CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP024708	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH1, complete sequence	0 crisprs	NA	1
CP024707	Klebsiella pneumoniae strain cr-hvkp3 chromosome, complete genome	1 crisprs	RT,csa3,cas3,DEDDh,DinG,WYL	3
CP024709	Klebsiella pneumoniae strain cr-hvkp3 plasmid pPUTH2, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

97703 : 162546

Salmonella_phage(20.0%)

integrase,transposase

attL 97672:97731|attR 159951:161006

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
97672:97731	attL	NA	NA	NA	NA
AZL03984.1\|97703_98672_+\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
AZL03985.1\|99453_99939_+	hypothetical protein	NA	NA	NA	NA
AZL03986.1\|101397_101898_-	transcriptional repressor	NA	NA	NA	NA
AZL03987.1\|102042_102444_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
AZL03988.1\|102480_103701_+	GTP-binding protein	NA	NA	NA	NA
AZL03989.1\|103761_103968_-	hypothetical protein	NA	NA	NA	NA
AZL03990.1\|103970_105620_-	ferrous iron transporter B	NA	NA	NA	NA
AZL03991.1\|105631_106762_-	thioredoxin reductase	NA	NA	NA	NA
AZL03992.1\|108293_108746_-	transcriptional repressor	NA	NA	NA	NA
AZL03993.1\|108843_110043_+	cobalamin biosynthesis protein CobW	NA	NA	NA	NA
AZL03994.1\|110113_110536_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
AZL03995.1\|110599_111535_+	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
AZL03996.1\|111524_112085_+	carbonate dehydratase	NA	NA	NA	NA
AZL03997.1\|112151_113081_+	isocitrate dehydrogenase	A0A140B3P3	Vibrio_phage	1.5e-11	25.2
AZL03998.1\|113097_113922_-	DUF1460 domain-containing protein	NA	NA	NA	NA
AZL03999.1\|114372_115374_+	hypothetical protein	A0A2K9L6B6	Tupanvirus	9.7e-54	41.5
AZL04000.1\|115366_116218_+	hypothetical protein	NA	NA	NA	NA
AZL04001.1\|116214_117561_+	dihydroorotase	NA	NA	NA	NA
AZL04002.1\|117624_118647_+	porphobilinogen synthase	NA	NA	NA	NA
AZL04003.1\|120860_121343_-	N-acetyltransferase	NA	NA	NA	NA
AZL04004.1\|121330_121597_-	DUF1778 domain-containing protein	NA	NA	NA	NA
AZL04005.1\|121791_122022_-	hypothetical protein	NA	NA	NA	NA
AZL04006.1\|122035_122239_-	hemolysin expression modulator Hha	NA	NA	NA	NA
AZL04007.1\|122299_122794_-	DNA-binding protein	NA	NA	NA	NA
AZL04008.1\|122835_125805_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.3
AZL04009.1\|125807_126365_-\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	2.6e-48	81.3
AZL04010.1\|126494_127571_-	signal peptidase II	NA	NA	NA	NA
AZL04011.1\|127567_129973_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.0e-141	46.1
AZL04012.1\|130058_130493_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AZL04013.1\|130788_132189_-	sensor histidine kinase	W8CYF6	Bacillus_phage	4.1e-18	26.3
AZL04014.1\|132185_132866_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AZL04015.1\|132920_133850_-	copper resistance protein CopD	NA	NA	NA	NA
AZL04016.1\|133854_134235_-	copper resistance system chaperone PcoC	NA	NA	NA	NA
AZL04017.1\|134274_135171_-	copper resistance protein B	NA	NA	NA	NA
AZL04018.1\|135170_136988_-	multicopper oxidase PcoA	NA	NA	NA	NA
AZL04019.1\|137221_137671_+	copper resistance protein	NA	NA	NA	NA
AZL04020.1\|137959_138697_+	peptidase M23	A0A2H4JAF5	uncultured_Caudovirales_phage	1.2e-11	32.5
AZL04021.1\|138730_138928_-	DUF2933 domain-containing protein	NA	NA	NA	NA
AZL04022.1\|138968_141416_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	7.6e-84	35.8
AZL04023.1\|141542_141983_-	hypothetical protein	NA	NA	NA	NA
AZL04024.1\|142069_145216_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	4.0e-61	22.5
AZL04025.1\|145226_146519_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZL04026.1\|146632_146995_-	copper ABC transporter substrate-binding protein	NA	NA	NA	NA
AZL04027.1\|147023_148409_-	hypothetical protein	NA	NA	NA	NA
AZL04028.1\|148598_149279_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.3e-30	35.7
AZL04029.1\|149271_150747_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.0e-27	30.1
AZL04030.1\|150997_151429_+	silver-binding protein SilE	NA	NA	NA	NA
AZL04031.1\|151572_151923_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	3.2e-20	53.3
AZL04108.1\|152309_153218_-	HNH endonuclease	NA	NA	NA	NA
AZL04032.1\|153854_154829_+	sensor domain-containing diguanylate cyclase	NA	NA	NA	NA
AZL04109.1\|155761_156574_+	hypothetical protein	NA	NA	NA	NA
AZL04033.1\|156570_157350_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	6.0e-51	89.4
AZL04110.1\|157494_158424_-\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	5.6e-72	52.4
AZL04034.1\|158736_158895_+	hypothetical protein	A0A0U2RK18	Escherichia_phage	2.2e-05	69.7
AZL04035.1\|159009_159978_-\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	2.2e-172	91.3
AZL04036.1\|159997_160678_+	amidase	NA	NA	NA	NA
AZL04111.1\|160870_161716_+	ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	1.9e-10	26.0
159951:161006	attR	NA	NA	NA	NA
AZL04037.1\|161712_162546_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-10	29.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP024707

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP024707_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP024707_1

2412957-2413056

Orphan

Consensus_repeat	Method
GCTGCGCCTTACCGGGCCTACGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP024707_1

>merge|CP024707|1|2412957-2413056|CRISPRCasFinder
GCTGCGCCTTACCGGGCCTACGAACTCGACAGGAAGCGGAAGGGCTGCAGGCTATGCAGTTCGAGGCCGCTGCAAGCGCCGCGCCTTACCGGGCCTACGA

>CP024707|1|1|2412957-2413056|CRISPRCasFinder
GCTGCGCCTTACCGGGCCTACGA	ACTCGACAGGAAGCGGAAGGGCTGCAGGCTATGCAGTTCGAGGCCGCTGCAAGC
GCCGCGCCTTACCGGGCCTACGA

Protein	Signature genes	Signature genes Name	Protein_function
CP024707.1\|AZL00979.1\|2416656_2417682_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP024707.1\|AZL00982.1\|2419694_2420597_+\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
CP024707.1\|AZL00978.1\|2415838_2416660_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
CP024707.1\|AZL00970.1\|2405113_2405716_-\|cysteine-dioxygenase	unknown	unknown	gnl\|CDD\|227840
CP024707.1\|AZL00983.1\|2420689_2421457_+\|basic-amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270342
CP024707.1\|AZL03750.1\|2422271_2422994_+\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
CP024707.1\|AZL00971.1\|2405822_2406716_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
CP024707.1\|AZL00975.1\|2411076_2412072_+\|sulfonate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
CP024707.1\|AZL00980.1\|2417678_2418731_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP024707.1\|AZL00972.1\|2406860_2407946_+\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|238527
CP024707.1\|AZL00974.1\|2410058_2411096_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|223787
CP024707.1\|AZL00981.1\|2418744_2419698_+\|preprotein-translocase-YidC	unknown	unknown	gnl\|CDD\|238566
CP024707.1\|AZL00968.1\|2402789_2403515_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319354
CP024707.1\|AZL00976.1\|2412065_2412839_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
CP024707.1\|AZL00977.1\|2413260_2415333_-\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|273805
CP024707.1\|AZL00985.1\|2423265_2423880_+\|DUF1062-domain-containing-protein	unknown	unknown	gnl\|CDD\|226782
CP024707.1\|AZL00969.1\|2403527_2405108_-\|sulfurtransferase	unknown	unknown	gnl\|CDD\|238793
CP024707.1\|AZL00973.1\|2409099_2410062_+\|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270276
CP024707.1\|AZL00984.1\|2421520_2422285_+\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
CP024707.1\|AZL03749.1\|2407999_2409094_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|224871

Protein	Function_ID	Function_description	E-value
CP024707.1\|AZL00979.1\|2416656_2417682_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	8.28878e-70
CP024707.1\|AZL00982.1\|2419694_2420597_+\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.17453e-48
CP024707.1\|AZL00978.1\|2415838_2416660_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.00519e-119
CP024707.1\|AZL00970.1\|2405113_2405716_-\|cysteine-dioxygenase	gnl\|CDD\|227840	COG5553, COG5553, Predicted metal-dependent enzyme of the double-stranded beta helix superfamily [General function prediction only].	2.22933e-53
CP024707.1\|AZL00983.1\|2420689_2421457_+\|basic-amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270342	cd13624, PBP2_Arg_Lys_His, Substrate binding domain of the arginine-, lysine-, histidine-binding protein ArtJ; the type 2 periplasmic binding protein fold. This group includes the periplasmic substrate-binding protein ArtJ of the ATP-binding cassette (ABC) transport system from the thermophilic bacterium Geobacillus stearothermophilus, which is specific for arginine, lysine, and histidine. ArtJ belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.97659e-96
CP024707.1\|AZL03750.1\|2422271_2422994_+\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	1.12708e-151
CP024707.1\|AZL00971.1\|2405822_2406716_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	3.98053e-36
CP024707.1\|AZL00975.1\|2411076_2412072_+\|sulfonate-ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	1.36619e-38
CP024707.1\|AZL00980.1\|2417678_2418731_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	8.12766e-70
CP024707.1\|AZL00972.1\|2406860_2407946_+\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|238527	cd01094, Alkanesulfonate_monoxygenase, Alkanesulfonate monoxygenase is the monoxygenase of a two-component system that catalyzes the conversion of alkanesulfonates to the corresponding aldehyde and sulfite. Alkanesulfonate monoxygenase (SsuD) has an absolute requirement for reduced flavin mononucleotide (FMNH2), which is provided by the NADPH-dependent FMN oxidoreductase (SsuE).	1.09183e-91
CP024707.1\|AZL00974.1\|2410058_2411096_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|223787	COG0715, TauA, ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism].	1.59826e-27
CP024707.1\|AZL00981.1\|2418744_2419698_+\|preprotein-translocase-YidC	gnl\|CDD\|238566	cd01146, FhuD, Fe3+-siderophore binding domain FhuD. These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.	5.66347e-44
CP024707.1\|AZL00968.1\|2402789_2403515_+\|hypothetical-protein	gnl\|CDD\|319354	cd16833, YfiH, protein of unknown function YfiH. This subfamily contains YfiH, a protein of unknown function from Shigella flexneri, E. coli, and many similar proteins which collectively are often called DUF152. The structure of YfiH reveals a distant homology to Rho-activating toxins cytotoxic necrotizing factor 1 (CNF1) as well as chemotaxis protein CheD that stimulates methylation of methyl-accepting chemotaxis proteins (MCPs), all having an invariant Cys-His pair forming a catalytic dyad, and is required by the CNF-1 toxins for deamidation activity.	4.58134e-50
CP024707.1\|AZL00976.1\|2412065_2412839_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	1.04308e-109
CP024707.1\|AZL00977.1\|2413260_2415333_-\|TonB-dependent-siderophore-receptor	gnl\|CDD\|273805	TIGR01783, Ferrienterobactin_receptor, TonB-dependent siderophore receptor. This subfamily model encompasses a wide variety of TonB-dependent outer membrane siderophore receptors. It has no overlap with TonB receptors known to transport other substances, but is likely incomplete due to lack of characterizations. It is likely that genuine siderophore receptors will be identified which score below the noise cutoff to this model at which point the model should be updated. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.53227e-100
CP024707.1\|AZL00985.1\|2423265_2423880_+\|DUF1062-domain-containing-protein	gnl\|CDD\|226782	COG4332, COG4332, Uncharacterized protein conserved in bacteria [Function unknown].	8.76061e-71
CP024707.1\|AZL00969.1\|2403527_2405108_-\|sulfurtransferase	gnl\|CDD\|238793	cd01535, 4RHOD_Repeat_4, Member of the Rhodanese Homology Domain superfamily, repeat 4. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 4th repeat which, in general, contains the putative catalytic Cys residue.	2.79233e-65
CP024707.1\|AZL00973.1\|2409099_2410062_+\|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270276	cd13558, PBP2_SsuA_like_2, Putative substrate binding domain of sulfonate binding protein, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	3.47757e-105
CP024707.1\|AZL00984.1\|2421520_2422285_+\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	6.5599e-78
CP024707.1\|AZL03749.1\|2407999_2409094_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	6.17908e-50

>CP024707.1|AZL00976.1|2412065_2412839_+|ABC-transporter-ATP-binding-protein
MVTETIARGAAVSISHLHHAFTLGKQTVPVLENISLQLRPGESVALLGPSGCGKSTLLRLLAGLEAPQSGQMQIDGAALGAPGPERILVFQDPTLYPWLTVRQNVLLGPQAQGKKGLEAKADALIDRIGLQAFSEAWPRQLSGGMAQRAALARALLNEPRLLLLDEPLGKLDSLTRISMQRELIALWQQQGYTSLLVTHDIEEALLLCERVLVMSPRPGRIIAEFALPLAFPRHRDNPQLLQHRQDILRILGQEADW
>CP024707.1|AZL00975.1|2411076_2412072_+|sulfonate-ABC-transporter-permease
MPTYSPEQALARPTGRAPLWGEGLLAATLWLLGGLFTLTWPDAGRRWPFSEGWALAQFTLGGGLLLLALSYRYWRARGARVLHAGKWLALLPVLFAVWEGLTAKTAVLPVPFFAPPQALIEVLHDDWPRLLDSLLHSLGLLGLGVLLGTSSGFITGLAIGWSQRIGYWVHPVLRLLGPVPSTALLPLCLFIFPSSFGASVFLIALSTWFPVTVLTWSGVMGIDKAWYDVARTLGASQRFLILRVAIPAALPNVFVGLFMGLGASFSVLIVAEMVGVKSGIGFYLQWAQGWAAYPNMYAALLVMALLCSGLISGLFMLRDRLLSWQRGGMQW
>CP024707.1|AZL00974.1|2410058_2411096_+|ABC-transporter-substrate-binding-protein
MTRTPFSRRRFLQLSGGLALAGVSLPLWAHDMADMAGGDTHPALRLPQPYKIKLAINKSAVCLAPVAVAEQQKIFSKYNLDVEFVNFGNSTDVLLEAIATGKADAGVGMALRWLKALEQGFDVKLTAGTHGGCLNLLTAKDSPFGGLESLKGQTIGVTDMAGPDKNFFAILLKRHGIDPISDVQWKVYPADLLSVALDKREIAAISGSEPFSYRLLETGKYQLIASNMTGDYANLSCCVLGVSGSLARDHKPAAAALTQAILEAHSYAAAHPESVAQSFLAHALNTSEAEVSGILHGQGHGHHAVGEAFVKELTQYAVDLQRVQVIKPGTDPHQFAESIYANVFA
>CP024707.1|AZL00973.1|2409099_2410062_+|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein
MRLSFSGRVAAALMLLALGGYATAQERLTLRIADQKGGMRSQLEAANALQNLPYDIKWAEFPAAAPLAEALNAGAVDAGIIGDAPLLFALANGAPVKAIAVDKSNPAGTAVLVSPGSTLKSGADLKGKRIATGKGSIGHFVALKALEQAGISPKEVQWVFLGPVDAKVALLNGSVDAWATWEPYTTQMVKTNEGQILVSGKGLLPGNTFLAATDSALNDPQKRAALQDYLQRLAGAERWAYANLDSYGKTLGEIIRFPAEIARAQFANRQSQWQPLAEETVAQQQATADFYLANGLIRTRLDVKPTFDRRFSVPAAEVTP
>CP024707.1|AZL03749.1|2407999_2409094_+|acyl-CoA-dehydrogenase
MAEQAASLDASGEFPWRNIDHLRAGGWLSLAVPPSCGGAGASLAQLQQVIAAIAWGEPATALIVCMQYLHHLRLAENDAWHAPLRQQVFHDAVEHGGLINSLRVEPELGSPARGGLPDTVATRRAEGWDISGHKINTTGIEGLRWLAVWARSDDNPPLVGTWLVPGDSPGITVVKSWDHAGMRATGSHEVIFNHVRVAAEHAVDVWPADAPPAAQAEPFRLFANRQTALLAAIYDSIAHAAHDWLVRWLAGRVPAGLGHPLSRLPRVQEKVGQIAGLLLVNRSLLEQAAALRFSAIEANLAKVTITDNAIQAVNIALELTGNHGLSRQNPLERHYRNVLCGRVHTPQSDSAWLAAGNFVFQSQG
>CP024707.1|AZL00972.1|2406860_2407946_+|LLM-class-flavin-dependent-oxidoreductase
MSIQFLGMIGHRLSSETIAPVGPIFDRDYIVRFAQTHEAAGFDRLLVGHWSDQPDGFLVTALAGLSTQKIQYLLAHRPGFVSPTLAARKFATLEHLLGGRLAVHIISGGNDAEQRRDGDYLDHDQRYARTDAFLDTVRQVWTSEQPVDIHNDFYQAEQAWSAIRPLQKPHLPIYFGGSSEAAITVAGKHADVFALWGESLAQTGETIQRVRAEAAKHQRDIGFSVSFRPIIADSEAEAWEKAEHILHVATEQAAQRGGGFKAKPDSIGAQRLRATAAQGRVVDKRLWTGIAQLVGGGHNSTALVGTPEQVADALLDYYDLGVRNFLIRGFDPLNDAADYGRALLPIAREKAARRAVAERAS
>CP024707.1|AZL00971.1|2405822_2406716_+|LysR-family-transcriptional-regulator
MRIDDIDALLATVQFSSLNQAAEYLGITQSAITRRLQRLEQELNVTLLERQTRPLTLTAAGHRVYEQCLSIKRETKKLYSLLDPEGEPRGALRLGVPQSLSEIALPAALSALSQQFPGLSPQITCGWSGQLQRRLENGELDGMLAMGPAQQSFAESYSGRLLCPLEVVPIVGRRLNLRASSLRECAERGWILNPDGCGLRAGLIRELQSQGLRLTLNVESAGAQLQIALVAQGLGLGLVPRAALASSPWRDEIAVLSLSDFQPAVSLWLIHAQYLANLQPPLTFFASKVVQQLTVSD
>CP024707.1|AZL00970.1|2405113_2405716_-|cysteine-dioxygenase
MTAPRLEKLRHFIHEVDRLHREHHQTAPLLDAVAQRLAALVRYDDWLPEEYTLPHPHHYQQYLLHADSGERFSIVSFVWGPGQATPIHDHRVWGAIGMLRGAEENQRYQLDADGIPRALGAATLLEAGQVEKVSADDGDIHRVSNALADRVSISIHVYGGNIGAVKRAVYTPEGQQKPFISGYSNRHLPNIWDSSREHQG
>CP024707.1|AZL00969.1|2403527_2405108_-|sulfurtransferase
MPTYAYRQAAGIRQALLDRRELALIDVREEADFATAHPLFAVNLPLSKLELEVRRRIPRFTTPLTVYDNGEGLAEIAVERLRSWGYQDVALLAEGLAGWRRSGGELFQDVNSASKAFGELVESVRHTPSLSAQEVQALIDSRQEVVIVDARRFDEYQTMSIPGSISVPGGELALRVESLTPSPQTPVIVNCAGRTRSIIGTQSLINAGVPNPVHALRNGTIGWTLAGQTLAHQQQRQYDPSARASGARAAEVAHFAERAGVAVIDEATLQHWLQQSDRTTFLFDVRSPEEYAAGHYPGSLSAPGGQLVQETDHFASVRGARIVLLDDDGIRAAITGSWLAQMGWETARLSALSTSQLSERGVPAAEVPPGPQAEEISPAQLAQQLEEPGTVVLDFTTSANFVARHIPGAWWLTRSQLRQALEAIPPAQRYVVTCGSSLLARYAVPEVAALTGKPVQLLTGGTLAWIAAGLPLAHGDSGLAVERRDRYRRPYEGTDNSAEAMQAYLEWEYGLVDQLARDGTHGFRVL
>CP024707.1|AZL00968.1|2402789_2403515_+|hypothetical-protein
MAYTSRLLNAIPGIRHAFLDVHETAAFPYAELAPVKLVHGNEVHHYQQPLPTRPHADAVFTAVAGQKVGVVTADCLPLLIASRDGRYVCSVHAGWQGLVSGIVDNSLACFRQQGVALADLVIAVGPHIHPCCYEVSAGFYQQLLDQPGGDRVARHRQRLFHSRSGPVSDPLKAAARGSDNLWFDLRAFAEAIFAEAGVAPASVEWLGSCTYCTPQSLGSYRRRTHFPAPKSFQYSWIMREA
>CP024707.1|AZL00977.1|2413260_2415333_-|TonB-dependent-siderophore-receptor
MAADNRAAKSTNDAEETITVVADGAQQSATSGYQPLSSATATLTSMPLLDIPQVVNTVSDRVLEDQHATSLDEALYNVANVVQTNTLGGTQDAFTRRGFGANRDGSIMTNGLRTVLPRSFNAATERVEVLKGPASTLYGILDPGGLINVITKRPERQFSGSVSGTSTSFGGGTGSVDITGPIEGTNLAYRLIGEYQNEDYWRNFGKNKSSFIAPSLTWFGERATVTASYSHRDYSAPFDRGTIFDLNTGHAVNVDRKTRFDEAFNITDGYSDLAQLNAEYRLNDAWTARFDYSYSQDHYNDNQARVMAYDSATGNLTRRVDGTHGSTQKMHSTRADLQGNVVVGGFYNELLTGVAYENYDLLRTDMLRCKNVKGFNIYHPVYGTLDTCNTVSASDSDQRIQQESYAAYVQDALYLTDNWIAVAGVRYQYYTQYAGKGRPFNVNTDSRDEKWTPKAGLVYKVTPNVSLFANVAQSFMPQSSIASYIGELPPEESTSYEVGAKFDLLNGITANIALFDIHKRNVLYTESIGDETVAKTAGKVRSQGVEVDLAGSITDNLSVIASYGYTDAKVLEDPDYAGKPLPNVPKHTGSLFLTYDIHNVYNSNTLTVGGGGHAVSKRSGTNGADYYLQGYAVADVFAAYKMKLQYPVTLQVNVKNLFDKTYYTSSIGTNNLGNQIGDPREVQFTVKMDF
>CP024707.1|AZL00978.1|2415838_2416660_+|ABC-transporter-ATP-binding-protein
MPQRVKPAEQGIVLDALSAGYGQTLIVDDINLTIPTGKMTVLAGANGSGKSTLLSTIARMLKPLGGCVRLDGQAIHQMPTKTVSRQLGILPQSPLTPEGLTVFELVSRGRYPWQGLMRQWSEADELAVEEALRLTGTAEFAHLPVDSLSGGQRQRCWIAMALAQQTATILLDEPTTWLDLRYQVDILELLQTLTREHGRTVVTVLHDLNFAVNYADLLVFLKQGRIAGTISDNDVCSPELIKRVFDVDVQMSINPQTGKPFFMPFRARQAAAQ
>CP024707.1|AZL00979.1|2416656_2417682_+|iron-ABC-transporter-permease
MSVAILLSARRRPRPRLALLLLTLLLIAASLVHLGLGARWIAPQTVLQALLEYDPRNFEQRIIIDLRLVRLAAALLTGAALGVAGLLLQTVIRNPLGEPHILGLNAGASLAVVATSALGLSLGAFPAGRPLTAACGAGLLFGGVMALASAGRGGATPLRITLCGVALSGFASAVTAAILILDEQTLLAMRTWLAGDLAGLNWSTLQTALVPALIGLGVALLIAPRLNVLALGDKVALGLGVNLVQTRLLGLLAIALLCGAAVAVAGPIGFVGLVVPHVVRRLVTEDIRLALPLAAPVGALALVLADIAARTLVAPQELATGAMTALVGAPLFIFIAARFFK
>CP024707.1|AZL00980.1|2417678_2418731_+|iron-ABC-transporter-permease
MTRAVHRAGFRPLAFASRHLLLRPAALKIAASIVLTLLALGLYSLSRGSYPLPASTLARALLAPQEMGEQPRFILFDIRLPRILMALLCGAMLGLAGAAMQSITRNGLADPGLIGVKEGASIVVLALVLFFPAVGLVWRPLAGMVGGIAVALLVLTLARDCSRPRFILIGIGVSWSLAAAVGIFMTTADVRDVQTAMIWLAGSLQTATWPLLAVAFCWALPGAIILFCTARAADVALLGDRTAVGLGVRLQQLTVLRFFAPVLLTSASVSCVGSLGFVGLMAPHMARFVLRGGQVSLLCGSALIGALLVLATDTLGRLAFAPLQIPAGIVIALVGCPFFVVLLWRRRDAL
>CP024707.1|AZL00981.1|2418744_2419698_+|preprotein-translocase-YidC
MRWFVSLLLLLTGAVSAAAPQTQTFTDDLGRTVTVPLHPQRIVSMHDLDITIPLIELGAPPIASHGRTRPDGSHYLRSSAQLTGVDFDNSDIRFIGTADIDLEAVAAARPDLIITEPSRHVSVEQLEKIAPTVSIDHLQGSAPEIYRKLAQLTGTQPRLAILERRYQEQIKQLKAMVNPPQYSVSVIQANNGKVTVHHSYHALGRVLRDAGFRFPPLIERIPDGQRIDVSAEQLPELDADFVFATWRSDTGGKPQDELQAMEGVMPGWCDFMRACRTGHYILLPREEVISNSYAALSLMVAQVQSHIAGRPIPAEAK
>CP024707.1|AZL00982.1|2419694_2420597_+|MurR/RpiR-family-transcriptional-regulator
MKSAVKKEKGKVDLFGERYRARAHQLSPRLRAVVSYINDNREVVLEHTAMEIATATQTSDATVVRAIQALGFAGLRELKQTMERWFGTSVTSAEKMRSTVTALSSDVNSSIDFVLEGHQRVCEVLSRADNRAAVAQAVVLLSDARQVGIFGIGASGILAEYTARLFSRIGLPAYVMNRTGFSLAEQLIGLQRGDVLIMMGQKSPHREGVTTLREAKRLGIPTILLTQAVDSRFSQEAQVVIDVPRGGDSSRMPLHGTVLVCLEMIVLSVASTTPQKTVKSLKRINDLHRAIGKSGGKRGH
>CP024707.1|AZL00983.1|2420689_2421457_+|basic-amino-acid-ABC-transporter-substrate-binding-protein
MVKNLLKACCMIAALTAAGQAAAETYTVGSGGTYRPFEFENSQKQLEGFDIDIIKAIAKAEGFDVKLVNTPWEGIFATLNTGDRDIIISGITITDKRKQMVDFSAPYFPAEQSIVVAQDSQVDSLAALKNEKVGVVNSSTGDIVVSEVLGKNSTAIKRFDNTPLMLQELFEDGVSAAVGDVGVVKYYIKQHPEKQFKLVPDAKFERQYFGIAVAKGNSELLGKINAGLQKIVADGTYAKIYKTWFDDNVPTLPAQ
>CP024707.1|AZL00984.1|2421520_2422285_+|amino-acid-ABC-transporter-permease
MTGFRWEIIEEYGPLFVDGALMTIKCTIICVILGTLWGLTLGLGRMAKAEHGPWKYILRYLVQFPVRFYVSAFRGTPLFVQIMVVHFALVPLFINPRDGLLVTSGLMSADFARELRASYGAFLSCIVAITLNAGAYVSEIFRAGIQSIDKGQMEASRALGMPWWKTMRKVILPQAFRRILPPLGNNAIAIVKDSSLASAIGLADLAYAARTVSGAYATYWEPYLTISLVYWVITFLLAQLVNRLEKRFGKSDSH
>CP024707.1|AZL03750.1|2422271_2422994_+|amino-acid-ABC-transporter-ATP-binding-protein
MIHINNLHKRFGDSHVLRGISCDIKPQEVVCIIGPSGSGKSTFLRCMNALETVSEGEVVVNGFAAHDRTTDLNKMRESVGMVFQRFNLFPHMTVLENLIMAPMNLRNMPRQQAVDLADALLAKVGLSDKRDAWPSSLSGGQQQRVAIARALAMKPSIMLFDEPTSALDPELVGDVLEVMKNLASEGMTMVIVTHEMGFAREVADRVIFIDQGVIQEEGKPGQIFSAPSNPRTAAFLSKVL
>CP024707.1|AZL00985.1|2423265_2423880_+|DUF1062-domain-containing-protein
MTVTWTVTPVGYQHIAKRCPACNVKRDFAPSGAIRVNSQKKLLDIWSIYKCTRCDYTWNIALFSRLHVSKINRELLQRLLQNDAAMVHYYAADLATLKRNRAEPSGQPDFRIHEQWSVTLKACQRITVRVRVSQPFRISLLSILKKQLKLSTAEIRWLVATGHIEGIPLKQLKTKKLKAMEYDFQLAAETLYARRRITLSLCGR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2911777 : 2922664

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZL01451.1\|2911777_2914885_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6
AZL01452.1\|2914939_2916205_+	MFS transporter	NA	NA	NA	NA
AZL01453.1\|2916235_2917324_-	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AZL01454.1\|2917410_2917671_-	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
AZL01455.1\|2917968_2918829_+	class A broad-spectrum beta-lactamase SHV-11	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AZL01456.1\|2918849_2919611_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AZL01457.1\|2919871_2920774_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	1.7e-158	99.0
AZL01458.1\|2920785_2922051_+	hypothetical protein	A0A077SLJ7	Escherichia_phage	1.7e-233	99.5
AZL01459.1\|2922043_2922664_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0

DBSCAN-SWA_2

3551379 : 3560842

Brazilian_cedratvirus(16.67%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZL02035.1\|3551379_3553101_+	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.5e-14	34.3
AZL02036.1\|3553145_3553847_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AZL02037.1\|3554200_3554419_+	translation initiation factor IF-1	NA	NA	NA	NA
AZL02038.1\|3554538_3556818_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
AZL02039.1\|3556848_3557166_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
AZL02040.1\|3557491_3557713_+	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
AZL02041.1\|3557646_3557850_-	hypothetical protein	NA	NA	NA	NA
AZL02042.1\|3557789_3559730_-	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.5e-37	40.5
AZL02043.1\|3559726_3560842_-	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7

DBSCAN-SWA_3

4044171 : 4090751

Salmonella_phage(26.53%)

tail,transposase,tRNA,head,integrase,coat

attL 4075566:4075580|attR 4094661:4094675

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZL02462.1\|4044171_4046355_-	hypothetical protein	B5TAB2	Burkholderia_phage	1.3e-82	42.7
AZL02463.1\|4046441_4048913_-\|tail	phage tail protein	F1C5A7	Cronobacter_phage	1.1e-202	45.2
AZL02464.1\|4048899_4049295_-	hypothetical protein	F1C5F2	Cronobacter_phage	2.3e-35	52.8
AZL02465.1\|4049291_4049762_-	hypothetical protein	F1C5F1	Cronobacter_phage	9.9e-25	37.0
AZL02466.1\|4049761_4050181_-	hypothetical protein	A0A2P1MXB5	Escherichia_phage	1.8e-30	47.8
AZL02467.1\|4050351_4050618_+	DUF1883 domain-containing protein	NA	NA	NA	NA
AZL02468.1\|4050594_4050774_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
AZL02469.1\|4050818_4051061_-	hypothetical protein	NA	NA	NA	NA
AZL02470.1\|4051060_4054501_-	hypothetical protein	Q5G8W8	Enterobacteria_phage	8.5e-166	47.8
AZL02471.1\|4054595_4055099_-	hypothetical protein	NA	NA	NA	NA
AZL03828.1\|4055201_4055429_-	hypothetical protein	NA	NA	NA	NA
AZL02472.1\|4055652_4055841_+	hypothetical protein	NA	NA	NA	NA
AZL03829.1\|4055892_4056213_-	hypothetical protein	NA	NA	NA	NA
AZL03830.1\|4056220_4056559_-	hypothetical protein	NA	NA	NA	NA
AZL02473.1\|4056633_4056888_-	hypothetical protein	K7PM89	Enterobacteria_phage	6.7e-20	73.0
AZL02474.1\|4056890_4057646_-	DNA-binding protein	K7PGT4	Enterobacteria_phage	1.1e-60	51.4
AZL02475.1\|4057821_4058499_-	hypothetical protein	F1C5E8	Cronobacter_phage	9.7e-74	58.4
AZL02476.1\|4058551_4059304_-	DNA breaking-rejoining protein	G0ZNE6	Cronobacter_phage	5.8e-43	42.1
AZL02477.1\|4059372_4059765_-	hypothetical protein	G0ZNE4	Cronobacter_phage	3.3e-34	51.9
AZL02478.1\|4059761_4060187_-	hypothetical protein	R9TPP7	Aeromonas_phage	2.5e-27	47.2
AZL02479.1\|4060189_4060552_-	hypothetical protein	A0A0M3LSC9	Mannheimia_phage	2.5e-20	49.2
AZL02480.1\|4060551_4060725_-	50S ribosomal protein L13	Q5G8X7	Enterobacteria_phage	3.9e-11	50.0
AZL02481.1\|4060724_4061105_-	hypothetical protein	F1C5E2	Cronobacter_phage	1.4e-29	56.1
AZL02482.1\|4061107_4061347_-	hypothetical protein	NA	NA	NA	NA
AZL02483.1\|4061379_4062435_-\|coat	phage coat protein	A0A1W6DYD5	Salmonella_phage	3.8e-101	53.2
AZL02484.1\|4062431_4062893_-	hypothetical protein	B1GS72	Salmonella_phage	5.0e-29	50.3
AZL02485.1\|4062892_4064248_-	DUF2213 domain-containing protein	F1C5D9	Cronobacter_phage	2.8e-128	52.6
AZL02486.1\|4064270_4064615_+	hypothetical protein	NA	NA	NA	NA
AZL03831.1\|4064615_4065617_-\|head	phage head morphogenesis protein	F1C5D8	Cronobacter_phage	5.2e-116	69.7
AZL02487.1\|4065552_4067004_-	DUF1073 domain-containing protein	F1C5D7	Cronobacter_phage	1.7e-123	53.3
AZL02488.1\|4067016_4068489_-	DNA-packaging protein	G0ZND4	Cronobacter_phage	4.6e-254	85.7
AZL02489.1\|4068475_4068955_-	DUF2280 domain-containing protein	F1C5D6	Cronobacter_phage	7.4e-52	62.9
AZL02490.1\|4068986_4069622_-	hypothetical protein	I6S676	Salmonella_phage	1.4e-101	80.7
AZL02491.1\|4069747_4069966_+	hypothetical protein	NA	NA	NA	NA
AZL02492.1\|4070413_4070764_-	hypothetical protein	H2EQH5	Salmonella_phage	1.3e-10	38.9
AZL02493.1\|4070760_4071255_-	lysozyme	M9P0E5	Enterobacteria_phage	4.0e-85	91.5
AZL02494.1\|4071257_4071572_-	hypothetical protein	H6WRZ3	Salmonella_phage	4.9e-44	86.1
AZL02495.1\|4072389_4073436_-\|transposase	IS481 family transposase	A0A0M3LR35	Mannheimia_phage	1.3e-05	21.9
AZL02496.1\|4073487_4074042_-	hypothetical protein	NA	NA	NA	NA
AZL02497.1\|4074498_4075026_-	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	1.7e-41	58.8
AZL02498.1\|4075022_4075541_-	hypothetical protein	G9L6B3	Escherichia_phage	5.1e-91	91.5
AZL02499.1\|4075540_4076047_-	Ead domain protein	A0A2H4FRZ0	Salmonella_phage	6.0e-28	58.7
4075566:4075580	attL	NA	NA	NA	NA
AZL02500.1\|4076039_4076303_-	DUF4752 domain-containing protein	T1S9K2	Salmonella_phage	2.6e-30	76.8
AZL02501.1\|4076299_4076824_-	hypothetical protein	A0A193GYX5	Enterobacter_phage	1.7e-12	74.4
AZL02502.1\|4076820_4077123_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZL02503.1\|4077122_4077899_-	replication protein	A0A193GYX1	Enterobacter_phage	8.8e-95	65.0
AZL02504.1\|4077895_4078624_-	helix-turn-helix domain-containing protein	H9C164	Pectobacterium_phage	7.8e-37	73.0
AZL02505.1\|4078757_4078979_-	transcriptional regulator	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
AZL02506.1\|4079018_4079252_-	transcriptional regulator	A0A2H4FNF3	Salmonella_phage	3.0e-22	70.4
AZL02507.1\|4079356_4080046_+	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	1.3e-86	70.6
AZL03832.1\|4080068_4080188_+	hypothetical protein	NA	NA	NA	NA
AZL03833.1\|4080351_4081776_+	AAA family ATPase	NA	NA	NA	NA
AZL02508.1\|4081852_4082056_-	hypothetical protein	A0A192Y6Q5	Salmonella_phage	1.0e-18	68.7
AZL02509.1\|4082483_4082690_+	cell division inhibitor protein	A0A0M4S6W3	Salmonella_phage	1.4e-31	94.1
AZL02510.1\|4082770_4083055_+	hypothetical protein	G8C7T1	Escherichia_phage	5.6e-39	77.7
AZL02511.1\|4083066_4083570_+	hypothetical protein	A0A0F7L7F5	uncultured_marine_virus	6.0e-12	29.5
AZL02512.1\|4083566_4084190_+	YqaJ-like viral recombinase	S0A2A9	Cellulophaga_phage	3.5e-46	49.0
AZL02513.1\|4084186_4084345_+	DUF1317 domain-containing protein	A0A0N7CHV0	Escherichia_phage	2.3e-10	60.8
AZL02514.1\|4084341_4085466_+	site-specific DNA-methyltransferase	A0A1P8DTZ3	Salmonella_phage	3.0e-88	48.1
AZL02515.1\|4085462_4085684_+	hypothetical protein	NA	NA	NA	NA
AZL02516.1\|4085680_4086217_+	hypothetical protein	J9Q748	Salmonella_phage	9.4e-72	74.9
AZL02517.1\|4086213_4086432_+	conjugal transfer protein TraR	A0A0K2FI84	Escherichia_phage	2.0e-12	52.2
AZL02518.1\|4086645_4087809_+\|integrase	site-specific integrase	G8C7S0	Escherichia_phage	5.0e-203	87.1
AZL02519.1\|4088239_4089106_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	1.3e-30	34.8
AZL02520.1\|4089107_4089320_+	ribosome-associated protein	NA	NA	NA	NA
AZL02521.1\|4089365_4090751_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	3.5e-46	35.4
4094661:4094675	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP024708

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP024707

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection