	NA	NA	NA
AZJ18693.1\|490782_491034_+	hypothetical protein	A0A1B1P743	Bacillus_phage	4.8e-10	48.3
AZJ23564.1\|491253_491592_+	hypothetical protein	Q2I8B8	Bacillus_phage	7.9e-16	63.6
AZJ18694.1\|491596_491827_+	hypothetical protein	NA	NA	NA	NA
AZJ18695.1\|491819_492155_+	alpha/beta hydrolase	D2XR61	Bacillus_phage	4.2e-54	92.8
AZJ18696.1\|492278_492590_+\|terminase	terminase	D2XR14	Bacillus_phage	9.4e-40	86.3
AZJ18697.1\|492586_494254_+\|terminase	terminase	D2XR15	Bacillus_phage	8.9e-294	88.8
AZJ18698.1\|494262_495426_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	4.1e-181	81.8
AZJ18699.1\|495409_496198_+	peptidase	R9TLM7	Paenibacillus_phage	6.7e-58	52.8
AZJ18700.1\|496201_497353_+\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	2.8e-206	95.3
AZJ18701.1\|497358_497652_+	hypothetical protein	D2XR19	Bacillus_phage	5.9e-44	90.7
AZJ18702.1\|497653_498007_+\|head,tail	head-tail adaptor protein	A0A2H4JGG7	uncultured_Caudovirales_phage	5.1e-58	96.6
AZJ18703.1\|498033_498408_+	hypothetical protein	Q0H235	Geobacillus_phage	3.4e-36	55.6
AZJ18704.1\|498404_498734_+	hypothetical protein	D2XR22	Bacillus_phage	1.1e-49	89.9
AZJ18705.1\|498734_499331_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	4.8e-109	98.5
AZJ18706.1\|499335_499698_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	1.2e-51	84.2
AZJ18707.1\|499928_503549_+	DUF2207 domain-containing protein	A0A2H4JAI2	uncultured_Caudovirales_phage	1.6e-186	86.4
AZJ18708.1\|503590_505075_+\|tail	phage tail protein	A0A1B1P7W7	Bacillus_phage	3.0e-237	79.1
AZJ18709.1\|505071_509010_+	peptidase S74	A0A288WFP5	Bacillus_phage	0.0e+00	74.3
509070:509086	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1390659 : 1461673

Bacillus_phage(56.86%)

transposase,capsid,head,holin,integrase,portal,tail,protease,terminase

attL 1391406:1391422|attR 1467765:1467781

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ19564.1\|1390659_1391631_+	hydroxyacid dehydrogenase	A0A1M7XU89	Cedratvirus	2.1e-29	28.4
1391406:1391422	attL	NA	NA	NA	NA
AZJ19565.1\|1391660_1392362_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
AZJ19566.1\|1392544_1394431_-	LTA synthase family protein	W6LM83	Streptococcus_phage	9.6e-87	34.5
AZJ19567.1\|1394626_1395736_-\|integrase	site-specific integrase	A0A0U3U8Y8	Bacillus_phage	1.6e-142	76.2
AZJ19568.1\|1396175_1396520_-	XRE family transcriptional regulator	A0A1B1P888	Bacillus_phage	3.5e-19	43.8
AZJ19569.1\|1397013_1398237_+	hypothetical protein	D2XQ10	Bacillus_virus	1.0e-81	44.4
AZJ19570.1\|1398473_1398689_+	hypothetical protein	NA	NA	NA	NA
AZJ19571.1\|1398724_1399075_-	transcriptional regulator	A0A0U3SD25	Bacillus_phage	2.2e-21	47.8
AZJ19572.1\|1399205_1399427_+	transcriptional regulator	Q0H243	Geobacillus_phage	1.1e-05	43.1
AZJ19573.1\|1399466_1400264_+	DNA-binding protein	A0A1Q1PVZ8	Staphylococcus_phage	8.2e-72	51.0
AZJ19574.1\|1400317_1400584_+	DNA-binding protein	A0A0U3ULL9	Bacillus_phage	1.8e-36	90.6
AZJ19575.1\|1400583_1400748_+	hypothetical protein	A0A1B1P8G4	Bacillus_phage	4.1e-18	91.5
AZJ19576.1\|1400777_1400954_+	hypothetical protein	A0A1B1P7U0	Bacillus_phage	5.3e-24	91.4
AZJ19577.1\|1400959_1401784_+	replication protein	V5UQV4	Oenococcus_phage	1.8e-42	41.0
AZJ19578.1\|1401722_1402598_+	hypothetical protein	Q2I8C8	Bacillus_phage	7.7e-63	45.8
AZJ19579.1\|1402614_1402917_+	hypothetical protein	NA	NA	NA	NA
AZJ19580.1\|1402919_1403123_+	hypothetical protein	NA	NA	NA	NA
AZJ19581.1\|1403119_1403344_-	hypothetical protein	Q9T1I9	Lactobacillus_phage	3.0e-16	62.9
AZJ19582.1\|1403424_1403619_+	hypothetical protein	A0A0U3K3J8	Bacillus_phage	1.4e-20	78.1
AZJ19583.1\|1403643_1403817_+	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	6.8e-24	93.0
AZJ19584.1\|1403831_1404086_+	hypothetical protein	A0A1B0T6B9	Bacillus_phage	6.7e-36	84.5
AZJ19585.1\|1404094_1404559_+	nucleoside permease	A0A2H4J8I5	uncultured_Caudovirales_phage	3.4e-17	36.1
AZJ19586.1\|1404576_1404798_+	glyoxalase	A0A1B0T6B5	Bacillus_phage	7.1e-26	95.2
AZJ19587.1\|1404839_1405247_+	hypothetical protein	A0A0S2MVF6	Bacillus_phage	7.6e-74	98.5
AZJ19588.1\|1405466_1405841_+	hypothetical protein	NA	NA	NA	NA
AZJ19589.1\|1406035_1406347_+	hypothetical protein	D2XR52	Bacillus_phage	9.1e-35	71.8
AZJ19590.1\|1406837_1407032_+	hypothetical protein	NA	NA	NA	NA
AZJ19591.1\|1407747_1408029_+	hypothetical protein	A0A0S2GLD3	Bacillus_phage	2.5e-39	88.2
AZJ19592.1\|1408369_1408855_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.3e-84	98.8
AZJ19593.1\|1408851_1409394_+\|integrase	site-specific integrase	H0USV4	Bacillus_phage	2.3e-94	98.3
AZJ19594.1\|1409610_1409835_+	hypothetical protein	H0USV5	Bacillus_phage	2.6e-31	93.2
AZJ19595.1\|1410260_1410548_+	hypothetical protein	H0USV6	Bacillus_phage	1.4e-45	95.8
AZJ19596.1\|1410583_1410811_+	hypothetical protein	NA	NA	NA	NA
AZJ23587.1\|1410964_1411252_+	hypothetical protein	A0A0S2MVC8	Bacillus_phage	2.2e-11	49.4
AZJ23588.1\|1411617_1411890_+	hypothetical protein	Q2I8B8	Bacillus_phage	4.7e-11	75.6
AZJ19597.1\|1411894_1412122_+	hypothetical protein	NA	NA	NA	NA
AZJ19598.1\|1412124_1412460_+	alpha/beta hydrolase	D2XR61	Bacillus_phage	1.4e-52	89.2
AZJ19599.1\|1412453_1412951_+	endonuclease	A0A2H4J2Q3	uncultured_Caudovirales_phage	1.2e-31	45.2
AZJ19600.1\|1413057_1413369_+\|terminase	terminase	D2XR14	Bacillus_phage	9.4e-40	86.3
AZJ19601.1\|1413365_1415033_+\|terminase	terminase	D2XR15	Bacillus_phage	1.3e-300	90.6
AZJ19602.1\|1415041_1416205_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	7.1e-181	81.2
AZJ19603.1\|1416188_1416971_+	peptidase	R9TLM7	Paenibacillus_phage	3.1e-55	52.0
AZJ19604.1\|1416974_1418123_+\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	5.0e-203	94.3
AZJ19605.1\|1418135_1418429_+	hypothetical protein	D2XR19	Bacillus_phage	3.8e-43	89.7
AZJ19606.1\|1418430_1418781_+\|head,tail	head-tail adaptor protein	D2XR20	Bacillus_phage	1.1e-52	87.9
AZJ19607.1\|1418807_1419182_+	hypothetical protein	Q0H235	Geobacillus_phage	5.8e-36	56.5
AZJ19608.1\|1419178_1419508_+	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	2.4e-54	94.5
AZJ19609.1\|1419508_1420081_+\|tail	phage tail protein	A0A0U4JWV5	Exiguobacterium_phage	1.1e-54	58.4
AZJ19610.1\|1420085_1420448_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	4.2e-31	55.0
AZJ19611.1\|1420558_1420672_+	hypothetical protein	NA	NA	NA	NA
AZJ19612.1\|1420689_1424646_+	tape measure protein	D2XR25	Bacillus_phage	6.8e-151	71.5
AZJ19613.1\|1424642_1425452_+\|tail	phage tail family protein	A0A290FZP5	Caldibacillus_phage	2.8e-59	44.5
AZJ19614.1\|1425465_1427250_+	hypothetical protein	NA	NA	NA	NA
AZJ19615.1\|1427267_1427465_+	hypothetical protein	NA	NA	NA	NA
AZJ19616.1\|1427822_1429796_+	hypothetical protein	A0A2H4JG80	uncultured_Caudovirales_phage	1.7e-166	60.6
AZJ19617.1\|1429832_1430300_+	hypothetical protein	A0A2H4J980	uncultured_Caudovirales_phage	4.7e-51	82.8
AZJ19618.1\|1430501_1431647_-\|transposase	IS110 family transposase	Q9JMN8	Wolbachia_phage	1.5e-42	29.2
AZJ23589.1\|1431918_1432887_+\|integrase	integrase	A0A0S2GLC8	Bacillus_phage	1.8e-174	94.7
AZJ19619.1\|1432902_1433328_+\|holin	holin	A0A1B1P787	Bacillus_phage	3.3e-72	100.0
AZJ19620.1\|1433327_1434029_+	N-acetylmuramoyl-L-alanine amidase	Q2I8E6	Bacillus_phage	1.9e-133	98.7
AZJ19621.1\|1434350_1434617_-	hypothetical protein	NA	NA	NA	NA
AZJ19622.1\|1434632_1434824_-	hypothetical protein	NA	NA	NA	NA
AZJ19623.1\|1435313_1435763_+	DUF3888 domain-containing protein	NA	NA	NA	NA
AZJ19624.1\|1436214_1437531_+	diaminopimelate decarboxylase	NA	NA	NA	NA
AZJ19625.1\|1437828_1437972_+	DUF2292 domain-containing protein	NA	NA	NA	NA
AZJ19626.1\|1438058_1438763_+	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
AZJ19627.1\|1438801_1439938_+	sulfate adenylyltransferase	A0A2K9L0F0	Tupanvirus	4.6e-44	29.7
AZJ19628.1\|1439950_1440544_+	adenylyl-sulfate kinase	NA	NA	NA	NA
AZJ19629.1\|1440555_1442178_+	ferredoxin--nitrite reductase	NA	NA	NA	NA
AZJ19630.1\|1442188_1442389_+	DUF3906 domain-containing protein	NA	NA	NA	NA
AZJ19631.1\|1442474_1443251_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AZJ19632.1\|1443252_1444008_+	sirohydrochlorin chelatase	NA	NA	NA	NA
AZJ19633.1\|1443982_1444600_+	precorrin-2 dehydrogenase	NA	NA	NA	NA
AZJ19634.1\|1445017_1446376_+	sodium-dependent transporter	NA	NA	NA	NA
AZJ19635.1\|1446670_1447942_-	peptidase M24	A0A2D0ZM66	Rhodococcus_phage	2.0e-11	37.2
AZJ19636.1\|1448435_1449710_+	glutamate/aspartate:proton symporter GltP	NA	NA	NA	NA
AZJ19637.1\|1449776_1450295_+	hypothetical protein	NA	NA	NA	NA
AZJ19638.1\|1450615_1451932_+	sodium:proton antiporter	NA	NA	NA	NA
AZJ19639.1\|1452161_1452518_+	flagellar basal body rod protein	NA	NA	NA	NA
AZJ19640.1\|1452574_1453237_+	phage shock protein A	NA	NA	NA	NA
AZJ19641.1\|1453343_1454084_+	transporter	NA	NA	NA	NA
AZJ19642.1\|1454083_1455139_+	sensor histidine kinase	NA	NA	NA	NA
AZJ19643.1\|1455135_1455768_+	DNA-binding response regulator	NA	NA	NA	NA
AZJ19644.1\|1455833_1456163_+	DUF3992 domain-containing protein	NA	NA	NA	NA
AZJ19645.1\|1456186_1457542_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
AZJ19646.1\|1458128_1458338_+	hypothetical protein	NA	NA	NA	NA
AZJ19647.1\|1458377_1459154_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZJ19648.1\|1459262_1460114_+	hypothetical protein	NA	NA	NA	NA
AZJ19649.1\|1460221_1460419_-	hypothetical protein	NA	NA	NA	NA
AZJ19650.1\|1460575_1461673_+\|protease	site-2 protease family protein	NA	NA	NA	NA
1467765:1467781	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1996801 : 2006122

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ20134.1\|1996801_1998082_+	peptidoglycan endopeptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-11	31.5
AZJ20135.1\|1998180_1998945_-	alpha/beta hydrolase	NA	NA	NA	NA
AZJ20136.1\|1999185_2000946_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-267	95.7
AZJ20137.1\|2001007_2001712_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.0e-121	92.7
AZJ20138.1\|2001708_2002782_+	sensor histidine kinase	W8CYF6	Bacillus_phage	2.1e-179	94.1
AZJ20139.1\|2002805_2003399_-	hypothetical protein	NA	NA	NA	NA
AZJ20140.1\|2003580_2004309_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	6.0e-61	100.0
AZJ20141.1\|2004446_2005118_+	methyltransferase	W8CYT3	Bacillus_phage	2.5e-66	93.4
AZJ20142.1\|2005249_2006122_+	aminoglycoside adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.6e-65	44.4

DBSCAN-SWA_4

2602419 : 2668499

Bacillus_phage(75.0%)

coat,head,holin,portal,tail,bacteriocin,tRNA,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ20671.1\|2602419_2603976_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
AZJ20672.1\|2604036_2604465_-	cell wall hydrolase	NA	NA	NA	NA
AZJ20673.1\|2604621_2605536_+	acetamidase	NA	NA	NA	NA
AZJ20674.1\|2605662_2606370_+	DNA-binding response regulator	NA	NA	NA	NA
AZJ20675.1\|2606366_2607350_+	sensor histidine kinase	NA	NA	NA	NA
AZJ20676.1\|2607751_2608378_-	hypothetical protein	NA	NA	NA	NA
AZJ23634.1\|2608939_2610568_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	6.4e-55	30.1
AZJ20677.1\|2610589_2611183_+	N-acetyltransferase	NA	NA	NA	NA
AZJ20678.1\|2611551_2612052_+	hypothetical protein	NA	NA	NA	NA
AZJ20679.1\|2612361_2613132_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-33	40.9
AZJ20680.1\|2613106_2615041_+	ABC transporter permease	NA	NA	NA	NA
AZJ20681.1\|2615106_2615781_+	hypothetical protein	NA	NA	NA	NA
AZJ20682.1\|2615856_2616198_-	DUF3914 domain-containing protein	NA	NA	NA	NA
AZJ20683.1\|2616465_2617707_+	lipase	NA	NA	NA	NA
AZJ20684.1\|2617794_2618838_+	homoserine dehydrogenase	NA	NA	NA	NA
AZJ20685.1\|2618998_2620447_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZJ20686.1\|2620451_2621366_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
AZJ20687.1\|2621666_2622356_+	thiaminase II	NA	NA	NA	NA
AZJ20688.1\|2622634_2622967_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
AZJ20689.1\|2623329_2623815_+	homoserine dehydrogenase	NA	NA	NA	NA
AZJ20690.1\|2625683_2625968_-	DUF4183 domain-containing protein	NA	NA	NA	NA
AZJ20691.1\|2626756_2627353_+	ABC transporter permease	NA	NA	NA	NA
AZJ20692.1\|2628280_2628475_+	hypothetical protein	NA	NA	NA	NA
AZJ20693.1\|2629354_2629579_+	hypothetical protein	A0A1B1P780	Bacillus_phage	8.5e-27	89.2
AZJ20694.1\|2630161_2630668_+	IDEAL domain-containing protein	G3MAV7	Bacillus_virus	8.2e-17	33.9
AZJ23635.1\|2630815_2631130_+	hypothetical protein	A0A0A7AQW3	Bacillus_phage	2.6e-21	44.7
AZJ20695.1\|2631689_2632205_+	dUTPase	A0A1L2JY27	Aeribacillus_phage	3.7e-25	44.1
AZJ20696.1\|2632201_2632618_+	hypothetical protein	A0A2P1JTY5	Anoxybacillus_phage	1.8e-30	51.9
AZJ20697.1\|2632632_2633364_+	2-methylcitrate dehydratase	NA	NA	NA	NA
AZJ23636.1\|2633478_2634327_+	hypothetical protein	NA	NA	NA	NA
AZJ20698.1\|2634336_2634738_+	hypothetical protein	NA	NA	NA	NA
AZJ20699.1\|2634730_2635405_+	RNA polymerase subunit sigma-28	Q2I8C6	Bacillus_phage	2.9e-46	45.5
AZJ20700.1\|2636269_2636671_+	hypothetical protein	A0A0S2GLF8	Bacillus_phage	3.0e-30	50.4
AZJ20701.1\|2636766_2637135_-	hypothetical protein	NA	NA	NA	NA
AZJ20702.1\|2637288_2637831_+	DNA (cytosine-5-)-methyltransferase	A0A0A8WFL3	Clostridium_phage	3.1e-54	53.9
AZJ20703.1\|2637730_2638213_+	DNA methyltransferase	A0A218MND0	uncultured_virus	3.0e-24	49.1
AZJ20704.1\|2638253_2638487_+	hypothetical protein	NA	NA	NA	NA
AZJ20705.1\|2638527_2638896_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	3.0e-13	36.2
AZJ20706.1\|2639097_2639343_+	hypothetical protein	NA	NA	NA	NA
AZJ20707.1\|2639311_2640364_+	hypothetical protein	NA	NA	NA	NA
AZJ20708.1\|2640540_2641218_+	hypothetical protein	NA	NA	NA	NA
AZJ20709.1\|2641425_2642082_+	hypothetical protein	NA	NA	NA	NA
AZJ20710.1\|2642160_2643099_+\|terminase	terminase	A0A0S2MVB6	Bacillus_phage	1.0e-113	83.1
AZJ20711.1\|2643085_2644357_+\|terminase	PBSX family phage terminase large subunit	A0A1L2JY46	Aeribacillus_phage	6.4e-220	84.2
AZJ20712.1\|2644369_2645803_+\|portal	phage portal protein	A0A0S2MVB2	Bacillus_phage	6.9e-271	96.6
AZJ23637.1\|2645876_2646644_+\|head	phage head protein	A0A0S2MVF0	Bacillus_phage	1.8e-137	96.1
AZJ20713.1\|2646719_2647430_+	ribonuclease	A0A0A7AQU8	Bacillus_phage	5.2e-70	68.6
AZJ20714.1\|2647538_2648381_+	hypothetical protein	A0A0A7AQF5	Bacillus_phage	9.1e-146	93.6
AZJ20715.1\|2648576_2648885_+	hypothetical protein	A0A0A7AQX9	Bacillus_phage	5.3e-43	84.3
AZJ20716.1\|2648881_2649226_+\|head,tail	head-tail adaptor protein	A0A0A7AR32	Bacillus_phage	1.8e-55	88.6
AZJ20717.1\|2649200_2649608_+	hypothetical protein	A0A0A7AQU9	Bacillus_phage	3.4e-66	94.8
AZJ20718.1\|2649613_2649976_+	hypothetical protein	A0A0S2MV90	Bacillus_phage	1.2e-57	90.8
AZJ20719.1\|2649990_2650584_+	hypothetical protein	A0A0S2MV81	Bacillus_phage	3.4e-107	97.5
AZJ20720.1\|2650631_2651060_+	hypothetical protein	A0A0S2MV94	Bacillus_phage	1.3e-68	95.1
AZJ23638.1\|2651164_2651371_+	hypothetical protein	A0A0A7AQY2	Bacillus_phage	5.3e-31	95.6
AZJ20721.1\|2651371_2654311_+\|tail	phage tail tape measure protein	A0A0A7AR36	Bacillus_phage	4.1e-302	77.2
AZJ23639.1\|2654332_2655814_+\|tail	phage tail protein	A0A288WFS2	Bacillus_phage	3.6e-246	83.1
AZJ20722.1\|2655810_2658873_+	peptidase S74	A0A288WG04	Bacillus_phage	0.0e+00	61.0
AZJ20723.1\|2659137_2660526_+	hypothetical protein	NA	NA	NA	NA
AZJ20724.1\|2660612_2661038_+\|holin	holin	A0A0S2MVC4	Bacillus_phage	3.1e-62	87.0
AZJ20725.1\|2661037_2661838_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	2.5e-108	70.4
AZJ20726.1\|2661971_2662280_-	hypothetical protein	NA	NA	NA	NA
AZJ20727.1\|2662514_2662973_-	1,3-beta-glucan synthase regulator	NA	NA	NA	NA
AZJ20728.1\|2662994_2664257_-	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	5.7e-51	47.0
AZJ20729.1\|2664507_2664708_+\|coat	spore coat protein	NA	NA	NA	NA
AZJ20730.1\|2664722_2665175_+\|coat	spore coat protein	NA	NA	NA	NA
AZJ20731.1\|2665288_2665762_-	restriction endonuclease	NA	NA	NA	NA
AZJ23640.1\|2665798_2665996_-	transcriptional regulator	A0A288WG80	Bacillus_phage	1.6e-08	50.0
AZJ20732.1\|2666146_2666449_+	hypothetical protein	H0USY0	Bacillus_phage	1.8e-24	54.6
AZJ20733.1\|2666445_2666628_+	hypothetical protein	Q2I8E2	Bacillus_phage	6.3e-20	80.0
AZJ20734.1\|2666746_2667937_+	cell division protein FtsK	A0A288WFS1	Bacillus_phage	1.5e-149	65.4
AZJ20735.1\|2667878_2668499_+	hypothetical protein	Q2LIA9	Bacillus_phage	6.0e-86	75.9

DBSCAN-SWA_5

2828479 : 2836580

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ20889.1\|2828479_2829847_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	3.3e-20	38.6
AZJ20890.1\|2830204_2831398_-	glycosyl transferase family 1	B0LUM8	Spodoptera_litura_multicapsid_nucleopolyhedrovirus	1.4e-11	26.9
AZJ23647.1\|2831467_2832112_-	cytoplasmic protein	A0A075BUR2	Microcystis_phage	1.1e-31	40.7
AZJ20891.1\|2832177_2832696_-	topology modulation protein	A0A097BYE2	Leuconostoc_phage	8.0e-44	47.2
AZJ20892.1\|2832717_2833104_-	DUF2809 domain-containing protein	NA	NA	NA	NA
AZJ20893.1\|2833169_2833877_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	9.4e-19	27.5
AZJ20894.1\|2833898_2834252_-	cytoplasmic protein	NA	NA	NA	NA
AZJ20895.1\|2834267_2834672_-	N-acetyltransferase	NA	NA	NA	NA
AZJ20896.1\|2834979_2836365_+	S-layer protein	Q0H255	Geobacillus_phage	3.0e-77	59.5
AZJ20897.1\|2836367_2836580_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.9e-12	51.5

DBSCAN-SWA_6

3508460 : 3522584

Bacillus_phage(81.82%)

bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ21523.1\|3508460_3509939_+	Lsa family ABC-F type ribosomal protection protein	Q6DMX7	Streptococcus_phage	2.0e-31	25.5
AZJ21524.1\|3510081_3510687_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZJ21525.1\|3512052_3512883_+	cytosolic protein	A0A2H4J6G7	uncultured_Caudovirales_phage	2.4e-106	71.7
AZJ21526.1\|3512889_3513510_-	hypothetical protein	H0USY2	Bacillus_phage	1.6e-99	84.5
AZJ21527.1\|3513451_3514633_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.3e-185	80.9
AZJ21528.1\|3514748_3514931_-	hypothetical protein	Q2I8E2	Bacillus_phage	2.2e-20	85.0
AZJ21529.1\|3514927_3515233_-	hypothetical protein	A0A288WG38	Bacillus_phage	2.3e-22	49.5
AZJ21530.1\|3515418_3515640_+	XRE family transcriptional regulator	A0A0S2SXU5	Bacillus_phage	2.1e-09	49.2
AZJ21531.1\|3515636_3516230_-	restriction endonuclease	NA	NA	NA	NA
AZJ21532.1\|3516992_3517697_-	N-acetylmuramoyl-L-alanine amidase	W8CZ46	Bacillus_phage	1.5e-114	85.7
AZJ21533.1\|3517696_3517927_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	1.6e-28	87.8
AZJ21534.1\|3517995_3518220_-	hypothetical protein	A0A1B1P780	Bacillus_phage	3.5e-20	75.0
AZJ21535.1\|3518318_3522584_-	4'-phosphopantetheinyl transferase	A0A0A0RPU4	Bacillus_phage	7.1e-138	37.7

DBSCAN-SWA_7

3532013 : 3551749

Bacillus_phage(82.35%)

integrase,terminase

attL 3549477:3549491|attR 3554256:3554270

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23681.1\|3532013_3533429_-\|terminase	terminase	U5PVG8	Bacillus_phage	1.3e-192	70.0
AZJ21546.1\|3533472_3533979_-	hypothetical protein	A0A090DCM3	Clostridium_phage	2.2e-38	51.6
AZJ21547.1\|3534035_3534608_-	resolvase	I1ZBD6	Salisaeta_icosahedral_phage	4.4e-27	40.8
AZJ21548.1\|3534775_3534928_-	hypothetical protein	NA	NA	NA	NA
AZJ21549.1\|3535281_3535677_-	hypothetical protein	A0A1C8E9D1	Bacillus_phage	5.7e-42	66.4
AZJ21550.1\|3536227_3538093_-	DNA primase	A0A1B1P7L5	Bacillus_phage	0.0e+00	92.9
AZJ21551.1\|3538900_3540583_-	hypothetical protein	A0A1B1P7M5	Bacillus_phage	2.8e-303	88.5
AZJ21552.1\|3540668_3541160_-	DUF669 domain-containing protein	A0A1B1P7N3	Bacillus_phage	3.3e-87	95.1
AZJ21553.1\|3541159_3541477_-	organic solvent tolerance protein OstA	A0A1B1P7N6	Bacillus_phage	7.3e-32	74.3
AZJ21554.1\|3541500_3543312_-	NTP-binding protein	A0A1B1P7N0	Bacillus_phage	1.8e-255	86.7
AZJ21555.1\|3543311_3543590_-	nuclease	A0A1B1P7M6	Bacillus_phage	4.3e-44	88.0
AZJ21556.1\|3543590_3543908_-	hypothetical protein	A0A1B1P7L0	Bacillus_phage	2.9e-12	43.3
AZJ21557.1\|3543897_3544095_-	hypothetical protein	NA	NA	NA	NA
AZJ21558.1\|3544087_3545320_-	helicase SNF2	A0A1B1P7L4	Bacillus_phage	2.8e-212	86.9
AZJ21559.1\|3545367_3546009_-	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	7.6e-52	50.2
AZJ21560.1\|3546034_3546223_-	helix-turn-helix domain-containing protein	A0A1B2APY7	Phage_Wrath	1.2e-18	75.8
AZJ21561.1\|3546234_3546432_-	hypothetical protein	NA	NA	NA	NA
AZJ21562.1\|3546829_3547084_-	hypothetical protein	NA	NA	NA	NA
AZJ21563.1\|3547330_3547660_+	transcriptional regulator	H0UST7	Bacillus_phage	4.8e-50	94.5
AZJ23682.1\|3548062_3549229_-	hypothetical protein	H0UST6	Bacillus_phage	6.6e-54	32.2
3549477:3549491	attL	NA	NA	NA	NA
AZJ21564.1\|3550687_3551749_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	1.1e-196	98.9
AZJ21564.1\|3550687_3551749_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	1.1e-196	98.9
3554256:3554270	attR	NA	NA	NA	NA

DBSCAN-SWA_8

3706150 : 3758507

Bacillus_phage(28.12%)

capsid,head,holin,portal,tail,protease,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ21710.1\|3706150_3706516_+\|holin	holin	NA	NA	NA	NA
AZJ21711.1\|3706512_3707190_+	LrgB family protein	NA	NA	NA	NA
AZJ21712.1\|3707202_3707616_-	DNA mismatch repair protein MutT	NA	NA	NA	NA
AZJ21713.1\|3707757_3707964_+	DUF3903 domain-containing protein	NA	NA	NA	NA
AZJ21714.1\|3708273_3709029_-	hypothetical protein	NA	NA	NA	NA
AZJ21715.1\|3709127_3709274_-	hypothetical protein	NA	NA	NA	NA
AZJ23686.1\|3709486_3711214_-	N-acetylmuramoyl-L-alanine amidase	Q9ZXD7	Bacillus_phage	6.2e-40	55.0
AZJ21716.1\|3711427_3711994_-	hypothetical protein	NA	NA	NA	NA
AZJ21717.1\|3712000_3713020_-	NERD domain-containing protein	A0A1L2JY40	Aeribacillus_phage	1.3e-24	27.9
AZJ21718.1\|3713229_3714279_-	N-acetylmuramoyl-L-alanine amidase	A0A140HM31	Bacillus_phage	6.0e-30	49.6
AZJ21719.1\|3714411_3716175_-	ABC transporter ATP-binding protein	A0A1V0SD74	Indivirus	9.2e-15	23.4
AZJ21720.1\|3716174_3717926_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.3e-49	27.9
AZJ21721.1\|3718049_3718271_-	hypothetical protein	NA	NA	NA	NA
AZJ21722.1\|3718349_3718790_-	sporulation inhibitor of replication protein SirA	NA	NA	NA	NA
AZJ21723.1\|3718946_3720947_-	transketolase	NA	NA	NA	NA
AZJ21724.1\|3721726_3722530_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AZJ21725.1\|3722529_3723324_-	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
AZJ21726.1\|3723320_3724094_-	phosphonate ABC transporter ATP-binding protein	W5SAS9	Pithovirus	1.0e-10	27.5
AZJ23687.1\|3724178_3725183_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZJ21727.1\|3725301_3726885_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
AZJ21728.1\|3726924_3727164_-	hypothetical protein	NA	NA	NA	NA
AZJ21729.1\|3727209_3727866_-	resolvase	NA	NA	NA	NA
AZJ23688.1\|3727995_3728628_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	4.9e-19	62.2
AZJ21730.1\|3728716_3729523_-	GNAT family acetyltransferase	NA	NA	NA	NA
AZJ21731.1\|3729523_3730066_-	DUF1700 domain-containing protein	NA	NA	NA	NA
AZJ21732.1\|3730058_3730388_-	PadR family transcriptional regulator	NA	NA	NA	NA
AZJ21733.1\|3730957_3731158_-	hypothetical protein	NA	NA	NA	NA
AZJ21734.1\|3731180_3732266_-	serine/threonine protein kinase	G9L673	Escherichia_phage	3.5e-57	43.4
AZJ21735.1\|3732262_3732751_-	hypothetical protein	NA	NA	NA	NA
AZJ21736.1\|3732919_3733132_-	DNA-binding protein	A0A1Z1LZP5	Bacillus_phage	3.1e-18	68.6
AZJ21737.1\|3733679_3734348_+	hypothetical protein	NA	NA	NA	NA
AZJ21738.1\|3734618_3735674_-	N-acetylmuramoyl-L-alanine amidase	A0A1C8E990	Bacillus_phage	4.9e-157	76.9
AZJ21739.1\|3735670_3735910_-\|holin	holin	A0A0A7AR38	Bacillus_phage	5.7e-29	83.5
AZJ21740.1\|3735909_3736146_-	hypothetical protein	A0A2H4J382	uncultured_Caudovirales_phage	1.9e-16	92.3
AZJ23689.1\|3736184_3738332_-	hypothetical protein	D2XR28	Bacillus_phage	2.0e-128	40.1
AZJ21741.1\|3743323_3744796_-\|tail	phage tail protein	D2XPZ5	Bacillus_virus	1.7e-216	71.3
AZJ21742.1\|3744837_3747270_-	hypothetical protein	D2XR26	Bacillus_phage	6.1e-09	66.0
AZJ21743.1\|3747484_3748735_-	hypothetical protein	A0A2H4JAI2	uncultured_Caudovirales_phage	6.9e-182	84.3
AZJ21744.1\|3748747_3748909_-	hypothetical protein	A0A2H4JHE4	uncultured_Caudovirales_phage	4.5e-22	92.5
AZJ21745.1\|3748962_3749325_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	9.2e-47	74.8
AZJ21746.1\|3749329_3749923_-\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	5.9e-91	83.0
AZJ21747.1\|3749923_3750253_-	hypothetical protein	A0A2H4JAG4	uncultured_Caudovirales_phage	3.8e-47	83.5
AZJ21748.1\|3750249_3750606_-	hypothetical protein	D2XR21	Bacillus_phage	2.7e-30	60.3
AZJ21749.1\|3750598_3750898_-\|head,tail	phage head-tail adapter protein	R9TPZ2	Paenibacillus_phage	4.4e-10	39.4
AZJ21750.1\|3750894_3751173_-	DNA-packaging protein	R9TMB7	Paenibacillus_phage	2.5e-20	56.2
AZJ21751.1\|3751169_3751460_-	hypothetical protein	A6XMJ7	Bacillus_virus	7.5e-07	40.2
AZJ21752.1\|3751496_3752660_-\|capsid	phage major capsid protein	H7BUQ0	unidentified_phage	1.8e-80	54.7
AZJ21753.1\|3752673_3753258_-\|head,protease	HK97 family phage prohead protease	A0A2I7SBY1	Paenibacillus_phage	3.0e-39	50.0
AZJ21754.1\|3753223_3754435_-\|portal	phage portal protein	J9QE83	Clostridium_phage	1.0e-137	59.4
AZJ21755.1\|3754450_3756139_-\|terminase	terminase large subunit	A0A290GJW3	Caldibacillus_phage	1.8e-238	70.5
AZJ21756.1\|3756135_3756510_-	hypothetical protein	R9TQ46	Paenibacillus_phage	2.1e-17	46.7
AZJ21757.1\|3756676_3756973_-	HNH endonuclease	R9TNN2	Paenibacillus_phage	1.6e-28	61.5
AZJ21758.1\|3757307_3757469_+	hypothetical protein	NA	NA	NA	NA
AZJ21759.1\|3757739_3758162_+	pilus assembly protein HicB	A0A1L2JY34	Aeribacillus_phage	1.7e-39	57.6
AZJ21760.1\|3758228_3758507_-	DNA-binding protein	A0A2H4JBQ8	uncultured_Caudovirales_phage	1.5e-09	43.8

DBSCAN-SWA_9

3767862 : 3778999

Bacillus_phage(75.0%)

integrase

attL 3774353:3774367|attR 3790043:3790057

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ21770.1\|3767862_3768237_-	ArpU family transcriptional regulator	A0A0M4R397	Bacillus_phage	3.8e-43	68.5
AZJ21771.1\|3768241_3768529_-	hypothetical protein	A6M999	Geobacillus_virus	1.9e-34	71.3
AZJ21772.1\|3768666_3768969_+	hypothetical protein	NA	NA	NA	NA
AZJ21773.1\|3769118_3769865_-	thymidylate synthase (FAD)	A0A142F1S2	Bacillus_phage	5.0e-79	61.4
AZJ21774.1\|3769903_3770476_-	dUTPase	A0A0A7AQI4	Bacillus_phage	1.7e-79	73.8
AZJ21775.1\|3770570_3770693_-	Fur-regulated basic protein FbpA	NA	NA	NA	NA
AZJ21776.1\|3770695_3771325_-	hypothetical protein	A0A0M4RU33	Bacillus_phage	5.7e-28	41.4
AZJ21777.1\|3771321_3771492_-	hypothetical protein	NA	NA	NA	NA
AZJ21778.1\|3771488_3771677_-	hypothetical protein	NA	NA	NA	NA
AZJ21779.1\|3771700_3772531_-	hypothetical protein	U5PWH5	Bacillus_phage	2.0e-36	38.7
AZJ21780.1\|3772466_3773225_-	replication protein	A0A1W6JNI1	Staphylococcus_phage	4.3e-62	55.3
AZJ21781.1\|3773221_3773494_-	hypothetical protein	A0A0M4S680	Bacillus_phage	6.5e-37	80.9
AZJ21782.1\|3773507_3774179_-	DUF1071 domain-containing protein	A0A1B1P7F0	Bacillus_phage	4.0e-27	46.3
AZJ21783.1\|3774175_3774658_-	ATPase	E5DV79	Deep-sea_thermophilic_phage	4.1e-34	48.1
3774353:3774367	attL	NA	NA	NA	NA
AZJ21784.1\|3774672_3774936_-	hypothetical protein	A0A0M5M3T1	Bacillus_phage	1.3e-10	61.1
AZJ21785.1\|3774907_3775255_-	hypothetical protein	NA	NA	NA	NA
AZJ21786.1\|3775214_3775400_-	hypothetical protein	NA	NA	NA	NA
AZJ21787.1\|3775375_3775642_-	group-specific protein	S5MC08	Brevibacillus_phage	6.6e-26	57.0
AZJ21788.1\|3775661_3776363_-	Rha family transcriptional regulator	A0A288WFT2	Bacillus_phage	1.7e-65	55.5
AZJ21789.1\|3776347_3776605_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZJ21790.1\|3776748_3777177_+	immunity repressor protein	Q786F1	Bacillus_phage	4.2e-38	60.6
AZJ21791.1\|3777199_3777628_+	hypothetical protein	Q9T201	Bacillus_phage	3.6e-34	54.4
AZJ21792.1\|3777644_3777812_+	hypothetical protein	NA	NA	NA	NA
AZJ21793.1\|3777853_3778999_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	1.5e-66	38.5
3790043:3790057	attR	NA	NA	NA	NA

DBSCAN-SWA_10

4570172 : 4577851

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ22606.1\|4570172_4571096_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-45	43.5
AZJ22607.1\|4571220_4572156_-	sensor histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	3.6e-10	25.9
AZJ22608.1\|4572157_4572850_-	DNA-binding response regulator	B5LWA6	Feldmannia_species_virus	2.3e-06	27.9
AZJ22609.1\|4573019_4573193_+	hypothetical protein	NA	NA	NA	NA
AZJ22610.1\|4573193_4573388_+	hypothetical protein	NA	NA	NA	NA
AZJ22611.1\|4573427_4574627_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	1.8e-70	41.2
AZJ22612.1\|4574922_4575246_+	heme-degrading monooxygenase IsdG	NA	NA	NA	NA
AZJ22613.1\|4575314_4576076_-	SrtB family sortase	NA	NA	NA	NA
AZJ22614.1\|4576107_4576878_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.8e-14	26.6
AZJ22615.1\|4576867_4577851_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.7e-16	26.2

DBSCAN-SWA_11

5082629 : 5158252

Bacillus_phage(66.0%)

transposase,capsid,holin,head,portal,integrase,tail,protease,bacteriocin,terminase

attL 5076037:5076053|attR 5141099:5141115

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5076037:5076053	attL	NA	NA	NA	NA
AZJ23132.1\|5082629_5085314_-\|transposase	transposase	NA	NA	NA	NA
AZJ23133.1\|5085335_5086616_-	hypothetical protein	NA	NA	NA	NA
AZJ23134.1\|5086766_5088794_+	serine/threonine protein kinase	A0A2H4UVE2	Bodo_saltans_virus	4.1e-19	32.1
AZJ23135.1\|5088790_5089429_-	hypothetical protein	NA	NA	NA	NA
AZJ23136.1\|5089826_5090525_-	hypothetical protein	NA	NA	NA	NA
AZJ23137.1\|5090633_5091833_-	macrolide ABC transporter permease	NA	NA	NA	NA
AZJ23138.1\|5091829_5092510_-	macrolide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.2e-35	40.1
AZJ23139.1\|5092506_5093700_-	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZJ23140.1\|5093886_5094108_+\|bacteriocin	bacteriocin uberolysin	NA	NA	NA	NA
AZJ23141.1\|5094207_5095893_+	hypothetical protein	NA	NA	NA	NA
AZJ23142.1\|5095897_5096428_+	stage II sporulation protein M	NA	NA	NA	NA
AZJ23143.1\|5096475_5097120_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	4.7e-09	25.5
AZJ23144.1\|5097148_5097430_+	hypothetical protein	NA	NA	NA	NA
AZJ23145.1\|5098386_5098854_-	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	3.1e-47	61.3
AZJ23146.1\|5099225_5101664_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.3e-91	40.8
AZJ23147.1\|5102156_5103038_+	cytosolic protein	I7ILW0	Bacillus_phage	5.8e-127	84.6
AZJ23148.1\|5103040_5103649_-	hypothetical protein	W8CZ47	Bacillus_phage	1.1e-89	79.1
AZJ23149.1\|5103638_5104805_-	cell division protein FtsK	A0A0S2GLG9	Bacillus_phage	1.4e-192	84.8
AZJ23150.1\|5104815_5105010_-	hypothetical protein	A0A1B1P7T1	Bacillus_phage	1.2e-13	54.7
AZJ23151.1\|5105309_5105531_+	transcriptional regulator	A0A0S2GLH4	Bacillus_phage	4.6e-25	72.6
AZJ23152.1\|5105663_5105882_+	hypothetical protein	NA	NA	NA	NA
AZJ23153.1\|5105914_5106676_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7G0	Bacillus_phage	1.0e-124	85.4
AZJ23154.1\|5106675_5107101_-\|holin	holin	D2XPZ9	Bacillus_virus	2.9e-68	93.6
AZJ23155.1\|5107136_5107583_-	hypothetical protein	A0A2H4J980	uncultured_Caudovirales_phage	9.6e-54	87.7
AZJ23156.1\|5107621_5109595_-	hypothetical protein	A0A2H4JG80	uncultured_Caudovirales_phage	7.8e-164	60.4
AZJ23157.1\|5109610_5111395_-	hypothetical protein	NA	NA	NA	NA
AZJ23158.1\|5111408_5112218_-\|tail	phage tail family protein	A0A290FZP5	Caldibacillus_phage	2.8e-59	44.2
AZJ23159.1\|5112214_5113657_-	tape measure protein	D2XR26	Bacillus_phage	1.3e-11	41.5
AZJ23160.1\|5116395_5116509_-	hypothetical protein	NA	NA	NA	NA
AZJ23161.1\|5116619_5116982_-	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	4.2e-31	55.0
AZJ23162.1\|5116986_5117559_-\|tail	phage tail protein	A0A0U4JWV5	Exiguobacterium_phage	1.5e-54	58.4
AZJ23163.1\|5117559_5117892_-	hypothetical protein	D2XR22	Bacillus_phage	2.0e-40	78.2
AZJ23727.1\|5117888_5118233_-	hypothetical protein	A0A2H4JAH8	uncultured_Caudovirales_phage	1.0e-50	84.2
AZJ23164.1\|5118234_5118579_-	hypothetical protein	NA	NA	NA	NA
AZJ23165.1\|5118565_5118859_-	hypothetical protein	A0A0S2SXS0	Bacillus_phage	3.7e-22	55.2
AZJ23166.1\|5118851_5119031_-	hypothetical protein	A0A0S2SXV2	Bacillus_phage	8.1e-12	66.1
AZJ23167.1\|5119046_5120219_-\|capsid	phage major capsid protein	A0A0S2SXJ6	Bacillus_phage	6.5e-158	82.3
AZJ23168.1\|5120211_5120784_-\|head,protease	HK97 family phage prohead protease	A0A0S2SXJ4	Bacillus_phage	5.7e-67	67.4
AZJ23169.1\|5120776_5121946_-\|portal	phage portal protein	A0A1S5S8H6	Streptococcus_phage	9.4e-133	57.7
AZJ23170.1\|5121964_5123722_-\|terminase	terminase	C5J959	Streptococcus_phage	3.5e-200	60.2
AZJ23171.1\|5123727_5124081_-\|terminase	terminase	A0A0U4JV93	Exiguobacterium_phage	1.3e-21	50.5
AZJ23728.1\|5124174_5124384_-	hypothetical protein	NA	NA	NA	NA
AZJ23172.1\|5124386_5124551_-	DNA-binding protein	A0A142F1N8	Bacillus_phage	1.5e-09	62.2
AZJ23173.1\|5124550_5124832_-	restriction endonuclease	A0A0S2SXR6	Bacillus_phage	2.6e-28	66.3
AZJ23174.1\|5125192_5125438_-	hypothetical protein	W8CYG8	Bacillus_phage	5.0e-36	93.8
AZJ23175.1\|5125644_5126187_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	3.3e-96	99.4
AZJ23176.1\|5126183_5126672_-	ArpU family transcriptional regulator	A0A1B0T6C9	Bacillus_phage	2.0e-84	96.9
AZJ23177.1\|5127012_5127294_-	hypothetical protein	A0A0S2GLD3	Bacillus_phage	2.5e-39	88.2
AZJ23178.1\|5127420_5127819_-	hypothetical protein	NA	NA	NA	NA
AZJ23179.1\|5127927_5128155_-	hypothetical protein	NA	NA	NA	NA
AZJ23180.1\|5128200_5128446_-	hypothetical protein	NA	NA	NA	NA
AZJ23181.1\|5128660_5129035_-	hypothetical protein	NA	NA	NA	NA
AZJ23182.1\|5129518_5129830_-	hypothetical protein	D2XR52	Bacillus_phage	9.1e-35	71.8
AZJ23183.1\|5130019_5130328_-	hypothetical protein	H0USU8	Bacillus_phage	3.5e-47	90.2
AZJ23184.1\|5130498_5130696_-	hypothetical protein	H0USU7	Bacillus_phage	4.7e-29	95.2
AZJ23185.1\|5130983_5131148_-	DUF3954 domain-containing protein	A0A0S2GLF5	Bacillus_phage	3.7e-19	83.3
AZJ23186.1\|5131198_5131465_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	4.0e-39	92.0
AZJ23187.1\|5131507_5132320_-	DNA replication protein	A0A0S2GLK2	Bacillus_phage	3.7e-144	93.0
AZJ23188.1\|5132282_5133299_-	DNA replication protein DnaD	W8CYG5	Bacillus_phage	3.7e-178	92.9
AZJ23189.1\|5133544_5134192_-	sigma-70 family RNA polymerase sigma factor	H0USU1	Bacillus_phage	8.9e-109	92.1
AZJ23190.1\|5134524_5134839_-	hypothetical protein	H0USU0	Bacillus_phage	8.3e-44	91.2
AZJ23191.1\|5135000_5135762_-	phage regulatory protein	A0A0S2GLP8	Bacillus_phage	3.3e-94	69.8
AZJ23192.1\|5135973_5136162_-	transcriptional regulator	A0A0S2GLE9	Bacillus_phage	6.7e-25	91.9
AZJ23193.1\|5136212_5136440_-	XRE family transcriptional regulator	A0A0S2GLE0	Bacillus_phage	4.0e-24	66.7
AZJ23729.1\|5136590_5136953_+	XRE family transcriptional regulator	I7J6V3	Bacillus_phage	2.1e-46	82.6
AZJ23730.1\|5137318_5138569_-	hypothetical protein	W8CYT9	Bacillus_phage	1.3e-185	79.1
AZJ23194.1\|5139166_5140228_+\|integrase	site-specific integrase	H0UST3	Bacillus_phage	1.3e-162	79.0
AZJ23195.1\|5140289_5141033_-	carboxylesterase	NA	NA	NA	NA
AZJ23196.1\|5141192_5141426_-	preprotein translocase subunit SecG	NA	NA	NA	NA
5141099:5141115	attR	NA	NA	NA	NA
AZJ23197.1\|5141520_5142213_-	LrgB family protein	NA	NA	NA	NA
AZJ23198.1\|5142209_5142578_-\|holin	holin-like protein	NA	NA	NA	NA
AZJ23199.1\|5142913_5143864_+	nucleoside hydrolase	NA	NA	NA	NA
AZJ23200.1\|5143914_5145210_-	enolase	A0A1X9I5Z8	Streptococcus_phage	8.4e-183	75.4
AZJ23201.1\|5145240_5146770_-	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
AZJ23202.1\|5146766_5147522_-	triose-phosphate isomerase	NA	NA	NA	NA
AZJ23203.1\|5147554_5148739_-	phosphoglycerate kinase	NA	NA	NA	NA
AZJ23204.1\|5148878_5149883_-	aldehyde dehydrogenase	NA	NA	NA	NA
AZJ23205.1\|5149909_5150938_-	hypothetical protein	NA	NA	NA	NA
AZJ23206.1\|5151073_5151319_-	glutaredoxin family protein	NA	NA	NA	NA
AZJ23207.1\|5151328_5152636_-	RNA polymerase factor sigma-54	NA	NA	NA	NA
AZJ23208.1\|5152908_5153205_-	hypothetical protein	NA	NA	NA	NA
AZJ23209.1\|5153666_5153873_+	DUF1657 domain-containing protein	NA	NA	NA	NA
AZJ23210.1\|5153966_5154452_+	hypothetical protein	NA	NA	NA	NA
AZJ23211.1\|5154481_5154958_+	stage V sporulation protein AC	NA	NA	NA	NA
AZJ23212.1\|5154958_5155975_+	stage V sporulation protein AD	NA	NA	NA	NA
AZJ23213.1\|5155971_5156322_+	stage V sporulation protein AE	NA	NA	NA	NA
AZJ23214.1\|5156333_5156540_+	DUF1657 domain-containing protein	NA	NA	NA	NA
AZJ23215.1\|5156560_5157430_+	hypothetical protein	NA	NA	NA	NA
AZJ23216.1\|5157670_5158252_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.8e-55	56.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP024689

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

42690 : 69185

Escherichia_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24805.1\|42690_43560_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AZJ24737.1\|43836_44193_+	hypothetical protein	NA	NA	NA	NA
AZJ24738.1\|44146_44479_+	DeoR family transcriptional regulator	NA	NA	NA	NA
AZJ24739.1\|44768_45362_+	cell division protein FtsN	NA	NA	NA	NA
AZJ24740.1\|45495_45687_-	hypothetical protein	NA	NA	NA	NA
AZJ24741.1\|45892_46126_-	RNA chaperone Hfq	NA	NA	NA	NA
AZJ24742.1\|46147_46429_-	AbrB family transcriptional regulator	A0A1B1P791	Bacillus_phage	6.3e-11	31.4
AZJ24743.1\|46553_46844_-	transcriptional regulator	NA	NA	NA	NA
AZJ24806.1\|47481_48351_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
AZJ24744.1\|48342_48525_-	hypothetical protein	NA	NA	NA	NA
AZJ24745.1\|48842_49709_+	hypothetical protein	NA	NA	NA	NA
AZJ24746.1\|49784_50843_+	hypothetical protein	NA	NA	NA	NA
AZJ24747.1\|52236_52527_-	transcriptional regulator	NA	NA	NA	NA
AZJ24748.1\|52619_53192_-	hypothetical protein	NA	NA	NA	NA
AZJ24749.1\|53440_53653_-	hypothetical protein	NA	NA	NA	NA
AZJ24750.1\|54412_54694_+	AbrB family transcriptional regulator	A0A2I7SC16	Paenibacillus_phage	1.1e-10	59.0
AZJ24751.1\|54715_54949_+	RNA chaperone Hfq	NA	NA	NA	NA
AZJ24752.1\|55002_55281_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	5.1e-21	62.2
AZJ24753.1\|55420_55606_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AZJ24754.1\|55673_55982_+	50S ribosomal protein L7ae	NA	NA	NA	NA
AZJ24755.1\|56555_57263_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24756.1\|57319_57466_+	Spo0E family sporulation regulatory protein-aspartic acid phosphatase	NA	NA	NA	NA
AZJ24757.1\|58053_58377_-	hypothetical protein	NA	NA	NA	NA
AZJ24807.1\|58364_59234_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AZJ24758.1\|59912_60131_-	hypothetical protein	NA	NA	NA	NA
AZJ24808.1\|60304_60544_-	hypothetical protein	NA	NA	NA	NA
AZJ24759.1\|60637_60895_-	hypothetical protein	NA	NA	NA	NA
AZJ24760.1\|61062_61560_-	hypothetical protein	NA	NA	NA	NA
AZJ24761.1\|62278_62626_+	hypothetical protein	NA	NA	NA	NA
AZJ24762.1\|62695_63403_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24763.1\|63560_65372_-	enterotoxin C	Q38196	Clostridium_botulinum_phage	4.0e-05	37.6
AZJ24764.1\|65477_66680_-	enterotoxin	NA	NA	NA	NA
AZJ24765.1\|66734_67895_-	enterotoxin	NA	NA	NA	NA
AZJ24766.1\|68477_69185_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP024685

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14739

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23741.1\|728_2375_-	cell wall hydrolase	NA	NA	NA	NA
AZJ24095.1\|2773_2920_+	gamma-aminobutyrate permease	NA	NA	NA	NA
AZJ23742.1\|3509_6119_+	S-layer protein	NA	NA	NA	NA
AZJ23743.1\|6190_6388_-	hypothetical protein	NA	NA	NA	NA
AZJ23744.1\|6374_6923_+	hypothetical protein	NA	NA	NA	NA
AZJ23745.1\|8032_8242_+	hypothetical protein	NA	NA	NA	NA
AZJ23746.1\|9304_9679_-	hypothetical protein	NA	NA	NA	NA
AZJ23747.1\|10367_10529_-	hypothetical protein	NA	NA	NA	NA
AZJ23748.1\|10528_11644_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	5.8e-108	54.4
AZJ23749.1\|12662_13751_-	CDP-glucose 4,6-dehydratase	M4QRT5	Synechococcus_phage	3.0e-16	26.3
AZJ23750.1\|13779_14739_-	CDP-abequose synthase	A0A2K9L4U8	Tupanvirus	2.8e-26	29.8

DBSCAN-SWA_2

26494 : 27871

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23758.1\|26494_27871_+	chitin-binding protein	G1FGA4	Mycobacterium_phage	2.9e-08	39.2

DBSCAN-SWA_3

36202 : 36979

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23764.1\|36202_36979_+	2-deoxy-D-gluconate 3-dehydrogenase	A0A0K0KVL6	Prochlorococcus_phage	2.9e-05	27.2

DBSCAN-SWA_4

73209 : 74952

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23791.1\|73209_74952_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-12	57.3

DBSCAN-SWA_5

77996 : 79424

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23795.1\|77996_79424_-	glucosaminidase	G3MAW8	Bacillus_virus	2.9e-27	43.6

DBSCAN-SWA_6

82701 : 84426

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23798.1\|82701_84426_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.9e-20	23.3

DBSCAN-SWA_7

91192 : 93113

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23803.1\|91192_91420_-	hypothetical protein	A0A125RQ78	Bacillus_phage	1.7e-06	38.2
AZJ23804.1\|92378_93113_+	chitooligosaccharide deacetylase	A0A2K9L357	Tupanvirus	3.7e-10	27.0

DBSCAN-SWA_8

108621 : 192337

Bacillus_phage(21.05%)

transposase,holin,protease,integrase

attL 113424:113474|attR 192340:192390

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23819.1\|108621_109203_-	hypothetical protein	A0A127AWH2	Bacillus_phage	8.2e-05	26.6
AZJ23820.1\|109254_110367_-	riboflavin biosynthesis protein RibD	A0A2H4PQS8	Staphylococcus_phage	7.2e-58	35.9
AZJ23821.1\|110359_111097_-	GTP cyclohydrolase	A0A2H4PQS2	Staphylococcus_phage	1.2e-29	45.9
AZJ23822.1\|111400_111718_+	transcriptional regulator	NA	NA	NA	NA
AZJ23823.1\|111992_113423_-\|transposase	IS4 family transposase	NA	NA	NA	NA
113424:113474	attL	NA	NA	NA	NA
AZJ23824.1\|113539_113890_-	hypothetical protein	NA	NA	NA	NA
AZJ23825.1\|117728_118766_-	peptidase M15	NA	NA	NA	NA
AZJ23826.1\|119409_121200_-	histidine kinase	NA	NA	NA	NA
AZJ23827.1\|121204_121795_-	histidine kinase	NA	NA	NA	NA
AZJ23828.1\|122494_123826_-	erythromycin esterase	NA	NA	NA	NA
AZJ23829.1\|124424_125582_-	D-alanyl-D-alanine carboxypeptidase	G1DB24	Mycobacterium_phage	7.3e-21	27.0
AZJ23830.1\|126164_128186_+	penicillin-binding protein	A0A1I9S919	Mycobacterium_phage	2.3e-09	31.9
AZJ23831.1\|128547_129294_+	bacitracin ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.1e-29	36.7
AZJ23832.1\|129295_131263_+	ABC transporter permease	NA	NA	NA	NA
AZJ23833.1\|132015_132462_+	spermidine acetyltransferase	NA	NA	NA	NA
AZJ23834.1\|132901_135784_-	collagenase	NA	NA	NA	NA
AZJ23835.1\|136602_137301_-	hypothetical protein	NA	NA	NA	NA
AZJ23836.1\|137666_138137_+	DUF5065 domain-containing protein	NA	NA	NA	NA
AZJ23837.1\|138319_139081_-	hypothetical protein	NA	NA	NA	NA
AZJ23838.1\|141424_141805_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZJ23839.1\|141801_142500_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-16	24.7
AZJ23840.1\|142496_143291_+	ABC transporter permease	NA	NA	NA	NA
AZJ23841.1\|143330_144065_+	hypothetical protein	NA	NA	NA	NA
AZJ23842.1\|144281_145649_-	ABC transporter permease	NA	NA	NA	NA
AZJ23843.1\|145725_146496_-	bacitracin ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-34	38.3
AZJ23844.1\|146667_147852_-	ABC transporter permease	NA	NA	NA	NA
AZJ23845.1\|147854_148529_-	macrolide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-37	40.6
AZJ23846.1\|148525_149626_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZJ23847.1\|149902_150988_-	vancomycin resistance histidine kinase VanS	A0A1B0VMK3	Pseudomonas_phage	1.5e-20	31.9
AZJ23848.1\|150980_151685_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	2.6e-37	38.9
AZJ23849.1\|152179_152554_-	hypothetical protein	NA	NA	NA	NA
AZJ23850.1\|153157_153805_+	recombinase	Q1MVP4	Enterobacteria_phage	5.7e-15	30.7
AZJ23851.1\|153927_154245_+	2-acyl-glycerophospho-ethanolamine acyltransferase	NA	NA	NA	NA
AZJ23852.1\|154468_154687_-	acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.2e-17	65.2
AZJ23853.1\|155241_155439_-	hypothetical protein	NA	NA	NA	NA
AZJ23854.1\|155615_156788_-\|integrase	integrase	A0A142F1N9	Bacillus_phage	3.4e-05	24.4
AZJ23855.1\|157191_158193_+	excisionase	NA	NA	NA	NA
AZJ23856.1\|158679_159609_-\|holin	choline-binding protein A	NA	NA	NA	NA
AZJ23857.1\|160108_161263_+	ribonuclease	NA	NA	NA	NA
AZJ23858.1\|161644_161887_-	hypothetical protein	NA	NA	NA	NA
AZJ23859.1\|162103_162196_+	hypothetical protein	NA	NA	NA	NA
AZJ23860.1\|162254_162554_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AZJ23861.1\|163179_163920_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
AZJ23862.1\|164158_164593_-	sodium:proton symporter	NA	NA	NA	NA
AZJ23863.1\|165392_165866_+	DUF1203 domain-containing protein	NA	NA	NA	NA
AZJ23864.1\|166006_167437_+\|transposase	IS4 family transposase	NA	NA	NA	NA
AZJ23865.1\|168615_170559_-	ABC transporter permease	NA	NA	NA	NA
AZJ23866.1\|170533_171304_-	bacitracin ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-33	42.5
AZJ23867.1\|172144_173095_+	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	2.9e-55	44.5
AZJ23868.1\|173656_174307_-	sugar phosphate isomerase	NA	NA	NA	NA
AZJ23869.1\|174583_176545_-	chitin-binding protein	NA	NA	NA	NA
AZJ23870.1\|177038_177467_-	DUF4879 domain-containing protein	NA	NA	NA	NA
AZJ23871.1\|177784_178549_-	short-chain dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-22	29.1
AZJ23872.1\|178948_179854_-	EamA family transporter	NA	NA	NA	NA
AZJ23873.1\|179963_181358_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.7e-25	25.8
AZJ23874.1\|181558_182545_-	hypothetical protein	NA	NA	NA	NA
AZJ23875.1\|182772_184266_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	9.6e-82	40.0
AZJ23876.1\|185148_185628_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZJ23877.1\|185688_186312_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZJ23878.1\|186374_186959_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZJ23879.1\|187382_188756_-	carboxylic ester hydrolase	NA	NA	NA	NA
AZJ24101.1\|188897_190127_-	aminopeptidase	NA	NA	NA	NA
AZJ23880.1\|190906_192337_-\|transposase	IS4 family transposase	NA	NA	NA	NA
192340:192390	attR	NA	NA	NA	NA

DBSCAN-SWA_9

204316 : 205225

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23890.1\|204316_205225_-	arginase	A0A1V0SJM8	Klosneuvirus	1.7e-33	35.3

DBSCAN-SWA_10

223584 : 223785

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23903.1\|223584_223785_-	cold-shock protein	Q9AZD3	Lactococcus_phage	6.3e-21	72.7

DBSCAN-SWA_11

230654 : 236481

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23909.1\|230654_231020_-	ArpU family transcriptional regulator	A0A1B1P853	Bacillus_phage	2.2e-19	42.5
AZJ23910.1\|232763_232928_+	hypothetical protein	A0A288WGN0	Bacillus_phage	3.8e-08	59.3
AZJ23911.1\|233541_234663_-\|transposase	transposase	S6AND0	Bacillus_phage	1.9e-175	82.0
AZJ23912.1\|234805_235063_-	hypothetical protein	NA	NA	NA	NA
AZJ23913.1\|235755_236019_-	hypothetical protein	A0A0S2GLK4	Bacillus_phage	3.1e-20	60.2
AZJ23914.1\|236015_236303_-	helix-turn-helix domain containing protein	A0A1B1P7W1	Bacillus_phage	1.7e-32	75.8
AZJ23915.1\|236217_236481_-	hypothetical protein	A0A1B1P8D7	Bacillus_phage	1.2e-19	75.0

DBSCAN-SWA_12

251216 : 251879

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23928.1\|251216_251879_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	9.9e-39	39.7

DBSCAN-SWA_13

256996 : 258114

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23935.1\|256996_257368_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	1.3e-19	45.6
AZJ23936.1\|257595_258114_-	Holliday junction resolvase RecU	A0A2H4J3A4	uncultured_Caudovirales_phage	5.6e-45	58.9

DBSCAN-SWA_14

266665 : 267643

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23943.1\|266665_267643_-	RNA polymerase subunit sigma-70	M4SMP8	Cyanophage	3.3e-14	27.0

DBSCAN-SWA_15

292432 : 299143

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23959.1\|292432_294973_+	hypothetical protein	A0A1S5SF64	Streptococcus_phage	2.4e-141	36.6
AZJ23960.1\|294974_295457_+	hypothetical protein	NA	NA	NA	NA
AZJ23961.1\|295489_297877_+	hypothetical protein	NA	NA	NA	NA
AZJ23962.1\|297904_299143_+	lytic transglycosylase	A0A1S5SEZ8	Streptococcus_phage	2.1e-66	44.5

DBSCAN-SWA_16

307401 : 319984

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24105.1\|307401_309354_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.9e-17	28.7
AZJ23970.1\|309573_309795_-	XRE family transcriptional regulator	A0A0S2GLH4	Bacillus_phage	1.1e-10	46.6
AZJ23971.1\|310088_310409_+	hypothetical protein	A0A0S2GLK1	Bacillus_phage	2.6e-29	62.3
AZJ23972.1\|310424_311591_+	cell division protein FtsK	A0A0S2GLG9	Bacillus_phage	3.8e-174	77.3
AZJ24106.1\|311613_312189_+	hypothetical protein	W8CZ47	Bacillus_phage	1.1e-81	74.1
AZJ23973.1\|313213_315028_+	acetyltransferase	B5WZU0	Pseudomonas_phage	1.4e-42	35.4
AZJ23974.1\|315525_315882_+	DUF1093 domain-containing protein	NA	NA	NA	NA
AZJ23975.1\|316272_316920_+	hypothetical protein	A0A223LKM8	Bacillus_phage	1.5e-15	34.3
AZJ23976.1\|317542_318010_-	RsfA family transcriptional regulator	NA	NA	NA	NA
AZJ23977.1\|318343_319984_+	peptidase S8	A0A217EQY2	Bacillus_phage	3.8e-07	23.5

DBSCAN-SWA_17

323973 : 326995

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23981.1\|323973_324189_+	acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	1.3e-19	71.6
AZJ23982.1\|324258_324678_-	hypothetical protein	NA	NA	NA	NA
AZJ23983.1\|325624_326995_+	chitin-binding protein	A7KUU1	Bacillus_phage	1.5e-09	29.2

DBSCAN-SWA_18

331601 : 334037

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23987.1\|331601_332597_+	hypothetical protein	I6R0L8	Salmonella_phage	1.8e-07	32.6
AZJ23988.1\|333278_333491_-	hypothetical protein	NA	NA	NA	NA
AZJ23989.1\|333779_334037_-	hypothetical protein	A0A288WFY7	Bacillus_phage	7.0e-33	92.2

DBSCAN-SWA_19

340724 : 340949

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ23996.1\|340724_340949_+	hypothetical protein	A0A1B1P780	Bacillus_phage	1.5e-26	89.2

DBSCAN-SWA_20

348534 : 351132

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24002.1\|348534_350361_+	asparagine synthase (glutamine-hydrolyzing)	A0A1V0SGM7	Hokovirus	4.9e-35	27.8
AZJ24109.1\|350577_351132_+	N-acetyltransferase	E4ZFP7	Streptococcus_phage	1.2e-24	47.7

DBSCAN-SWA_21

354465 : 358707

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24004.1\|354465_358707_+	peptidase S8	A0A217EQY2	Bacillus_phage	1.2e-15	31.1

DBSCAN-SWA_22

366007 : 367950

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24010.1\|366007_366280_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	6.3e-24	67.8
AZJ24011.1\|366418_366784_-	hypothetical protein	NA	NA	NA	NA
AZJ24012.1\|367524_367950_+	GTP pyrophosphokinase	A0A141E1X8	Streptococcus_phage	1.9e-38	63.4

DBSCAN-SWA_23

373116 : 374537

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24019.1\|373116_373443_-	hypothetical protein	A0A2H4JBB8	uncultured_Caudovirales_phage	4.9e-07	45.6
AZJ24020.1\|373442_374537_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.2e-102	54.4

DBSCAN-SWA_24

396726 : 397968

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24032.1\|396726_397968_+	DNA (cytosine-5-)-methyltransferase	A0A1S5S8U7	Streptococcus_phage	1.9e-30	28.6

DBSCAN-SWA_25

403837 : 410002

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24037.1\|403837_410002_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	4.9e-204	31.6

DBSCAN-SWA_26

413849 : 416408

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24041.1\|413849_416408_+	glycosyl transferase family 2	A0A1V0SAH6	Catovirus	2.6e-10	32.0

DBSCAN-SWA_27

419999 : 431027

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24046.1\|419999_421652_-	aspartate aminotransferase family protein	M1HWX9	Paramecium_bursaria_Chlorella_virus	1.2e-05	33.6
AZJ24047.1\|422135_423062_-	aldo/keto reductase	NA	NA	NA	NA
AZJ24048.1\|423428_431027_+	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	2.9e-166	28.3

DBSCAN-SWA_28

436593 : 437595

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24055.1\|436593_437595_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-23	28.3

DBSCAN-SWA_29

452131 : 453136

Aeropyrum_coil-shaped_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24065.1\|452131_453136_+	hypothetical protein	J7Q326	Aeropyrum_coil-shaped_virus	1.1e-12	35.8

DBSCAN-SWA_30

461411 : 462494

Proteus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24070.1\|461411_462494_+	peptidase U32	A0A249XWF7	Proteus_phage	5.2e-29	28.8

DBSCAN-SWA_31

466744 : 475996

Acinetobacter_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24075.1\|466744_467311_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.8e-41	43.2
AZJ24076.1\|467331_468573_+	hypothetical protein	NA	NA	NA	NA
AZJ24077.1\|469162_469618_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZJ24078.1\|469820_470711_+	3-deoxy-7-phosphoheptulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.6e-15	30.7
AZJ24079.1\|471671_472037_+	hypothetical protein	A0A0K2CYS5	Paenibacillus_phage	3.7e-11	39.5
AZJ24080.1\|472233_472674_+	SMI1/KNR4 family protein	NA	NA	NA	NA
AZJ24081.1\|473121_473703_+	hypothetical protein	NA	NA	NA	NA
AZJ24082.1\|473863_474091_+	hypothetical protein	NA	NA	NA	NA
AZJ24083.1\|474622_474814_-	hypothetical protein	NA	NA	NA	NA
AZJ24084.1\|474922_475996_+	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	2.4e-74	41.8

DBSCAN-SWA_32

483659 : 485087

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24090.1\|483659_485087_-	serine hydrolase	A0A2P1JR59	Mycobacterium_phage	5.2e-08	22.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP024687

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8166 : 77526

Streptococcus_phage(20.0%)

transposase,protease,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24542.1\|8166_9036_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AZJ24543.1\|9594_9945_+	hypothetical protein	NA	NA	NA	NA
AZJ24370.1\|9901_10093_+	hypothetical protein	NA	NA	NA	NA
AZJ24371.1\|10591_14845_+	fusion protein (includes pXO2-28-29-30)	NA	NA	NA	NA
AZJ24372.1\|14863_15238_+	hypothetical protein	NA	NA	NA	NA
AZJ24373.1\|15576_15960_+	hypothetical protein	NA	NA	NA	NA
AZJ24374.1\|15976_17302_+	hypothetical protein	NA	NA	NA	NA
AZJ24375.1\|17319_18153_+	hypothetical protein	NA	NA	NA	NA
AZJ24376.1\|18149_18899_+	hypothetical protein	NA	NA	NA	NA
AZJ24377.1\|18951_19314_+	hypothetical protein	NA	NA	NA	NA
AZJ24378.1\|19498_19795_+	hypothetical protein	NA	NA	NA	NA
AZJ24379.1\|19812_20091_+	hypothetical protein	NA	NA	NA	NA
AZJ24380.1\|20175_22101_+	hypothetical protein	NA	NA	NA	NA
AZJ24381.1\|22127_24755_+	conjugal transfer protein	NA	NA	NA	NA
AZJ24382.1\|24785_28157_+	hypothetical protein	NA	NA	NA	NA
AZJ24383.1\|28153_28432_+	hypothetical protein	NA	NA	NA	NA
AZJ24384.1\|28428_28638_+	hypothetical protein	NA	NA	NA	NA
AZJ24385.1\|28606_29452_+	hypothetical protein	NA	NA	NA	NA
AZJ24386.1\|29555_29870_+	hypothetical protein	NA	NA	NA	NA
AZJ24544.1\|29932_30601_+	hypothetical protein	NA	NA	NA	NA
AZJ24387.1\|30617_32555_+	ATP-binding protein	NA	NA	NA	NA
AZJ24388.1\|32556_33690_+	lysozyme	A0A1S5SEZ8	Streptococcus_phage	3.3e-50	36.0
AZJ24389.1\|33712_34321_+	hypothetical protein	NA	NA	NA	NA
AZJ24390.1\|34409_34685_+	hypothetical protein	NA	NA	NA	NA
AZJ24391.1\|34681_35539_+	hypothetical protein	NA	NA	NA	NA
AZJ24392.1\|35817_36105_+	hypothetical protein	NA	NA	NA	NA
AZJ24393.1\|36116_36725_+	hypothetical protein	NA	NA	NA	NA
AZJ24394.1\|36743_38300_+	hypothetical protein	NA	NA	NA	NA
AZJ24395.1\|38365_39847_+	hypothetical protein	NA	NA	NA	NA
AZJ24396.1\|39921_40350_+	hypothetical protein	NA	NA	NA	NA
AZJ24397.1\|40417_40894_+	hypothetical protein	NA	NA	NA	NA
AZJ24398.1\|40913_41342_+	hypothetical protein	NA	NA	NA	NA
AZJ24399.1\|41392_47626_+	helicase SNF2	A0A248SL14	Klebsiella_phage	1.4e-270	35.3
AZJ24400.1\|47653_48028_+	hypothetical protein	NA	NA	NA	NA
AZJ24401.1\|48098_49082_+	hypothetical protein	NA	NA	NA	NA
AZJ24402.1\|49105_49657_+	metal-dependent hydrolase	NA	NA	NA	NA
AZJ24403.1\|49736_50762_+	hypothetical protein	NA	NA	NA	NA
AZJ24404.1\|51012_51585_+	type III toxin-antitoxin system ToxN/AbiQ family toxin	NA	NA	NA	NA
AZJ24405.1\|51773_53921_+	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.9e-107	44.6
AZJ24406.1\|53973_54324_+	hypothetical protein	NA	NA	NA	NA
AZJ24545.1\|54467_54905_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZJ24407.1\|54955_55189_-	hypothetical protein	NA	NA	NA	NA
AZJ24546.1\|55847_57221_+\|transposase	IS21 family transposase ISSau9	NA	NA	NA	NA
AZJ24408.1\|57220_57973_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	4.0e-36	34.5
AZJ24409.1\|58121_59108_-\|integrase	integrase	A0A1B1P793	Bacillus_phage	4.5e-35	34.5
AZJ24410.1\|59085_59703_-	DNA recombinase	A0A1V0E035	Clostridioides_phage	6.1e-14	30.9
AZJ24411.1\|60276_60987_-	hypothetical protein	NA	NA	NA	NA
AZJ24412.1\|61607_62681_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.1e-78	44.2
AZJ24413.1\|63385_63631_+	hypothetical protein	NA	NA	NA	NA
AZJ24414.1\|64587_64962_-	hypothetical protein	D2XQ01	Bacillus_virus	1.2e-25	44.4
AZJ24415.1\|65008_65356_-	YolD-like family protein	NA	NA	NA	NA
AZJ24416.1\|65757_66351_+	hypothetical protein	A0A1Z1LZN4	Bacillus_phage	6.7e-10	34.1
AZJ24417.1\|66347_66545_+	hypothetical protein	NA	NA	NA	NA
AZJ24418.1\|66862_68503_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZJ24419.1\|70049_71483_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AZJ24420.1\|72699_76215_-	hypothetical protein	NA	NA	NA	NA
AZJ24421.1\|76818_77526_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9

DBSCAN-SWA_2

82883 : 161200

Escherichia_phage(38.1%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24424.1\|82883_83591_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24425.1\|84228_85731_-	hypothetical protein	NA	NA	NA	NA
AZJ24426.1\|86483_87191_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24427.1\|89474_90182_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24428.1\|90726_91092_+	hypothetical protein	NA	NA	NA	NA
AZJ24429.1\|91254_91461_+	hypothetical protein	NA	NA	NA	NA
AZJ24430.1\|92811_93519_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24431.1\|93813_94410_+	hypothetical protein	NA	NA	NA	NA
AZJ24432.1\|95120_95384_-	hypothetical protein	NA	NA	NA	NA
AZJ24433.1\|95839_96997_-	hypothetical protein	NA	NA	NA	NA
AZJ24434.1\|98205_98466_-	hypothetical protein	NA	NA	NA	NA
AZJ24435.1\|98794_99502_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24436.1\|101071_101338_+	hypothetical protein	NA	NA	NA	NA
AZJ24437.1\|101381_101609_+	hypothetical protein	NA	NA	NA	NA
AZJ24438.1\|101705_102713_-	capsular biosynthesis protein CpsI	A0A2K9L0I7	Tupanvirus	3.6e-40	34.5
AZJ24439.1\|103235_104393_-	hypothetical protein	NA	NA	NA	NA
AZJ24440.1\|104425_105766_-	colanic acid biosynthesis glycosyltransferase WcaL	NA	NA	NA	NA
AZJ24547.1\|107213_108524_-	UDP-glucose 6-dehydrogenase	A0A127AXI2	Bacillus_phage	3.8e-90	41.9
AZJ24441.1\|108525_109434_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	7.9e-79	55.4
AZJ24442.1\|110129_110483_+	hypothetical protein	NA	NA	NA	NA
AZJ24443.1\|113303_115379_-	hypothetical protein	NA	NA	NA	NA
AZJ24444.1\|115708_116416_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24445.1\|116850_118293_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZJ24446.1\|118418_119318_+	kinase	NA	NA	NA	NA
AZJ24447.1\|119365_120073_+\|tRNA	alanyl-tRNA editing protein	NA	NA	NA	NA
AZJ24448.1\|120380_121418_+	pyridoxal-5'-phosphate-dependent protein	A0A1W6JHY1	Lactococcus_phage	1.1e-39	35.4
AZJ24449.1\|121451_122636_+	cystathionine beta-lyase	NA	NA	NA	NA
AZJ24450.1\|123027_123927_+	EamA family transporter	NA	NA	NA	NA
AZJ24548.1\|124218_124362_-	hypothetical protein	NA	NA	NA	NA
AZJ24451.1\|124469_124751_+	AbrB family transcriptional regulator	A0A2I7SC16	Paenibacillus_phage	8.8e-13	63.9
AZJ24452.1\|124772_125006_+	RNA chaperone Hfq	NA	NA	NA	NA
AZJ24453.1\|125058_125337_-	DNA-binding protein	A7KV42	Bacillus_phage	5.1e-21	62.2
AZJ24454.1\|125487_125778_+	transcriptional regulator	A0A218MNF3	uncultured_virus	1.1e-05	39.1
AZJ24455.1\|125847_126156_+	50S ribosomal protein L7ae	NA	NA	NA	NA
AZJ24456.1\|126522_127440_+	ATPase	NA	NA	NA	NA
AZJ24457.1\|128059_128632_-	resolvase	M9Q1K0	Clostridium_phage	2.1e-24	36.0
AZJ24458.1\|128942_130004_+	hypothetical protein	NA	NA	NA	NA
AZJ24459.1\|130177_132475_+	hypothetical protein	NA	NA	NA	NA
AZJ24460.1\|132546_133419_+	hypothetical protein	NA	NA	NA	NA
AZJ24461.1\|136410_136791_-\|transposase	transposase	NA	NA	NA	NA
AZJ24549.1\|138509_139379_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AZJ24550.1\|139981_141355_+\|transposase	IS21 family transposase ISSau9	NA	NA	NA	NA
AZJ24462.1\|141354_142107_+	AAA family ATPase	A0A059NT77	Lactococcus_phage	4.0e-36	34.5
AZJ24463.1\|142258_143341_-\|transposase	transposase	A0A1B1IQT7	uncultured_Mediterranean_phage	6.9e-05	23.5
AZJ24464.1\|143700_145767_+	hypothetical protein	NA	NA	NA	NA
AZJ24465.1\|145834_147508_+	pesticidial crystal protein	NA	NA	NA	NA
AZJ24466.1\|149445_150153_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24467.1\|150486_151902_+	tyrosine phenol-lyase	NA	NA	NA	NA
AZJ24468.1\|151898_153140_+	transporter	NA	NA	NA	NA
AZJ24469.1\|153325_154627_+	tryptophan halogenase	NA	NA	NA	NA
AZJ24470.1\|154805_155357_-	DNA invertase	A0A0C4UR34	Shigella_phage	2.2e-39	49.4
AZJ24471.1\|155599_156307_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24472.1\|157631_158195_+	hypothetical protein	NA	NA	NA	NA
AZJ24551.1\|158313_158493_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	6.8e-19	77.6
AZJ24473.1\|158651_158951_+	hypothetical protein	NA	NA	NA	NA
AZJ24474.1\|159070_159400_+	DeoR family transcriptional regulator	NA	NA	NA	NA
AZJ24475.1\|160492_161200_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.7e-39	43.9

DBSCAN-SWA_3

166610 : 226746

Bacillus_phage(40.0%)

transposase,integrase

attL 194652:194711|attR 218825:219820

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZJ24479.1\|166610_167318_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.7e-39	43.9
AZJ24480.1\|167745_168015_-	hypothetical protein	H0USV6	Bacillus_phage	1.1e-23	63.1
AZJ24481.1\|168446_169364_-	hypothetical protein	NA	NA	NA	NA
AZJ24552.1\|171665_172535_-\|transposase	ISNCY family transposase	NA	NA	NA	NA
AZJ24482.1\|172772_174200_+	collagen-like protein	NA	NA	NA	NA
AZJ24483.1\|174525_174786_-	DNA-binding protein	NA	NA	NA	NA
AZJ24484.1\|175609_176317_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24485.1\|181070_181778_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24486.1\|182784_184134_+	YVTN family beta-propeller repeat-containing protein	NA	NA	NA	NA
AZJ24487.1\|184322_185399_+	hypothetical protein	NA	NA	NA	NA
AZJ24488.1\|186437_187145_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24553.1\|187214_188594_-\|transposase	IS21 family transposase ISSau9	NA	NA	NA	NA
AZJ24489.1\|189078_189642_-	resolvase	A0A219Y9V9	Aeromonas_phage	1.3e-31	41.2
AZJ24490.1\|192058_192748_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.1e-69	58.4
AZJ24491.1\|193292_194273_-	hypothetical protein	NA	NA	NA	NA
194652:194711	attL	NA	NA	NA	NA
AZJ24492.1\|195807_196497_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.5e-69	57.9
AZJ24493.1\|198739_198949_-	preprotein translocase	NA	NA	NA	NA
AZJ24494.1\|199253_199868_+	hypothetical protein	NA	NA	NA	NA
AZJ24495.1\|200062_201073_+	plasmid segregation protein ParM	A0A2H4IZP5	uncultured_Caudovirales_phage	6.6e-26	27.4
AZJ24496.1\|201062_201302_+	hypothetical protein	NA	NA	NA	NA
AZJ24497.1\|201396_201636_+	hypothetical protein	A0A1B1P789	Bacillus_phage	5.0e-17	52.6
AZJ24498.1\|202194_202386_+	hypothetical protein	NA	NA	NA	NA
AZJ24499.1\|202401_202668_+	hypothetical protein	NA	NA	NA	NA
AZJ24500.1\|203574_203874_-	hypothetical protein	NA	NA	NA	NA
AZJ24554.1\|203964_204159_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P878	Bacillus_phage	5.0e-23	79.4
AZJ24501.1\|205660_205930_-	hypothetical protein	NA	NA	NA	NA
AZJ24502.1\|206314_206719_+	hypothetical protein	NA	NA	NA	NA
AZJ24503.1\|206958_207150_+	hypothetical protein	NA	NA	NA	NA
AZJ24504.1\|207437_209267_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.1e-30	24.8
AZJ24505.1\|209878_210223_+	hypothetical protein	NA	NA	NA	NA
AZJ24506.1\|210268_210679_-	hypothetical protein	NA	NA	NA	NA
AZJ24507.1\|211363_212536_-\|integrase	integrase	A0A142F1N9	Bacillus_phage	2.3e-06	24.4
AZJ24508.1\|213068_213491_+	hypothetical protein	NA	NA	NA	NA
AZJ24509.1\|213575_214016_+	hypothetical protein	NA	NA	NA	NA
AZJ24510.1\|214724_215432_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9
AZJ24511.1\|215556_215922_+	hypothetical protein	A0A0S2MVJ1	Bacillus_phage	2.5e-52	78.2
AZJ24512.1\|215918_216500_+	dUTPase	A0A0S2MVD0	Bacillus_phage	2.1e-93	82.9
AZJ24513.1\|216539_217196_+	hypothetical protein	A0A0A7AR03	Bacillus_phage	2.3e-35	63.6
AZJ24555.1\|220811_221003_+	hypothetical protein	NA	NA	NA	NA
218825:219820	attR	NA	NA	NA	NA
AZJ24514.1\|221021_221396_+	hypothetical protein	NA	NA	NA	NA
AZJ24515.1\|221915_222173_+	hypothetical protein	NA	NA	NA	NA
AZJ24516.1\|222361_222556_+	hypothetical protein	NA	NA	NA	NA
AZJ24517.1\|222805_223336_+	Holliday junction resolvase RecU	A0A1C8E9C3	Bacillus_phage	1.5e-77	82.4
AZJ24518.1\|223335_223680_+	hypothetical protein	A0A2H4JAV2	uncultured_Caudovirales_phage	5.7e-22	45.8
AZJ24519.1\|224798_225023_+	hypothetical protein	NA	NA	NA	NA
AZJ24520.1\|226038_226746_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-46	47.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP024686

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP024684

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP024689

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP024685

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. CP024687

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection