CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP034447	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 chromosome, complete genome	10 crisprs	WYL,csa3,DEDDh,RT,cas3	1	4	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP034447_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_1

208800-208912

Orphan

Consensus_repeat	Method
ACCTCCCAACGCGAGGGGCCGAGATTTGGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_1

>merge|CP034447|1|208800-208912|CRISPRCasFinder
ACCTCCCAACGCGAGGGGCCGAGATTTGGCGAGTGGATGATATTCGGAGATGTGACGTCCAAAGTATCGATGCATCGGCTTACCTCCCAACGCGAGTGGCCGAGATTTGGCGA

>CP034447|1|1|208800-208912|CRISPRCasFinder
ACCTCCCAACGCGAGGGGCCGAGATTTGGCGA	GTGGATGATATTCGGAGATGTGACGTCCAAAGTATCGATGCATCGGCTT
ACCTCCCAACGCGAGTGGCCGAGATTTGGCGA

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO19460.1\|218440_219973_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
CP034447.1\|AZO19446.1\|201138_201972_-\|carbohydrate-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP034447.1\|AZO19445.1\|199844_201095_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270451
CP034447.1\|AZO19449.1\|205120_206599_-\|DUF229-domain-containing-protein	unknown	unknown	gnl\|CDD\|293757
CP034447.1\|AZO19442.1\|196886_197765_-\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
CP034447.1\|AZO25554.1\|201971_202922_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP034447.1\|AZO19444.1\|198974_199784_-\|phosphodiesterase	unknown	unknown	gnl\|CDD\|277347
CP034447.1\|AZO19457.1\|215346_215802_-\|transposase	unknown	unknown	gnl\|CDD\|226077
CP034447.1\|AZO19453.1\|210134_211148_-\|glucosamine--fructose-6-phosphate-aminotransferase	unknown	unknown	gnl\|CDD\|240142
CP034447.1\|AZO19459.1\|218014_218371_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|377551
CP034447.1\|AZO19443.1\|198246_198978_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|319828
CP034447.1\|AZO19448.1\|204146_204971_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
CP034447.1\|AZO19454.1\|211144_212089_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|225518
CP034447.1\|AZO19447.1\|202923_204072_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226359
CP034447.1\|AZO19456.1\|213203_214481_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|130740
CP034447.1\|AZO19455.1\|212379_213207_+\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
CP034447.1\|AZO19458.1\|217562_218018_+\|IS66-family-insertion-sequence-hypothetical-protein	unknown	unknown	gnl\|CDD\|366690
CP034447.1\|AZO19461.1\|220060_221197_+\|ImmA/IrrE-family-metallo-endopeptidase	unknown	unknown	gnl\|CDD\|225412
CP034447.1\|AZO19450.1\|206678_207650_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270303
CP034447.1\|AZO19462.1\|221201_221645_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO19460.1\|218440_219973_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	5.2428e-124
CP034447.1\|AZO19446.1\|201138_201972_-\|carbohydrate-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	3.26706e-70
CP034447.1\|AZO19445.1\|199844_201095_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	5.0963e-83
CP034447.1\|AZO19449.1\|205120_206599_-\|DUF229-domain-containing-protein	gnl\|CDD\|293757	cd16033, sulfatase_like, uncharacterized sulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	5.33679e-87
CP034447.1\|AZO19442.1\|196886_197765_-\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	5.43134e-58
CP034447.1\|AZO25554.1\|201971_202922_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	1.76309e-75
CP034447.1\|AZO19444.1\|198974_199784_-\|phosphodiesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	6.71412e-68
CP034447.1\|AZO19457.1\|215346_215802_-\|transposase	gnl\|CDD\|226077	COG3547, COG3547, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.83657e-11
CP034447.1\|AZO19453.1\|210134_211148_-\|glucosamine--fructose-6-phosphate-aminotransferase	gnl\|CDD\|240142	cd05009, SIS_GlmS_GlmD_2, SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal glutaminase domain and two C-terminal SIS domains and catalyzes the first step in hexosamine metabolism, converting fructose 6-phosphate into glucosamine 6-phosphate using glutamine as nitrogen source. The glutaminase domain hydrolyzes glutamine to glutamate and ammonia. Ammonia is transferred through a channel to the isomerase domain for glucosamine 6-phosphate synthesis. The end product of the pathway is N-acetylglucosamine, which plays multiple roles in eukaryotic cells including being a building block of bacterial and fungal cell walls. In the absence of glutamine, GlmS catalyzes the isomerization of fructose 6-phosphate into glucose 6- phosphate (PGI-like activity). Glucosamine-6-phosphate deaminase (GlmD) contains two SIS domains and catalyzes the deamination and isomerization of glucosamine-6-phosphate into fructose-6-phosphate with the release of ammonia; in presence of high ammonia concentration, GlmD can catalyze the reverse reaction.	1.58949e-12
CP034447.1\|AZO19459.1\|218014_218371_+\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	1.19539e-53
CP034447.1\|AZO19443.1\|198246_198978_-\|HAD-family-hydrolase	gnl\|CDD\|319828	cd07526, HAD_BPGM_like, subfamily of beta-phosphoglucomutase-like family, similar to Escherichia coli 6-phosphogluconate phosphatase YieH. This subfamily includes Escherichia coli YieH/HAD3 an 6-phosphogluconate phosphatase, which can hydrolyzed purines and pyrimidines as secondary substrates. It belongs to the beta-phosphoglucomutase-like family whose other members include Lactococcus lactis beta-PGM, a mutase which catalyzes the interconversion of beta-D-glucose 1-phosphate (G1P) and D-glucose 6-phosphate (G6P), Saccharomyces cerevisiae phosphatases GPP1 and GPP2 that dephosphorylate DL-glycerol-3-phosphate, and DOG1 and DOG2 that dephosphorylate 2-deoxyglucose-6-phosphate. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.15951e-52
CP034447.1\|AZO19448.1\|204146_204971_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	8.06793e-59
CP034447.1\|AZO19454.1\|211144_212089_-\|sugar-kinase	gnl\|CDD\|225518	COG2971, COG2971, Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism].	7.48515e-22
CP034447.1\|AZO19447.1\|202923_204072_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226359	COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].	2.24363e-126
CP034447.1\|AZO19456.1\|213203_214481_-\|FAD-binding-protein	gnl\|CDD\|130740	TIGR01679, bact_FAD_ox, FAD-linked oxidoreductase. This model represents a family of bacterial oxidoreductases with covalently linked FAD, closely related to two different eukaryotic oxidases, L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae.	7.2186e-98
CP034447.1\|AZO19455.1\|212379_213207_+\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	1.24959e-59
CP034447.1\|AZO19458.1\|217562_218018_+\|IS66-family-insertion-sequence-hypothetical-protein	gnl\|CDD\|366690	pfam01527, HTH_Tnp_1, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family consists of various E. coli insertion elements and other bacterial transposases some of which are members of the IS3 family.	1.42167e-09
CP034447.1\|AZO19461.1\|220060_221197_+\|ImmA/IrrE-family-metallo-endopeptidase	gnl\|CDD\|225412	COG2856, COG2856, Predicted Zn peptidase [Amino acid transport and metabolism].	1.30159e-12
CP034447.1\|AZO19450.1\|206678_207650_-\|extracellular-solute-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.7581e-53

>CP034447.1|AZO19450.1|206678_207650_-|extracellular-solute-binding-protein
MKSADVQDFIAPVLRLYNKDGKQLAFPHFAATQLLYYRADLFEKAGIKQPPQTWEEFRNDCDLLRKADIQCTALRGQPDTGENIWFWGQVLYGFGGKYFANEPADLTPTVNSPAAVEALKWYTDVMTNFTVPGSISATFDDVVIAMQQGRIAMTVEGAPTAGRILDPKLSKVVGKLGFALPPGGVSGRFPPFAGQAYVIPAASENKAAAAAFLQWATSKDLMKRISLDSTFVAITRTSLWDDPEIRAKHDYDYGHGSFAATYAETLRGAPEWYYPRIPEFKEIGDRLGRALQEAVVRSKSPEAALDDAQGDAVEIVKRAGYLK
>CP034447.1|AZO19449.1|205120_206599_-|DUF229-domain-containing-protein
MRNFSIVWICSDQQRWDTLQCLGFKGTQTPNIDRLAARGTAFARAYCQSPICTPSRTSFLTGLYPIAHQVHQNGAGTFPSHLVLLPKLMANAGYYTGHIGKLHLSATRGMIEKRPDDGFAEFYWSPEPFPEWSGNHDYHAWMWSKGVNPEAYFKPYLDQHYGPGPAAEYRQARWAGDRAERFIKMHSDRSWYLGVNIDAPHPPLNPPPDYLRRFNPNDMPDPAFKPIDLEHQKKFERVDQQAKFAVDPWHAATDAGEAHNDELAGPTHEAPPTKFNIWEMRAAYHAEVAQVDDLVGRILDTLTETGQLDRTIIVFMSDHGDMMGDHGLLYKGCRFYEGVVHVPLVISVPGSPAQGSVSNALVELVDIAPTLLSLSGLEVPKAMQGLSLDQMLLGNTSLDCHKPYVVSEYHNSLRFRGSRGSRASMYYDGRHKLNVYHDVGIGELFDHKEDPNEHYDLWDSHHHRGLKYDLLGRSFSAMMLRSGSGPERIEDY
>CP034447.1|AZO19448.1|204146_204971_-|MurR/RpiR-family-transcriptional-regulator
MSVNSPAMKAASHESILARLQDDIDRLPNALARIAKYILENPEKVLHQSVAELGEFAASGEASILRLCRQIGFSGFRDFKLALAAEIGRPGLPPTAAGTADSALQSLHDTMAQNLSIAHNNADSETLAKVAAALAASRRIDLYGAGMSGITAELLAYRLLRVGLTAFAFRNSNMAHEVASGLSPGCVAIGLSISGLTVDTVQFLKGARSAGALTVAITNRARSPLEKAADFTLQASGLQDHPIGGTLTSTIGKIFVIESLMLALGKAMDKPVAK
>CP034447.1|AZO19447.1|202923_204072_-|ABC-transporter-ATP-binding-protein
MAALDLHIDDIGKRFGAIDVLRGICLRVAAGEFVTLLGPSGCGKSTLLRIIAGLERADQGHVRAGGRGLDAVAPKDRDLAFVFQSYALYPHLSVHDNIAAPLVMRELSSLERLPVIGALLPGAIQRKRSIQERVRQTSGLLKLDALLERRPSALSGGQRQRVALGRAMVRKPKIFLMDEPLANLDAALRIHTRGEIARLHKEMETTTIFVTHDQAEAAALSDRVAVIFGGELRQVAAPADLYREPVDLDVARFLAQPFLNELAVAAPIGGGLMIGGSRIIIRDALGSGLAGTLAFRPEHATLAEKDHPGALPVRVTRIEHAGIDAHVFVDAEAGAQFVARISAERARSLRDGDNLGLTIDAEKAWFFPSNGSRQRGDHSGAA
>CP034447.1|AZO25554.1|201971_202922_-|sugar-ABC-transporter-permease
MALANDIPLSSLAPNTAGSYRPTRAQAQAGIILSVPATLLLVALVIGPAILVFFLSFTNASLGLAGIQFIGVANYTRMLTDPGFAQSLRNTALYVAVVVPTAIGWGLLVAVLIARSRFAVLYRTAYFLPVAASLVALATAWEAILHPSLGFANTLLQLLGASPVRFLSDPATAIYALAAIGVWQLVGFNMILFLAGLSTIPEELYEAATIDGADRGLKRFLLVTWPMLAPVTVFVTVMTIIRAFSVFETVAVLTQGGPMKSTSVVLYTFYEEGFRFFRVGYASAISVSFFVFVTFLSLVQMRVSERRARWKANGGQ
>CP034447.1|AZO19446.1|201138_201972_-|carbohydrate-ABC-transporter-permease
MILGQSSSSRIVSHAVLVTGAIIMVFPFLWMILASLTPQSEIFDGSLLPTPTLHGAIDNYGTALSAIPLLRFMANGFVVCLAILVLQIAIAIPCGYALAKLSFPGRPILLVGVLLGLLVPVQIPTIPIYIALAKSGLLDSYAALVLPWIISVFAIFLFRQFFVTFPDEVLDAARLDGFSELSIAWRIMLPAAWPAVVSFSIFSIVAHWNDLYWPMVVITNPDMMTASLGIAYFRQAGEGAGNVGALMAGGVLVTAPLVSFFLLMQKHFIRGLVLGRH
>CP034447.1|AZO19445.1|199844_201095_-|ABC-transporter-substrate-binding-protein
MKTVAMILAAGVAAAAMPAQAETKLNVYYAWPEHEVIHKPIADRFMADHPEIKISFRAAAPSYDEAVQTLIRQSMAGELPDVHYVGFNVLRPLVTRGLVKPIDDLVAADHLADKGYTEQILSLARIEGHLYGLPFAMSTPVVYYNADLVKQAGGDPDKVPTDWDSFVALAGKVGALGNGTSGMYYQLGSDDWATQNLVRNFGGQMMNDKESDIAFDGPAGQAAVKLFKRFHTDGAQPAIDSHAARQLFTSGKLGFFFASAGSVSGFEGEIGDRFKLRTAKQPLGAEDATMPTGGMVAIILTDDPAKRAAAWDYVKFTTSPEGQSIVVPNTGYMPTNTLALDKDHLAGFYDKHPNWYTSVLQTPRARPWFSWPGDNGVQIGEVLRDEMTAIALGSKEPEAALADMVSEVRALLPKTN
>CP034447.1|AZO19444.1|198974_199784_-|phosphodiesterase
MKLIHLTDPHLVPLGAMLFGFDPAQRLRKTIERINRDHADAELCVVTGDLTDEGDFASYVLLREVLQELRVPARLLLGNHDSRENFVRAFPGEPRDENGFIQSVHDGSAGRLIFLDTLVEGFGHGSLDDGRLEWLLARVAEASDVRAYLFVHHPLQPIGLPHFEPWSTENWRPIMQAIVSAGNVRHIFHGHVHVDVGGTWSGIPFSANRGVAHQIIPHFTRRDADFVEDAPAFDIAIIDVDGVLVHRFEVSDRHVVEVSAEGWVPEGMQ
>CP034447.1|AZO19443.1|198246_198978_-|HAD-family-hydrolase
MNQQASYELVIFDCDGVLIDSETLASRIDAEELTRIGYPMSYSDVILRFTGLSSATMRKMIEEDWGRPLPSDFDVIVQSRIKESYQTELQAISGIDQLLHQLRLPRCVASSSAPDKLRLGLELTELWAYFHPHVFSSAMVKAGKPAPDLFLFAAAQMGTKAARCVVVEDSIAGVRAGVAAGMMVIGFTAGGHCHDDHGQRLLSAGAAVVARSAEELSVLLMTSEVQPNTKWQEADPVAAGAVR
>CP034447.1|AZO19442.1|196886_197765_-|phosphodiesterase
MVTTTTAIKWPDAAAVSCPTSSQGRAQSECGAMQKIIHITDPHFVAPGKTLYGIDPAQRLRDTLDHVSRVHADAKLILITGDLADTGDPAAYALLREILSEVRLPVHLTIGNHDDRGAFRGVFGGEGFVQAAVDLHDWLVVLLDTKDDISHFGCLDGGRFEWLQDQLFRAAGRPVVVAMHHTPADLHVPCFKTSDMKESDRLLSILRKNASVRHMLFGHRHVAAAGSLSGISFTASRGTAQHIVLDWEQYGKPIFVAAAPSYDVVMLDGSDVVVHRHEGLDQLPVIRPGDPK
>CP034447.1|AZO19453.1|210134_211148_-|glucosamine--fructose-6-phosphate-aminotransferase
MIYRSTIARQPNQFRHTLEVVGTQLRDLDLAPFEKGTVVVTGIGASYEAAGVVAGELQRRGRRANTWRAVDLMEPGDPGDAIIVFSVGGRSIEPIAALTIHSTLPSLAITSGGNDPLSRTASAALRFESGPDSLPSSTGYTGSLLAGGLLIDALCGEDSFNWNDIPLIASEVLETSAKRMARIGEMFHDQRAIDCVGAISALGTAGEACLLIREAARVPTGVADTLHYLHGPMESMDQATGILIFGDGREVRLAQELAEIGCAVLLVTASESPQDAKNLAVVKVPSLQNRVGRSIVDILPAQLLAAELSDAAGLTDAQFRYSQNDTKVTVNESEPRV
>CP034447.1|AZO19454.1|211144_212089_-|sugar-kinase
MGSISIGVDIGGTKTHLRSCLEQGMGRDLVVRTSEWRCGAYHHDIPGLIALISGFADGAAPNGIAIGSHGCDDEAECAIVQKPLSNHFACPLRVVNDAELFPLAMGLSSGIGVVAGTGSIAVARDQKGRMHVAGGWGWAIGDEGSAPGLVREAGRVVRRHIDLGGARSEPLVEALCDAFGLNSPTNIGTAIAKEGGASALGRHAPVIFYAANEGSSLAKRVIDEGAAALTQLVHHLKLAGVSDKDVVVGGGVILAQPLLANAFSHQISDRFGATVAVTFLDKPPVLGACVLARQLCSAGDGPETSIVSQHMDIQ
>CP034447.1|AZO19455.1|212379_213207_+|MurR/RpiR-family-transcriptional-regulator
MQEKILARLRSSQPSLSPALLRISEYVLNDPAKVVNQTITEVADGSGSSEASVLRFCRDIKFSSFQRFKLALGIELSTHQTIRHASPSGDVIDDTLSTAITALKQTKDLLNHAALELAAKQIIRAKSIDLYGFGGSANVARYAHYLFVRFGLVSRVLDDPHLAVMSAVNLGPKQVALAISESGSSKDTINSLMAAKAAGAFTIAITCHIRSPIAANADAVLGASSTDTPITRGAFSRVAGQYLIIDILANMIAKDGSKFQAAMQRTAEATIDKSF
>CP034447.1|AZO19456.1|213203_214481_-|FAD-binding-protein
MPSSETRAQTLGPSMIWRNWVSNQVCRVKHFEMPSSDDDVCRTIKTAASTNLRVRVVGTGHSYTPIVPTDGVLISAERLTGIENIDPTNGSVTLRGGTRICDVGLELRSAGWALPNQGDIDLQTMSGAVSTGTHGSGDSLQCLAGPIIGMRIAMGDGSIANFDASQDIDVLNAAKVCLGMLGVVLSVTMKLVPAFDLHDKIWREDFEECMDHLDQLCQENRSLRVFWCPTEHSASLYSLPDTSGIGRTRSKADVCEIRTLNVTTQPSAAVEAQAGERIGPSYRIFPGSIPMPNHNECEYSVPYEDGPAVLREIRKLIQTKHPSQIFPVEYRTVAADDIWLSPYFERKTAMISVSGAAGEDYWDFIRDCETIFSWVKGRPHWGKLHSLGRSEIEGLYPRYGDFISQRARFDPDGRFLNDYLRERFS
>CP034447.1|AZO19457.1|215346_215802_-|transposase
MTAIDDPTRFRRSRDVAAYFGLTSRRWQSGSTIDIQGRISKAGDADVRRALYEAASGLMTRFKGRDKVKSWGRDIAKRSCHRKACVAVARKLAVIIHAMWSDGRLRRRCGRERGRCHAARPCQGPQAAGSASMSGAAADKTHGAGALTDPI
>CP034447.1|AZO19458.1|217562_218018_+|IS66-family-insertion-sequence-hypothetical-protein
MGIGDRLVSGLDLTLDPERQLRRFEVINGAGGRRHWSVDDKARIIAETLEPNAVISEVARRYGLRPQQVFAWRREACKPATSVQQDSPAFVPAVLAAAEPVASRSPKQRKRQATRGAGMIELEIDGISMRVGRGADTKTVAAVIRALKATS
>CP034447.1|AZO19459.1|218014_218371_+|IS66-family-insertion-sequence-hypothetical-protein
MIGPTGAVKVMVATKPVDFRKGAEGLAALVRETMGADPFNGAVYVFRAKRTDRIKLIFWDGTGVCLYAKRLEDGEFRWPKVHDGMMRLTAAQLSALLEGLDWRRVHEARRTRVPAQAG
>CP034447.1|AZO19460.1|218440_219973_+|IS66-family-transposase
MAMTADQLPDDPDALKAMVLARDVENARLIQIIKELQRHRFGRRAETLPEDQLLLGLEEAEQIEAAGDEEQAQTALGERQAPVAKRRANRGGLPPHLPRVEMVVDIEDHACPCCRNGLHRIGEDMSERLDIVPAQLRVIVVRRPKYACRACEDVVVQAPAPARLIEGGLPTEATVAQVLVSKYADHLPLYRQAQIYARQGINLDRSTLADWVGRAAWHLRPVHERLLGKLKSSPKLFADETTAPVLDPGRGKTKTGQLWAYARDDRPWEGSDPPGVAYVYAPDRKAERPIAHLVGFTGILQVDGYGGYRVLADKSGVTLAFCWAHVRRRFYELAAAGPAPIASEALRRIAELYRVEDDVRRRSAEQRRVVRQDRSRPIVVELEPWLREKLGLISQKTKLAEAIRYTLSRWEGLSRFLDDGRIEIDSNTVERSIRPIALNRKNALFAGSDGGAEHWAVIASLIETCKLNGVEPLGYLADVLTRIVNGHPNSQIDDLLPWVYINKLQLKAVA
>CP034447.1|AZO19461.1|220060_221197_+|ImmA/IrrE-family-metallo-endopeptidase
MPLKLTPRPSAVESIRRARRLSIEAVAIEANIRPDFLTEMETTPTDVSKRVAFSLASALAVPVQFLFAKDVEIDANMPDFRAANNRPAVLTSAGLTRIARARSIAAYLADRAFEDCTRFANTNSVTIHQQSTARKLLKSLYVRVQRVDGSVDPTLTFRETRVSLERKGIIVLCDRVADPFRGFCYSPTGDFPIIFVNTTGQRPATKLFTLMHEVVHVLLGKTGVSDPAILNNQVERFCNSVTASVMMPAEEFSQAYKSVAGRGARAVVDLLSRRFGASKQASALRVSDLGLSKGFYAAWSATLPSEVPMIEEEDEGEENSGGGGISSQIARFGYLLPNMLTAAVDRKAISQFDAYRLTNLKPSTIKQIAAIGVNRLGP
>CP034447.1|AZO19462.1|221201_221645_+|hypothetical-protein
MAYSGINFVLDLEACLYFSEAGGNLKAALFQRAKVERIAVPKEVFDQVRIFDKSLADEISESDIEIVELDSDVYVAACALNEIFMTSGHRLNAAANEKVPVIALVHCAQNGAKPPCHLVSGDNGLHSSSMRSLCAALKVPFMEVTSF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_2

1000443-1000526

Orphan

Consensus_repeat	Method
CTACGCACTTTTCCTGGAATTGCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_2

>merge|CP034447|2|1000443-1000526|CRISPRCasFinder
CTACGCACTTTTCCTGGAATTGCTCTCTTTGTCTTGTCGCAATTCCGGACGGAAAACCGCTACCCACTTTTCCTGGAATTGCTC

>CP034447|2|2|1000443-1000526|CRISPRCasFinder
CTACGCACTTTTCCTGGAATTGCTC	TCTTTGTCTTGTCGCAATTCCGGACGGAAAACCG
CTACCCACTTTTCCTGGAATTGCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO20002.1\|990022_991300_+\|5-aminolevulinate-synthase	unknown	unknown	gnl\|CDD\|236370
CP034447.1\|AZO20001.1\|988635_989631_-\|UDP-glucose-4-epimerase-GalE	unknown	unknown	gnl\|CDD\|224012
CP034447.1\|AZO20012.1\|1001433_1002510_+\|quinone-dependent-dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|240089
CP034447.1\|AZO20007.1\|997467_998124_+\|O-methyltransferase	unknown	unknown	gnl\|CDD\|226607
CP034447.1\|AZO20015.1\|1005623_1005887_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20017.1\|1006703_1006934_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20016.1\|1006156_1006657_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20018.1\|1007039_1007375_-\|protamine-2-(modular-protein)	unknown	unknown	gnl\|CDD\|367272
CP034447.1\|AZO20014.1\|1004623_1005526_+\|histone-deacetylase	unknown	unknown	gnl\|CDD\|212519
CP034447.1\|AZO20005.1\|993239_996725_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|223664
CP034447.1\|AZO20011.1\|1001059_1001437_+\|DUF952-domain-containing-protein	unknown	unknown	gnl\|CDD\|226033
CP034447.1\|AZO25612.1\|1003147_1004407_-\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240541
CP034447.1\|AZO20003.1\|991311_992478_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|180404
CP034447.1\|AZO20006.1\|996737_997373_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|375433
CP034447.1\|AZO20013.1\|1002547_1003072_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20010.1\|1000534_1000972_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20004.1\|992579_993002_-\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|237569
CP034447.1\|AZO20008.1\|998239_999532_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
CP034447.1\|AZO20009.1\|999547_1000207_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
CP034447.1\|AZO20000.1\|987283_988534_-\|D-amino-acid-dehydrogenase	unknown	unknown	gnl\|CDD\|234819

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO20002.1\|990022_991300_+\|5-aminolevulinate-synthase	gnl\|CDD\|236370	PRK09064, PRK09064, 5-aminolevulinate synthase; Validated.	0
CP034447.1\|AZO20001.1\|988635_989631_-\|UDP-glucose-4-epimerase-GalE	gnl\|CDD\|224012	COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane].	0
CP034447.1\|AZO20012.1\|1001433_1002510_+\|quinone-dependent-dihydroorotate-dehydrogenase	gnl\|CDD\|240089	cd04738, DHOD_2_like, Dihydroorotate dehydrogenase (DHOD) class 2. DHOD catalyzes the oxidation of (S)-dihydroorotate to orotate. This is the fourth step and the only redox reaction in the de novo biosynthesis of UMP, the precursor of all pyrimidine nucleotides. DHOD requires FMN as co-factor. DHOD divides into class 1 and class 2 based on their amino acid sequences, their cellular location and their natural electron acceptor used to reoxidize the flavin group. Members of class 1 are cytosolic enzymes and multimers, while class 2 enzymes are membrane associated, monomeric and use respiratory quinones as their physiological electron acceptors.	2.00271e-180
CP034447.1\|AZO20007.1\|997467_998124_+\|O-methyltransferase	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	7.08225e-43
CP034447.1\|AZO20018.1\|1007039_1007375_-\|protamine-2-(modular-protein)	gnl\|CDD\|367272	pfam02956, TT_ORF1, TT viral orf 1. TT virus (TTV), isolated initially from a Japanese patient with hepatitis of unknown aetiology, has since been found to infect both healthy and diseased individuals and numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF1 is a large 750 residue protein. The N-terminal half of this protein corresponds to the capsid protein.	5.09304e-06
CP034447.1\|AZO20014.1\|1004623_1005526_+\|histone-deacetylase	gnl\|CDD\|212519	cd09993, HDAC_classIV, Histone deacetylase class IV also known as histone deacetylase 11. Class IV histone deacetylases (HDAC11; EC 3.5.1.98) are predicted Zn-dependent enzymes. This class includes animal HDAC11, plant HDA2 and related bacterial deacetylases. Enzymes in this subfamily participate in regulation of a number of different processes through protein modification (deacetylation). They catalyze hydrolysis of N(6)-acetyl-lysine of histones (or other proteins) to yield a deacetylated proteins. Histone deacetylases often act as members of large multi-protein complexes such as mSin3A or SMRT/N-CoR. Human HDAC11 does not associate with them but can interact with HDAC6 in vivo. It has been suggested that HDAC11 and HDAC6 may use non-histone proteins as their substrates and play a role other than to directly modulate chromatin structure. In normal tissues, expression of HDAC11 is limited to kidney, heart, brain, skeletal muscle and testis, suggesting that its function might be tissue-specific. In mammals, HDAC11 proteins are known to be involved in progression of various tumors. HDAC11 plays an essential role in regulating OX40 ligand (OX40L) expression in Hodgkin lymphoma (HL); selective inhibition of HDAC11 expression significantly up-regulates OX40L and induces apoptosis in HL cell lines. Thus, inhibition of HDAC11 could be a therapeutic drug option for antitumor immune response in HL patients.	5.19486e-141
CP034447.1\|AZO20005.1\|993239_996725_+\|sensor-histidine-kinase	gnl\|CDD\|223664	COG0591, PutP, Na+/proline symporter [Amino acid transport and metabolism / General function prediction only].	2.21812e-82
CP034447.1\|AZO20011.1\|1001059_1001437_+\|DUF952-domain-containing-protein	gnl\|CDD\|226033	COG3502, COG3502, Uncharacterized protein conserved in bacteria [Function unknown].	5.90659e-60
CP034447.1\|AZO20003.1\|991311_992478_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|180404	PRK06108, PRK06108, pyridoxal phosphate-dependent aminotransferase.	0
CP034447.1\|AZO20006.1\|996737_997373_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|375433	pfam17923, TetR_C_18, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain. This entry represents the C-terminal domain present in TetR transcriptional regulations found in proteobacteria.	1.06213e-42
CP034447.1\|AZO25612.1\|1003147_1004407_-\|MATE-family-efflux-transporter	gnl\|CDD\|240541	cd13136, MATE_DinF_like, DinF and similar proteins, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli DinF is a membrane protein that has been found to protect cells against oxidative stress and bile salts. The expression of DinF is regulated as part of the SOS system. It may act by detoxifying oxidizing molecules that have the potential to damage DNA. Some member of this family have been reported to enhance the virulence of plant pathogenic bacteria by enhancing their ability to grow in the presence of toxic compounds. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	1.47927e-115
CP034447.1\|AZO20004.1\|992579_993002_-\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|237569	PRK13952, mscL, large conductance mechanosensitive channel protein MscL.	1.13749e-75
CP034447.1\|AZO20008.1\|998239_999532_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.58819e-62
CP034447.1\|AZO20009.1\|999547_1000207_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	5.66182e-63
CP034447.1\|AZO20000.1\|987283_988534_-\|D-amino-acid-dehydrogenase	gnl\|CDD\|234819	PRK00711, PRK00711, D-amino acid dehydrogenase.	4.5544e-169

>CP034447.1|AZO20009.1|999547_1000207_-|response-regulator-transcription-factor
MPSGYTFVIADDHPLFRGALKEALAGLGDVAAIHEAGDFESAKALVLANEDIDMVLLDLSMPGASGLSGLISLRGIHQSVPLVVVSAHDDPVTIRRALDLGASGFISKSASMEEIRNAVQAVLAGDIAAPAGVELGVERDPEISDLIKRLQALTPQQTRVLGMLAEGLLNKQIAYELGVSEATIKAHVSAILQKLGVDSRTQAVIQLSKIGGDPLQPVG
>CP034447.1|AZO20008.1|998239_999532_+|MFS-transporter
MTTFSSSWRGLPRPALLGLFLFFCAGFADGALVPFFPLWASREAGIPVGAIGLLFGCYAGGELIAAPLIGGIADRVGRRPVLILSSLGVGCGFIALFFVHGVVATAVVLILTGICESVLHPTILTAIADVTEPSAHPRWFSMARVSSSAGQILGPACGALLALISLSTVFLAGGGMLILGGTVMLIALAETIGSGAHAAGDQDDEEEEEGLSALLPAFRDGRLAKLLLWVVLFEISGNWIEAVIPLYAQDADTLSPSGVGTLFAYAAALTVGLQMLVSGFAEARSALWLTVGAGLSTIAAFVLLAASPAMLSLIAAVSLCSVAQMLVGPLVPTAVNALAPAARRASYMAASSVAVDLKDSLGPSIGTALYALAPRLPWIAGIPLVAIASLGLGVAIGRARNFSGAGFDAESGGPERSTTWSTSPATEEQS
>CP034447.1|AZO20007.1|997467_998124_+|O-methyltransferase
MTTLTGTPLAPLLARLFNEAAAATSPAIVQYSREERARLLGSKTEYLNFYGSLKDLWLAVSPETGTLLYMLARSTGARIIVEFGTSFGISTLYLAAALRDNGGGRLITTEFEPSKVVRAKANLADGGLLDLVEIREGDALETLARDLPDRIDLLLLDGAKALYPEILSLVESRLRPGALVIADNADFSPEYLERVRSPTGDYLSTSFGDDVELSMRLG
>CP034447.1|AZO20006.1|996737_997373_-|TetR/AcrR-family-transcriptional-regulator
MIQRPSPSISTRKQPKQARATELVAAILQAAAQVLASEGAQRFTTTRVAEKAGVSVGSLYQYFPNKAALLFRLQSDEWRQTTDLLCDILEDVEIPPLERIRTLVHAFIRSECDEAAVRGALDDAAPLYRDAPEAQEARATANGTVEAFMRETLPEAADDARAMAGQLIIKTLSAMGADFSENPRTEAEIEDYSDALADMFCAYLRSLGHQG
>CP034447.1|AZO20005.1|993239_996725_+|sensor-histidine-kinase
MQGWFVVIIAIAYVTLLFAIASVGDRRSVAAGLGRARPFIYALSLAIYCTSWTFFGSVGLSSERGLEFLGIYTGPVLVFVFGFPLLNRIVRLAKSEKITSIADFLGARYGKSFIVAAIATLIATIGAVPYIALQLKAISGSVSLMIEHYTGSPPSFDPFVSDISLVVAMLLALFAVLFGTRHADATEHQDGLVLAVAVETVVKLAAFLAIGLMVTFLIFGGPGDMLATLAANAEVREAMGYNTSLATWLVLTTLSGFAILMLPRQFYVTIVENRSEAELRAATWVFPLYLVAINLFVLPIAFAGLSLVGTKTSSDLYVLSLPLLSGHDVLAMAAFIGGLSAATAMVIVESVALSIMISNDLVIPLFVRRLLKTTSSQNEDWSTLILNVRRASIFIMLFIAFLYYRESTNSARLSSIGLMSFAAIAQFAPALIGGLIWRRANGRGAALGMVAGIAVWGYTLLLPSLVGPGSDIVVHGLFGFEALRPQALFGTVGEPLNHGVLWSLSINTLFFVLGSLSRASVPLERIQAAIFVPREAGPMPSLRRFRTAVTVNDLKDTISRYLGVERTERSFQSFEKNANVSLHGKEQASMDVIRFSEQLLASAVGSSSARLIMSLLFRRNDRDSKDAFRLLDDATEALQHNRDLLQIALDQMEQGITVFDRDFRLICWNRQYRALFDLPDEMGQVGVSLDQILRHLAERGDIPADQRVAMLNRLTSFVSPWQMELKTSGRILELRSNPMPDGGIVATYADISGRVEQDLALKRANESLEQRVRSRTAELTRVNEELAQAQMLAEEANLSKTRFLAAAGHDILQPLNAARLYCSSLIEKAGKGPAGKAAINIESSLESVETILGAVLDISRLDAGALKPEDTAFSLGGLLSQIGNDFRPLAAEKKLELEIMPSSLGVMTDRNLLRRLIQNLVSNAIKYTREGRILVGVRRRGELAEIQVIDTGIGIAGDKLNTVFHEFTRLDEGAREAEGLGLGLSIVDRIARVLRLEIRIYSNPGKGTRFSVILPVAAVAAPPREVGKPPARAASTLAGLNVLCIDNDARILDGMRLLLEGWGCSVETASGSDDLLRPGARRPDIVLADYHLDGGTGLDAIAKLRAAYGQDLPCVLVTADRSSEVRTAAGRLDVPVVNKPLKPAVLRSMMARVRALAPAAE
>CP034447.1|AZO20004.1|992579_993002_-|large-conductance-mechanosensitive-channel-protein-MscL
MLKEFQEFISKGNVMDLAVGVIIGAAFGKIVDSLVNDIIMPIVGAIFGGLDFNNYFFGLSSNVHSAALADAKKEGAVFAYGSFITVVLNFLILAFIIFLMVKAVNNLRKRLEREKPAAAAAPPPADVQLLTEIRDLLAKK
>CP034447.1|AZO20003.1|991311_992478_-|pyridoxal-phosphate-dependent-aminotransferase
MTLIQTLRAEARAAPESGIVAVVNHGRLREGLIPLWAGEGDLPTPSFISDAAARGLANGETFYTWQKGIPELRQALARYYARHFGKHFAEEEFIVTASGMHAIQLAIDAIAGSGDEVIYLSPAWPNFAAAAGVAGAVPVAVVLDRSGNGWSCDVEKIASAITPRTKALFINTPSNPTGWTADRETLQAILDLARAKNLWIIADEIYSLFHYGHGRAPSFLDVATGEDRILFVNSFSKNWAMTGWRVGWIKTHPALQQVFENLIQYSTSGVAQFMQRGAVAALDEGDGFIVSQVERARAARDLVCDILGATGKARFTVPQGAFYLFFTVDGITDSRTAAFDIVDNANVGLAPGTAFGPGGEAFLRLCFHRRLDQLEEAANRLAKWMKTV
>CP034447.1|AZO20002.1|990022_991300_+|5-aminolevulinate-synthase
MNYQRFFEDAIDQLHAERRYRVFADLERIVGKFPRAIWRSNGRAQEITVWCSNDYLGMGQNGDVITAFQTAAGKMGSGAGGTRNISGTSNPLVELEHELADLHDKEAALVFTSGFVSNEASISTIARLLPNCLIISDELNHASMIEGVRRSGAEKKIFRHNDVAHLESLLQAAGRERAKLIVFESVYSMDGDIAPIRQIVELAERYNAMTYIDEVHAVGMYGARGGGITEREGLADRIDIIEGTLAKAFGTLGGYIAGASAVIDAVRSYAPGFIFTTALPPAIAAAATTSIRHLKRSQAERDAQQRQAARTKQVLAAAGLPVMESATHIVPVLVGDPELCKMASDRLLGVHGIYIQPINYPTVPRGTERLRITPTPFHSDALIAELQDALVETWDALGIPYATSGRPVLAKSDRIVPLLVPKSGG
>CP034447.1|AZO20001.1|988635_989631_-|UDP-glucose-4-epimerase-GalE
MTVLVTGGAGYIGSHMVWELLDAGESVVVLDRLSTGFEWAVAPEAKLVVGDVADRELVGRIIRENKIDAIIHFAGSIVVPESVADPLGYYENNTCKTRTLIQTAVREGVPHFIFSSTAAVYGGAGLEPVREDARLAPESPYGLSKLMSEWMLRDAAIAHDIRYTALRYFNVAGADPKGRTGQSTPGATHLIKVACETALGKRPFMQVFGNDYPTPDGTCIRDYIHVSDLAAAHRLALQRLREGGESLVANCGYSHGYSVLEVIESVRRAFGHDFDVRMGDRRPGDAAAVVANSELARKEFGWAPQRDDLDQIVKDALAWERILTGKNSVRN
>CP034447.1|AZO20000.1|987283_988534_-|D-amino-acid-dehydrogenase
MKVLVLGAGVVGTAAAYYLAKDGHEVTVIERHEAAARGTSQSNAGLVSPGDATAWASPAALKTFLRALWNHDLGIKVRLRLDPYFYAWSLRFLRECTATRLRANTDVKLRLALYSRDCINALSDATGIQYDERKKGILYFFRSQKSFDTGADNYRYLGEHGLPIEIVGRDRLAELEPGLAGVKGKIAGGIYSPIDQTGDSKQFVDKLAAYAAEKLGVRFLFGTTVQGLDIEGDHVRAVMTSAGPVTGDAVVISMGPESGLIGRRYGIDLPVYPVKGYTATIPLEDESKGPTMGGADEDRLIGYSRLGNRLRMSSTAEFTGFDRAFKPRDFRTILETGKDLFPGAFDEKKAVLWAGLRPMMPNSVPIFGQAKYRNLYLDTGHGHLGWTMACGSGKFLADLVAGRKPEIDPQGLLYAN
>CP034447.1|AZO20010.1|1000534_1000972_-|hypothetical-protein
MRLQHIVISAALCSLVAASAYSEETDRYRLEKSANGYVRMDTQTGAMSICEERSGQLVCKMAADERAAFQDEIDRLQGSVKALDERVAKLENSLSAQLESKLPSEEDFNKTMSYMERFFRSFMDIVKDMDKENGDGGAKPAPQKT
>CP034447.1|AZO20011.1|1001059_1001437_+|DUF952-domain-containing-protein
MVRSDYSATMSQIIYKIAPEAMWREAERNGRFTGAPIDIADGFIHFSTAAQVRETAAKHFAGQADLLLIAIDEAKLGTALKYEVSRGGALFPHLYAPLDLDAVLWVKPLPLGADGSHQFSALEGE
>CP034447.1|AZO20012.1|1001433_1002510_+|quinone-dependent-dihydroorotate-dehydrogenase
MSLLDRIGQKLLFSFDPETAHGMSIAVLRCGLPVASPPMRDARLMVSLCGLDFPNPLGMAAGYDKNAEVPDALLKLGFGFAEVGTITPLPQRGNPKPRIFRLTADEAVINRLGFNNEGHAAAEKRLAARKGREGIVGVNIGANKDSADRIGDYERGVARFAPYASYLTVNISSPNTPGLRNMQAREQLGELLSRVMAARAKAAAHPPIFLKIAPDLAEAELEDVAAEVIEKEIDGVIVSNTTLSRAGLRSASLAGETGGLSGKPLFERSTAVLARMRKLLGPEMAIIGVGGVDSAETALEKTRAGADLVQLYTGMIYAGPALPGRIVAGMARFVERERLTSLRELRDSRVDAWAARSL
>CP034447.1|AZO20013.1|1002547_1003072_-|hypothetical-protein
MSGELQQVEPMIIKGSRTKGFLCLVPSAAFVWLGAYLIRDYMNKPIFAALKMIVAGSLGISFFGLCSLIFAWLIIRPHFLILDGGGFTVGGGLIRTPFKIAWQDVQGFHIRRQRRSKAVGFRFEPSAKPRSDGRPRIEGGLPRGWRLSTEKMVETLNSYRLQALHGELSQSSTS
>CP034447.1|AZO25612.1|1003147_1004407_-|MATE-family-efflux-transporter
MTLAYLTTPLLGIVDTAVVGQFGDAALLGGLAAGALVFDVVFTTFNFLRSGTTGLVAQAFGRGDPLEEQAVLWRAVLIAVVAGVVLAALAPLFAVAGQWFMGAEPRVSAAMSVYIRIRLLAAPFSLVNYAILGYVLGRGEGGLGLMLQAVLNGINILLCFLLGLELGWGVAGVAWATVTGEFLAMLLGLAIVLARFRKLERPSRRRILDLPAYRRMLSLNRDIMIRSFSLLAAFALFTRQGAQFGTVTLAANAVLMNFFLVAGYFLDGFATAAEQLAGRAIGAHAATPFRQAVRLTLIWGFGLAGAASLVLLTAGASLVALVTTAPEVRAVADTYLPWAAFTALSGVLAFQMDGVFIGATWSRDMRNMMLVSFLAFSAALITLAPAFGNSGLWAALHVFLLVRGLSLLAVLRLRVRTAF
>CP034447.1|AZO20014.1|1004623_1005526_+|histone-deacetylase
MPLQIVHHPDYDAGFAVNHRFPMSKYPLLMEALRNCGLAVQDALSTPEPAPPAWLKLAHAEDYVDQVLACEVPEKIEREIGFPVGQRVSLRAQLATAGTVLAARLALRHGIACNAAGGSHHARRMQGAGFCTFNDVAVASLALLAERAVENILIVDLDVHQGDGTADILKDEPRAFTFSMHGERNYPLRKIASDLDVALPDGTGDAAYLDRLGAILPELSEARRWDIVFYNAGVDVHAEDRLGRLALSDQGLRARDEMVIAHFKARGIPLCGVIGGGYSTDVPALAARHAILFEAAARYA
>CP034447.1|AZO20015.1|1005623_1005887_-|hypothetical-protein
MSALTRFLGDTLLRVLVKLLVVSFLVGLVMHAFGWSPMDVFYGIRQFFIDLWNLGFHAIDRFLGYILLGAAIVVPVFILLRIASYRK
>CP034447.1|AZO20016.1|1006156_1006657_-|hypothetical-protein
MSEANKMYADPQRIGWRLIARAIALFAALLTTLPADAETVRGSPGGQIIVFALHVAKLRAADEPVAFDGACDSACTLYLSLPADRLCVTPRASFGFHLPYGVGAEQNAVAADYLISQYPDWVRQWIGEHGGLSRTIVRMEADEAAKHLPPCGTLAQATTIAFASSR
>CP034447.1|AZO20017.1|1006703_1006934_+|hypothetical-protein
MKTSNFQVRPLPALSQQQGFWKIKALFDRIPKGAITFIESVKQAHVAASMTDWAAAGEQSRDYGETEAGHLAMAGC
>CP034447.1|AZO20018.1|1007039_1007375_-|protamine-2-(modular-protein)
MERRLFLTGMLGVAGAAALASLAGPSKAVAGIPGGNGILDELDKPDPTVFEDGEDKAELEQVYHRYWHHGYYGRRRRRRRRVWRRVCRRYWRHGYWRRRCWRERVWIGIWL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_3

1942264-1942356

Orphan

Consensus_repeat	Method
CCCAAAACCGCTACGCACTTTTGGGCGACATGCG	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP034447_3

>merge|CP034447|3|1942264-1942356|CRISPRCasFinder
CCCAAAACCGCTACGCACTTTTGGGCGACATGCGGTTCTTGCATGACGCATGTCGTTATCCCAAAACCGCTACGCACTTTTGGGCGACATGCG

>CP034447|3|3|1942264-1942356|CRISPRCasFinder
CCCAAAACCGCTACGCACTTTTGGGCGACATGCG	GTTCTTGCATGACGCATGTCGTTAT
CCCAAAACCGCTACGCACTTTTGGGCGACATGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO20843.1\|1940749_1941457_-\|calcium-binding-protein	unknown	unknown	gnl\|CDD\|226830
CP034447.1\|AZO20847.1\|1944666_1945500_-\|shikimate-dehydrogenase	unknown	unknown	gnl\|CDD\|234703
CP034447.1\|AZO20852.1\|1950745_1952761_-\|thioredoxin-domain-containing-protein	unknown	unknown	gnl\|CDD\|224250
CP034447.1\|AZO20837.1\|1935553_1935916_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868
CP034447.1\|AZO20840.1\|1938703_1939072_-\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP034447.1\|AZO25660.1\|1944059_1944656_-\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|234620
CP034447.1\|AZO20848.1\|1945492_1946092_-\|Maf-like-protein	unknown	unknown	gnl\|CDD\|167380
CP034447.1\|AZO25661.1\|1948593_1949130_+\|protoporphyrinogen-oxidase-HemJ	unknown	unknown	gnl\|CDD\|224892
CP034447.1\|AZO20850.1\|1947562_1948591_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
CP034447.1\|AZO20851.1\|1949308_1950574_+\|transcription-termination-factor-Rho	unknown	unknown	gnl\|CDD\|236490
CP034447.1\|AZO25659.1\|1938593_1938671_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20838.1\|1936145_1937423_+\|polyhydroxyalkanoate-depolymerase	unknown	unknown	gnl\|CDD\|226926
CP034447.1\|AZO20846.1\|1943277_1943985_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP034447.1\|AZO20842.1\|1939620_1940727_-\|transglycosylase	unknown	unknown	gnl\|CDD\|225377
CP034447.1\|AZO20839.1\|1937701_1938319_+\|transglutaminase	unknown	unknown	gnl\|CDD\|368714
CP034447.1\|AZO20849.1\|1946339_1947161_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|235419
CP034447.1\|AZO20836.1\|1935059_1935245_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO20845.1\|1942454_1942955_+\|protein-export-chaperone-SecB	unknown	unknown	gnl\|CDD\|224863
CP034447.1\|AZO20844.1\|1941669_1942164_+\|membrane-protein-FxsA	unknown	unknown	gnl\|CDD\|225574
CP034447.1\|AZO20841.1\|1939099_1939624_-\|DNA-mismatch-repair-protein-MutS	unknown	unknown	gnl\|CDD\|225396

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO20843.1\|1940749_1941457_-\|calcium-binding-protein	gnl\|CDD\|226830	COG4395, COG4395, Uncharacterized protein conserved in bacteria [Function unknown].	1.52314e-88
CP034447.1\|AZO20847.1\|1944666_1945500_-\|shikimate-dehydrogenase	gnl\|CDD\|234703	PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed.	4.83485e-122
CP034447.1\|AZO20852.1\|1950745_1952761_-\|thioredoxin-domain-containing-protein	gnl\|CDD\|224250	COG1331, COG1331, Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones].	0
CP034447.1\|AZO20837.1\|1935553_1935916_+\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	8.4132e-48
CP034447.1\|AZO20840.1\|1938703_1939072_-\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.0371e-10
CP034447.1\|AZO20838.1\|1936145_1937423_+\|polyhydroxyalkanoate-depolymerase	gnl\|CDD\|226926	COG4553, DepA, Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism].	0
CP034447.1\|AZO20849.1\|1946339_1947161_-\|kinase/pyrophosphorylase	gnl\|CDD\|235419	PRK05339, PRK05339, pyruvate, phosphate dikinase/phosphoenolpyruvate synthase regulator.	2.01317e-136
CP034447.1\|AZO20848.1\|1945492_1946092_-\|Maf-like-protein	gnl\|CDD\|167380	PRK02478, PRK02478, Maf-like protein; Reviewed.	4.79156e-122
CP034447.1\|AZO20850.1\|1947562_1948591_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
CP034447.1\|AZO20851.1\|1949308_1950574_+\|transcription-termination-factor-Rho	gnl\|CDD\|236490	PRK09376, rho, transcription termination factor Rho; Provisional.	0
CP034447.1\|AZO25660.1\|1944059_1944656_-\|dephospho-CoA-kinase	gnl\|CDD\|234620	PRK00081, coaE, dephospho-CoA kinase; Reviewed.	1.23521e-80
CP034447.1\|AZO20842.1\|1939620_1940727_-\|transglycosylase	gnl\|CDD\|225377	COG2821, MltA, Membrane-bound lytic murein transglycosylase [Cell envelope biogenesis, outer membrane].	4.35117e-150
CP034447.1\|AZO20839.1\|1937701_1938319_+\|transglutaminase	gnl\|CDD\|368714	pfam06035, Peptidase_C93, Bacterial transglutaminase-like cysteine proteinase BTLCP. Members of this family are predicted to be bacterial transglutaminase-like cysteine proteinases. They contain a conserved Cys-His-Asp catalytic triad. Their structure is predicted to be similar to that of Salmonella typhimurium N-hydroxyarylamine O-acetyltransferase, in pfam00797, however they lack the sub-domain which is important for arylamine recognition.	1.4566e-97
CP034447.1\|AZO25661.1\|1948593_1949130_+\|protoporphyrinogen-oxidase-HemJ	gnl\|CDD\|224892	COG1981, COG1981, Predicted membrane protein [Function unknown].	4.19842e-69
CP034447.1\|AZO20846.1\|1943277_1943985_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.27442e-111
CP034447.1\|AZO20845.1\|1942454_1942955_+\|protein-export-chaperone-SecB	gnl\|CDD\|224863	COG1952, SecB, Preprotein translocase subunit SecB [Intracellular trafficking and secretion].	2.06616e-72
CP034447.1\|AZO20844.1\|1941669_1942164_+\|membrane-protein-FxsA	gnl\|CDD\|225574	COG3030, FxsA, Protein affecting phage T7 exclusion by the F plasmid [General function prediction only].	4.69366e-47
CP034447.1\|AZO20841.1\|1939099_1939624_-\|DNA-mismatch-repair-protein-MutS	gnl\|CDD\|225396	COG2840, COG2840, Uncharacterized protein conserved in bacteria [Function unknown].	5.83495e-52

>CP034447.1|AZO20844.1|1941669_1942164_+|membrane-protein-FxsA
MRVSLFPLFLLLLPLLEIAGFVIVGREVGALATVALVVLSTIAGSLLLRHQGFGVMARVRAEMDAGRDPSRQLAHGAMIVLAAILLIIPGFITDIFAILLLLPPVRDLAWRLLKSRIVMATSFSSGFSARGRDKVIDLDDSDYSRDDYKRGPDHNSPWRRLKDD
>CP034447.1|AZO20843.1|1940749_1941457_-|calcium-binding-protein
MGFFDFGTIFFLIAAVVIFFQLRNVLGRRTGNERPPFDPYSASRTRDQDAAQKSENVVSLPRKRMPGETAAETYAAIDAFAKPDSDLNKGLRTIKDSDPSFDPKTFVDGAKMAYEMIVMAFADGDRKTLKNLLSREVYDSFAAAIGEREAKSEKIQSSFVGIDKVDVVAAEMKGSEAHITLRIVSELISATRDKVGAVIDGDPEKVAEVKDVWTFFRDTRSRDPNWKLVATEEED
>CP034447.1|AZO20842.1|1939620_1940727_-|transglycosylase
MPLFPTFSEKSFGDLPGWDEDDHLAAFAAFRRSAFHVLTKPYRTGSLGIDFNAFAGTYAEARSVSPANRSQARSFFERHFVPVLVPADNGDAGLVTGFYEPQVEASPVRTERFVVPLLSRPADLIDIDDKNRPAGMDPYLAFGRDTPAGPVEYPDRGAIERGALSGRNLEIAWLTDKVDAFFIHVQGAARLKMTDGRLCRVTYAAKSGQRFTGPGRILSEIGEIPLEKVTMQSIRAWFKAHPDRVDEILWQNRSYIFFREAPVEDPALGPIAAAKVPLTPGRSVAVDRLLHTFGTPFYIDAPTLTAFDGNPFRRLMIAQDTGSAITGPARGDLFAGSGDAAGEIAGVVRNAADFYALVPRGLVTRGRM
>CP034447.1|AZO20841.1|1939099_1939624_-|DNA-mismatch-repair-protein-MutS
MTRRDDKLSEDDRILWNLVARTTRPLKGKAAIEIPDVIEPKPVPASAPVNGVSAVAAKPKTQHVSHVLDDQTHEKLKKGRLPIEGRVDLHGMTQDEAYSLLLSFLHRAHAGGIRYVLVITGKGSSSGGDGILRRSVPHWLSTPAFRHLVSSHDHAARNHGGSGALYVRLRRTRA
>CP034447.1|AZO20840.1|1938703_1939072_-|XRE-family-transcriptional-regulator
MTPFGERLRALRAERGVSQKAMAQAIGVSAAYLSALEHGRRGAPTWTLIQKIIGYFNIIWDDAEDLARLAETSHPRVRIDTSGLSPAATELANLLAESIEKLDEAELRSITASVRVALGRRG
>CP034447.1|AZO25659.1|1938593_1938671_+|hypothetical-protein
MHVAQKCARFWDNDMHQNKDLKRVA
>CP034447.1|AZO20839.1|1937701_1938319_+|transglutaminase
MNSSPMARMLRLCAVAGMAISAHWAVPAWAAGAMTTGGLTSQPIGHYDFCKAQPSECNIRPANLAPATMTNSLWRKLTGVTARVNAAVKPMSDLDNYGKDEVWTYPDNGFGDCEDYVLEKRRDLYRMGMSLADLLITVVRKPDGEGHSVLTVRTDKGDYVLDNLTDKVKAWDETGYRYLKRQAIDNTGRWVSIRDGQQVLVGSVQ
>CP034447.1|AZO20838.1|1936145_1937423_+|polyhydroxyalkanoate-depolymerase
MFYQLYELNHAVLQPARLYADAVRLFYSNPLNPVSHTPLGRSVAAAAELFERTTRRYGKPQFGLTKTMVDWKTVDVTEKTVWSKPFCNLQRFERSLPADRKPDPKLLIVAPMSGHYATLLRGTVEAMLPHADVHITDWVDARMVPLSKGSFDLDDYVDYIIDMFHALGPDTHVMAVCQPSVPVLAAVAVMEKRGDPFVPSTMTLMGGPIDTRRNPTAVNLLAEEKGIGWFRDNVIMQAPWPVPGFGREVYPGFLQLSGFMSMNLDRHIIAHKDFFMHLVKHDGDNAEKHRDFYDEYLAVMDLTAEFYLQTVDTVFVRHALPKGEMTHRGEAVDPSLIRNVAMFTVEGENDDISGLGQTQAAHDLCVNIPADWQAHYVQPAVGHYGVFNGSRFRSEIVPRIVDFIGSYGRRTRVAAKPKLVRSAKS
>CP034447.1|AZO20837.1|1935553_1935916_+|septal-ring-lytic-transglycosylase-RlpA-family-protein
MKKTNRTALVAATVAAGLMAGASTASSAAAQCGRASWYALHSRTASGERMNPAALTAAHRSLPFGTKLKVTNKNNGRSVVVRINDRGPFIRGRVLDLSRGAASQLGFIGSGHTAVCMARV
>CP034447.1|AZO20836.1|1935059_1935245_-|hypothetical-protein
MRLIRNVLALIVLGIGVLWSLQGLGLVQGSFMTGQREWLYIGLVTMLVGLLGLGWANRSRV
>CP034447.1|AZO20845.1|1942454_1942955_+|protein-export-chaperone-SecB
MASNDDAAAGAANGNGNQAQPSLNVLAQYVKDLSFESPGAPNSLRGRDKAPGIAINVNVNANPLSDKQFDVNLTLNAKASFDQEVLFNVELVYGGVFAISGFPQEHMLPILFIECPRLLFPFARQIIADATRNGGFPPLMLDPIDFAQMFQQRIAEDQAAAKVQVS
>CP034447.1|AZO20846.1|1943277_1943985_-|DNA-polymerase-III-subunit-epsilon
MREIIFDTETTGLDLRDDRIIELGGVELVNRFPTGRTFHKFINPQGRAIHAEAQAVHGISAADLVGKPTFTEVVEEWLAFTDGAKLIAHNATFDIGFLNLEFGRLGHPAIDGARVVDTLALARRKHPMGPNSLDALCRRYGIDNTRRTKHGALLDSELLAEVYIELIGGKQAALVLDAVAIQMNGAGEVADIDISIGARPIALPPRLTEADRAAHAGLVGTLGEKALWLKVAVAG
>CP034447.1|AZO25660.1|1944059_1944656_-|dephospho-CoA-kinase
MIVLGLTGSIGMGKSTTAKMFADAGVPVHDSDETVHRLYSGKAAPLVEAAFPGTTKAGVVDRARLAEKVLGDPAALKKLEAIIHPLVRADADAFLGLHRAAGAPIAVLDIPLLFETGGRNRVDKVVVVTAPAEIQRARVLARPGMSAAKFEAILAKQVPDTEKRRQADFIVDTGQGFDAARRAVEAIVSELTGDKARS
>CP034447.1|AZO20847.1|1944666_1945500_-|shikimate-dehydrogenase
MVEKKAFVTGHPIAHSRSPKIHGYWLAKYGIDGSYRAIDVVPEDFAAFLKSLGENGYRGGNVTIPHKEAAFALVERRDEAAEAIGAVNTLWLEDGVLWGGNTDGLGFAGNLDDYAPGWAGNGPAVVLGAGGASRAVIHALKARGVKDIRIVNRTLARARELSDRFGAGVSAHGAGAVGELLADAGLLVNTTALGMHGNETLAADPAGLPGHAIVTDIVYVPLETPLLAAARARGLKTVDGLGMLLHQAVPGFERWFGKRPEVTPELRRMIVADIEAH
>CP034447.1|AZO20848.1|1945492_1946092_-|Maf-like-protein
MAEKIILASGSLFRKAMLVNAGLDIEAVPADVDERALEAPLQDSGVSPEDVASILAEAKATEVSERRPGALVLGCDQTLSLGDEIFHKPADMEGARSHLLALSGKTHQLNSAAVLCRDGEVLWRHVGVVSLTMRKLDPAFIGRHLARVGAKALASVGAYQIESEGIQLFEKIEGDYFTIVGLPLLPLLKELRALGAIDG
>CP034447.1|AZO20849.1|1946339_1947161_-|kinase/pyrophosphorylase
MNKPQSFFHLHLISDATGETLLAAGRAASAQYKDARAIEHIYPLIRTEKQVAKVFEDIEEEPGIILYTVVDQKLARSIDERCAAMGLPCVSVLEPVLAVFQSYLGTPAGRRVGAQHVLDAEYFRRIDALNFTMEHDDGQLPANMDDADIVLIGISRTSKTPTSIYLANRGIKTANIPIVLGVPLPESLIAAKTPLIVGLVATAERISHVRQNRILGNTAPYVSTDYIDRAAINEELAYARQLCTKHGWPMIDVSRRSIEETAAAIVALRGKTR
>CP034447.1|AZO20850.1|1947562_1948591_+|uroporphyrinogen-decarboxylase
MAGKRIMLDVLKGETVSPPPLWMMRQAGRYLPEYRETRKRAGSFLDLCYDPDLAVEVTLQPIERFGFDASILFSDILVVPDALGREVRFEEGHGPILKPIAAAEIAALNGETFHVNLEPVYETVRRLRAKLPDETTLIGFCGAPWTVATYMIAGHGTPDQGPARLFAYREPGAFARLLKILADHSAAYLIRQIEAGADVVQIFDSWSGVLDEASFDAFCVEPVAEIVRQVKAAHPDVPVIGFPKGAGERYRDYRKKTGITGLGLDWTVPLSMARELQGEGAVQGNLDPLRLVAGGKALADGVDAILRTLGDGPLIFNLGHGITPETPVAHVEAMVKMVRRAS
>CP034447.1|AZO25661.1|1948593_1949130_+|protoporphyrinogen-oxidase-HemJ
MMGKGELGGGAGAMRRAAIAIAVFLALAGLLFLLGPDDFYPWAKAIHVIAVISWMAGMLYLPRLFVYHADAEMGSVQSETFKVMERRLLRGIINPAMIVTWAFGLWLAWKGFGFQGGWLHAKILAVLLLSGLHGYLAGAVRKFAGDKNEKPARHWRIVNEIPTLLMVVIVILVIVKPF
>CP034447.1|AZO20851.1|1949308_1950574_+|transcription-termination-factor-Rho
MQEMKLTEFKNKKPPELIAYAESLEVENASVMRKQELMFAILKKLAAQDIEIIGDGVVEVLQDGFGFLRSANANYLPGPDDIYISPSQIRRFSLKTGDTVEGPIRSPKEGERYFALLKVNTINFDDPEKIRHKIHFDNLTPLYPTKRLKMEIENPTSKDISPRVIDLVAPIGKGQRALINAQPRTGKTVLMQNIAHSITANHPECYLIVLLIDERPEEVTDMQRSVKGEVISSTFDEPAARHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKGTGNCEIQLDRKVADKRIYPAMDILKSGTRKEDLLVPRADLQKIFVLRRILAPMGTTDAIEFLIDKLKQTKTNADFFDSMNT
>CP034447.1|AZO20852.1|1950745_1952761_-|thioredoxin-domain-containing-protein
MTLPARNMLAEEASPYLQQHSDNPVHWRAWSPAALAEAKESGRPILLSIGYAACHWCHVMAHESFENDTVAAVMNRLFVNIKVDREERPDIDQIYMAALHAMGEQGGWPLTMFLTPDGKPFWGGTYFPREARYGRPGFIQVLEAVDKAWREKQQSLAESADGLTAHVEQRLAGAKGKAVLDRDTLADLGNRIGGMIDRDLGGLSGAPKFPNAPFMHSLWLSWLRDGQTAHRDAVLLSLEKMLAGGIYDHVGGGLSRYSTDAEWLVPHFEKMLYDNAQLIRMCNWAFAAAGNDLFRIRIEETVAWLLREMRVDGGAFAASLDADSEGEEGLFYTWSKEEIEAALVDDSALFFRYFELAAPHGWEGKPIIRQTEEQQRLGIADCARLAPLKAKLLARREKRVRPGRDGKALTDWNGLMIAALAEAGRSLARADWIEAAAKAFAHIVEAGQHGRLPHSMLGSKKLFPALSSDYAAMTNAAIALFEATSDPAYSEQARQFVDQLDRWHQDSEKTGYYLTASDSGDVLIRIRGDVDEAIPSATSQVVEALVRLSSLTGDPDLWEKAWTTAEHAMGRAAQQAYGQAGIVNACALALEPLKLVIIDKADSSMLVPVANRNPDPRRVDIVVPVGTEANRALLPGGVLPPTDKPGAWFCSGQVCLPAVTGPEELEKLLRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_4

2466339-2466492

Orphan

Consensus_repeat	Method
TAAGCAATTCCAGGAAAAGTGTGTAACGGTTTTCCGTCCGGAATTGCGCAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_4

>merge|CP034447|4|2466339-2466492|CRISPRCasFinder
TAAGCAATTCCAGGAAAAGTGTGTAACGGTTTTCCGTCCGGAATTGCGCAAAATCAAACATTTAGAGCGGATCAGCGATTCTGTGAAAAGCTGAGCCGCTCTAAGCAATTCCAGGAAAAGTGTGTAACGGTTTTCCGTCCGGAATTGCGTAAAA

>CP034447|4|4|2466339-2466492|CRISPRCasFinder
TAAGCAATTCCAGGAAAAGTGTGTAACGGTTTTCCGTCCGGAATTGCGCAAAA	TCAAACATTTAGAGCGGATCAGCGATTCTGTGAAAAGCTGAGCCGCTC
TAAGCAATTCCAGGAAAAGTGTGTAACGGTTTTCCGTCCGGAATTGCGTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO21332.1\|2452902_2453775_+\|glutathione-S-transferase-family-protein	unknown	unknown	gnl\|CDD\|223698
CP034447.1\|AZO21338.1\|2461255_2462179_+\|DUF2865-domain-containing-protein	unknown	unknown	gnl\|CDD\|371363
CP034447.1\|AZO21343.1\|2469103_2469955_+\|phosphate-ABC-transporter-permease-PstA	unknown	unknown	gnl\|CDD\|183065
CP034447.1\|AZO21336.1\|2460146_2460515_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO25683.1\|2456484_2457345_+\|integrase	unknown	unknown	gnl\|CDD\|271193
CP034447.1\|AZO21349.1\|2476390_2477635_-\|ROK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224851
CP034447.1\|AZO21340.1\|2462854_2466238_+\|response-regulator	unknown	unknown	gnl\|CDD\|236848
CP034447.1\|AZO21344.1\|2469951_2470755_+\|phosphate-ABC-transporter-ATP-binding-protein-PstB	unknown	unknown	gnl\|CDD\|182692
CP034447.1\|AZO21345.1\|2470775_2471483_+\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|273990
CP034447.1\|AZO21346.1\|2471502_2472192_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	unknown	unknown	gnl\|CDD\|131209
CP034447.1\|AZO21334.1\|2457358_2458546_+\|IS91-family-transposase	unknown	unknown	gnl\|CDD\|377437
CP034447.1\|AZO21341.1\|2466988_2468047_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	unknown	unknown	gnl\|CDD\|182837
CP034447.1\|AZO21350.1\|2477995_2479036_+\|D-xylose-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380648
CP034447.1\|AZO21342.1\|2468113_2469100_+\|phosphate-ABC-transporter-permease-subunit-PstC	unknown	unknown	gnl\|CDD\|183070
CP034447.1\|AZO21339.1\|2462215_2462572_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO21333.1\|2454832_2456020_+\|IS91-family-transposase	unknown	unknown	gnl\|CDD\|377437
CP034447.1\|AZO21348.1\|2474452_2476174_+\|adenylate/guanylate-cyclase-domain-containing-protein	unknown	unknown	gnl\|CDD\|227903
CP034447.1\|AZO21335.1\|2458952_2459907_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
CP034447.1\|AZO21337.1\|2460548_2460764_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO21347.1\|2472632_2473664_+\|alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176234

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO21338.1\|2461255_2462179_+\|DUF2865-domain-containing-protein	gnl\|CDD\|371363	pfam11064, DUF2865, Protein of unknown function (DUF2865). This bacterial family of proteins has no known function.	1.10424e-21
CP034447.1\|AZO21332.1\|2452902_2453775_+\|glutathione-S-transferase-family-protein	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	6.77337e-22
CP034447.1\|AZO21343.1\|2469103_2469955_+\|phosphate-ABC-transporter-permease-PstA	gnl\|CDD\|183065	PRK11268, pstA, phosphate ABC transporter permease PstA.	2.55238e-132
CP034447.1\|AZO25683.1\|2456484_2457345_+\|integrase	gnl\|CDD\|271193	cd01193, INT_IntI_C, Integron integrase and similar protiens, C-terminal catalytic domain. Integron integrases mediate site-specific DNA recombination between a proximal primary site (attI) and a secondary target site (attC) found within mobile gene cassettes encoding resistance or virulence factors. Unlike other site specific recombinases, the attC sites lack sequence conservation. Integron integrase exhibits broader DNA specificity by recognizing the non-conserved attC sites. The structure shows that DNA target site recognition are not dependent on canonical DNA but on the position of two flipped-out bases that interact in cis and in trans with the integrase. Integron-integrases are present in many natural occurring mobile elements, including transposons and conjugative plasmids. Vibrio, Shewanella, Xanthomonas, and Pseudomonas species harbor chromosomal super-integrons. All integron-integrases carry large inserts unlike the TnpF ermF-like proteins also seen in this group.	8.48495e-79
CP034447.1\|AZO21341.1\|2466988_2468047_+\|phosphate-ABC-transporter-substrate-binding-protein-PstS	gnl\|CDD\|182837	PRK10918, PRK10918, phosphate ABC transporter substrate-binding protein PstS.	1.56352e-144
CP034447.1\|AZO21349.1\|2476390_2477635_-\|ROK-family-transcriptional-regulator	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	4.1609e-57
CP034447.1\|AZO21340.1\|2462854_2466238_+\|response-regulator	gnl\|CDD\|236848	PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional.	3.48843e-128
CP034447.1\|AZO21344.1\|2469951_2470755_+\|phosphate-ABC-transporter-ATP-binding-protein-PstB	gnl\|CDD\|182692	PRK10744, pstB, phosphate ABC transporter ATP-binding protein PstB.	0
CP034447.1\|AZO21345.1\|2470775_2471483_+\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|273990	TIGR02135, Uncharacterized_protein, phosphate transport system regulatory protein PhoU. This model describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems. The protein consists of two copies of the domain described by pfam01895. Deletion of PhoU activates constitutive expression of the phosphate ABC transporter and allows phosphate transport, but causes a growth defect and so likely has some second function. [Regulatory functions, Other, Transport and binding proteins, Anions].	1.90587e-69
CP034447.1\|AZO21334.1\|2457358_2458546_+\|IS91-family-transposase	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	6.42755e-85
CP034447.1\|AZO21346.1\|2471502_2472192_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	3.30973e-113
CP034447.1\|AZO21350.1\|2477995_2479036_+\|D-xylose-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380648	cd19993, PBP1_ABC_xylose_binding-like, periplasmic xylose-like sugar-binding component of the ABC-type transport systems. Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic xylose-binding protein is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR.	6.87436e-160
CP034447.1\|AZO21342.1\|2468113_2469100_+\|phosphate-ABC-transporter-permease-subunit-PstC	gnl\|CDD\|183070	PRK11275, pstC, phosphate ABC transporter permease PstC.	1.1781e-128
CP034447.1\|AZO21333.1\|2454832_2456020_+\|IS91-family-transposase	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	6.42755e-85
CP034447.1\|AZO21348.1\|2474452_2476174_+\|adenylate/guanylate-cyclase-domain-containing-protein	gnl\|CDD\|227903	COG5616, COG5616, Predicted integral membrane protein [Function unknown].	8.37817e-60
CP034447.1\|AZO21335.1\|2458952_2459907_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.78789e-49
CP034447.1\|AZO21347.1\|2472632_2473664_+\|alcohol-dehydrogenase	gnl\|CDD\|176234	cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	6.2716e-126

>CP034447.1|AZO21340.1|2462854_2466238_+|response-regulator
MADTDGTVGARGPRDFEGAVGRGEAAVAGAQDQHAAATSEALVNLRRMVDSMPIGVVVLDADLKAEIINRAFYDFWKIDPRRATVGCGFRELMEASRDADPYGVDEAEWQRHIAQREAEIRAGLAGSRQLPRNDGRTLIASLAPLAGGKRLISYVDITDMKHRETEADDARKNLATVLESLPAGVIIYDRDDKFVFANRKLQDTLPALKPVWQPGRTFREALALGHSVGYFRSSGDVEIDNLYSVDKERWLDAILGRYHLPNSHYERLNPDGRWYQVYDMRTDDGTFIGVRVDISDIKAREKALRDSMRQIDLYRHVMDELPVAAFIKAEDLSIEFVNKAWCALTGLPKEDVIGKTDRQLFAAGDAQSYSQDDTEVIATGKGREVEEPVTHRDGTVRQLMTRKSRLVALDGSVHLVGSSTDITDVKARERALKESMSENEVFRSLIDNVPVSIYAKRSDLRQFYVNKGWCDLTGFSKEEAIGKTDVEIFGADGEAFVAGDLAVLRTGETQEVEEKVTLSDGSVRHQFARKGAMIASDGSLYLIGSTTDITELKQREVELSEARQRAVLADRAKSEFLANMSHEIRTPMNGVLGMAELLAKSALDSKQKTFTDIIVKSGNALLTIINDILDFSKIDAGQLVLDPAPFNLAEAIEDVATLVSTRAKEKDLELIVRVQPGLDGQFVGDVGRLRQIVTNLLGNAVKFTDEGHVLVDVTGERVPAGTRLTISITDTGIGIPEDKLKLVFEKFSQVDTSSTRRHEGTGLGLAITSRLVEMMGGEISVDSAEGKGSTFWFTVTLPRAAQGGQRIMPVDVTGARVLIVDDNAVNRSILSEQMASWTFDSCAAESGAEGLKVLIAAAAYGVPVDCVVLDYQMPGMTGAEMARIVRNTAGLAHTPIIMLTSVDQSLANATYRDLGIDAQLIKPARSSILLETLVATIQRHRHGTTAAQPPLIAGAGPAHGAPQASQAQAPAAASDRALLQPPPVRARPRPAGVERGLDILVAEDNEVNQLVFTQILGETRYHFEIVGNGRKALDAFGKLNPRMILMDVSMPEMNGLEATAAIRRLEAEIGTHVPIVGVTAHALKGDRERCLEAGMDDYLPKPISPKALLEKLERWLGPDAEVRRSAS
>CP034447.1|AZO21339.1|2462215_2462572_-|hypothetical-protein
MLLMFGRILSLVLCPVLLAATGCARSDDGTVIIPRQLDVRRVWDKPPQQAQVSPPPVAAGVFPAPPEPARSAPRRYRKPPPAMRPVDTQLPDASSGPEKALACHNVSEPGKRFRVVCD
>CP034447.1|AZO21338.1|2461255_2462179_+|DUF2865-domain-containing-protein
MARLRFLTTSLLAVTALVAFAAVSHADPCGVLRSQMLTGRGTANPELAQLRRQLAAIQGIERQRRCTASSAMGGFFNACADLARSRAEVQRRIAGIGNSGRDDPQARYAALGCQSAPKRQPAAKPQSSDTTFGSNAMLFCVRLSDGYFFPAPNSQFTQGADLKDTVDQCRYICDDPSVDLYTLGDPNLETDQMVAVDTRKPYKELPTAFRYRDDASFKACDLKRYHQRVAELRARTVTPGNMQNAIIPLPTAKPDLGTVSDIPSPAAADAKVRATAAETGAAEDQAPTMPAGSRPVRMIGPAFFPAD
>CP034447.1|AZO21337.1|2460548_2460764_-|hypothetical-protein
MSIHFTVSGLTRNLIHSLGLDHERAPRHLTPEQNLLLECYLAGQIPESAWNDYVFEMPELEKHVTARQAAR
>CP034447.1|AZO21336.1|2460146_2460515_+|hypothetical-protein
MRSTARFSAIVGALLAAPFPASAASLNTMNEVGAALQACWTPPANSGNASVTLSFSFKRDGTLIGPPKPTAIKVGGDDKARQAYVDAATAALRNCLPLSFSPALAQGIAGNVFTLQFNSPKQ
>CP034447.1|AZO21335.1|2458952_2459907_+|IS630-family-transposase
MPKPYSLDLRERVVRFVEAGHSRRAAAAHFGVSVSFVVILMRNYRKTESLAPKASGGRRHSKLDPHRAFLLGCVAEKDDITMPELAAELVTAAGVQVAPASISRWLIRNGYRFKKTLLASEQDRPDISKARQEWRAKRQPRMRLEPHRLVFIDETGTTTKMTRPRGRCLKGRRLRSKAPFGHWKTQTFIAGLRCHGLTAPFVVDTPMNRRIFETYVETQLAPTLAKGDVVILDNLAAHKSPTAEAAIRARGAWLLFLPPYSPDLNPIEMAFAKLKAHLRARAIRTIDALWQAIGDICNLFSPTECRNYFTAAGYGLT
>CP034447.1|AZO21334.1|2457358_2458546_+|IS91-family-transposase
MPARLEVADIFRRHGEAYRQAHDGHLGRVERRTMSAIELCRTAELGGHVEGCRSCGSIRVAYNSCRNRHCPKCQSQACRDWLAARQDELLPVPYFHVVFTLPAEVAAIAFHNKTALYTILFKAAAETLRTIAADPRHLGAEIGLIAVLHSWGQTLTYHPHLHCIVPGGGVSPDGARWISCRPGFFLPVRVLSRLFRRRFLEELRVAHDAGRLGFFGDLAHLAKPDAFARLLAEVRHLEWVVYAKPPFGGPQQVLAYLGRYTHRVAIANSRLVSMADDRVAFRWRDYRHGGRTKVMTLDADEFIRRFLLHTLPDGFHRIRHYGFLANGHRAAKLGLCRRLLASQQQNNLEPSAESAAVAAGRLALTHRCPCCGGAMVTLATWRCGQAPTPFWNDTS
>CP034447.1|AZO25683.1|2456484_2457345_+|integrase
MVELSPLRRRMIEDMTIRNLSPATQRSYVHAVAKFSRYFGRSPDRLGLEDVRAFQVHLVSTGISWPALNQTVCALRFFYGVTLGHAEIPERIVYARLPRTLPVVLSADEVVRFLEAVPSLKTRTALTTAYAAGLRASETVGLKVGDIDSGRGVIRIEHGKGGKDRTVMLSAQLLRILRIYWRLAKPQDWLFPGRGADRPIDVQVLYSACRSARAAAGIDKRVTVHTLRHSFATHLLENGTDIRIIQVLLGHNNLSSTARYTRVSNGLIRRTTSPLDRLNVEVVPPG
>CP034447.1|AZO21333.1|2454832_2456020_+|IS91-family-transposase
MPARLEVADIFRRHGEAYRQAHDGHLGRVERRTMSAIELCRTAELGGHVEGCRSCGSIRVAYNSCRNRHCPKCQSQACRDWLAARQDELLPVPYFHVVFTLPAEVAAIAFHNKTALYTILFKAAAETLRTIAADPRHLGAEIGLIAVLHSWGQTLTYHPHLHCIVPGGGVSPDGARWISCRPGFFLPVRVLSRLFRRRFLEELRVAHDAGRLGFFGDLAHLAKPDAFARLLAEVRHLEWVVYAKPPFGGPQQVLAYLGRYTHRVAIANSRLVSMADDRVAFRWRDYRHGGRTKVMTLDADEFIRRFLLHTLPDGFHRIRHYGFLANGHRAAKLGLCRRLLASQQQNNLEPSAESAAVAAGRLALTHRCPCCGGAMVTLATWRCGQAPTPFWNDTS
>CP034447.1|AZO21332.1|2452902_2453775_+|glutathione-S-transferase-family-protein
MAKAATKGTKKAAAKPAAKAAKPAAKAAAKATTAAKVSAKPAPKATAKAAPKAKAKPAKKPGIKLSMLRPSVNNMTVRVFARAAGLDPAETDAWGLTRTPEFLARNPAHLTPMIEDKGLPRGVLWESCAIMQYLSNKHGLDKFYPKAPAKRAMVDSAMFYLIGTLYPYVARATYPALGFPQYAGEVGHSDAHPDRKSEAQKAAAAAIAEPLEVFHSFFRDGKPFIGGNNPSIADIRLAATLEFLAVIDYALPEWAKDYMAAIEKKLGKAYAEPAGDVRGYIAHVKAQAAS
>CP034447.1|AZO21341.1|2466988_2468047_+|phosphate-ABC-transporter-substrate-binding-protein-PstS
MRHFIRSAAVAIAMAAASTLSISAAMAADISGAGATFPYPIYAKWADAYKKETGTGLNYQSIGSGGGIKQIKAKTVTFGASDAPLKGDELDSTGLAQFPMVMGGIVPVVNLEGVKPGELVLDGPTLADIFIGKITNWNDEAIKKLNPDVKLPDQAIAVVHRSDGSGTTFNFSYYLGDVSADWKSKVGVDKALEWPVGIGAKGNEGVANNVSQTGGAIGYVEYAYAKQNKLTYTDLINKDGKKVEPTAAAFSAAAANADWSSQPGYGVILANQAGAESWPMTSATWILVYKKPDDAAATGEALKFFAWSYAKGDDMAAELDYVPMPDAVVKSVEDMWGKDIVDSNGKPIFSGM
>CP034447.1|AZO21342.1|2468113_2469100_+|phosphate-ABC-transporter-permease-subunit-PstC
MTAVSEAVTSSAMRTREATVRRFAFTDMAFRAATRASAILVLVLLGGVAISLIAGSWEALSKFGVSFLTTESWNPVTENFGALAPIYGTIVTSAIAIIIAVPIGIGIAVFLTELCPRPLRRPIGIAVELLAGIPSIIYGIWGLFVFAPFLQTTVQPFIISLFHGIPGLSSLFAGPPYGIGLLTSSLILAIMVLPFITSITKDVFDTVPAVLKESACGIGCTTWEVTRRVVIPYTRVGIMGGVMLGLGRALGETMAVTFVIGNAHRISASLFAPGTTISATIANEFTEADGALYTSSLVALGLILFIITFIILALARYMLLRIDSRTGA
>CP034447.1|AZO21343.1|2469103_2469955_+|phosphate-ABC-transporter-permease-PstA
MSTATSLYRSRKRKNAVMMALCVIAAGIGLAWLALILGALLYKGLSGVSLAVFTEMTPPPGDAGGLLNAIYGSIVMTIIGIIVGTPIGVLAGTYMAEYGRFSRLTTVVRFINDILLSAPSIIVGLFVYELLVRPMGHFSAIAGAVALSILVIPVVVRTTEDMLNLVPNALREAGTAIGAPRWVVIRSVAYRAALSGIVTGILLAIARISGETAPLLFTALNNQFWSSNLNAPMASLPVTIFQFALSPYEEWQQLAWTGALIITLTVLGLSIFARSLTGRREDR
>CP034447.1|AZO21344.1|2469951_2470755_+|phosphate-ABC-transporter-ATP-binding-protein-PstB
MKPMLSTDLNVADTVVEKAKIEVKNLNFYYGQSKALKDINLSLPERSVTAFIGPSGCGKSTLLRVLNRIYELYPKQNAEGQVLLDGKNILDRSQDLNLLRTKIGMVFQKPTPFPMSIYENIAFGVRLYEKISKTEMDNRVEQALKRAALWSEVKDKLNASGQSLSGGQQQRLCIARTVAVKPEVILLDEPCSALDPLSTAKIEELIDELQADYTIVIVTHNMQQAARVSRQTAFMYLGELVEFDRTEKIFTSPREKRTQDYITGRFG
>CP034447.1|AZO21345.1|2470775_2471483_+|phosphate-signaling-complex-protein-PhoU
MAEHTVASFDEDLRQISQLIIDMGDLAGSMVGASTKALLNSDNAMAQRVVSDDAIMDARQRELDDRAITLIAKRQPMADDLRSVVGAIRMAGDLERIGDLAKNIAKRVGSVGISAAPRDLSHSIDSMAQLVLIQVQGVIEEYTAGDATALAKLRNDDERVDVKYTSVFRELLTYMMEDPRNITACTHLLFCAKNLERIGDHVTNIAENAYYVLTGTQLPANRPKQDETAMPAPAA
>CP034447.1|AZO21346.1|2471502_2472192_+|phosphate-regulon-transcriptional-regulatory-protein-PhoB
MIAPRIMVVEDEEPLGVLLRYNLESEGYQVEVVTRGDEAEIRLQENVPDLLVLDWMVPAVSGIELCRRLRMRPETERLPIIMLTARGEESDRVRGLSTGADDYLVKPFSTPEFMARIKALLRRAKPEVLSSVLKVGDIVLDRESHRVYRKKSEIRLGPTEFRLLEFMMRHPGRVFSRSQLLDNVWGETIYIDERTVDVHVGRLRKAVNNGRMPDVIRTIRGAGYAIRED
>CP034447.1|AZO21347.1|2472632_2473664_+|alcohol-dehydrogenase
MKSLRVVVRHHGGPEVLEIVEEDAPHPASGELRVQTIAAGVSFAELLMREGIHPEKTTLPFTPGWDIVGIVDEAGEGVSHAMIGKMVAALPIHGGYAQFICLPADELTLVPTGVDPAEAVSLVLNYVTAYQMMHRLGHASPGQRVLIHGAAGGVGTALLQLGRLAGLEMYGTASLAAHQIVSDLGATPIDYERVDFVEEIHRLTNDGVDVVFDGVGEANVWRSFRTLRPGGRVIAYGFTSFLQKGQLAGGLRYRLRGILRPAWYAVRAFVSPGRRRILPYSIQYLKRWKLAWFREDLGVLLDLLRDGKIKPMVADRMPLIEARRAQELLGQGGVKGKLVLICN
>CP034447.1|AZO21348.1|2474452_2476174_+|adenylate/guanylate-cyclase-domain-containing-protein
MERKLAAILAADVVAYSALMEADEGGTFERLRASRKELFQPEISKHHGRIFKLMGDGLLAEFGSAVDAVECAVTLQRGMVERNASVPESERFEVRLGINLGEVIVEGDDRYGEGVNVAARLQQLADPGGVCVSEKVSKEVEKKLAFEFEPMGGQRVKNIAEPIYCYRVNLQSVRASSAGRPVSLELPDRAAVAVLPFANMSSDPEQEFFAEGLAEDLITDLAKVPGLLVIARNSSFVYKGRSVDVRSIARDLGVRYVVEGSVQKAAARVRINAQLIDARENTHIWADRFDGELADVFALQDEVVGKIVGALSGSFPSACSLPRQRTSNFEAYELLVRGRSLVTQSQEANKTARPLLERAIQLDPGFAEAHAWLAMSHLLGWMFWGEPEEYRSLGRAEAERAVSLDPGNAGAHSILGYVLQFDFRADEAAAEFATALRIDPNHADTWIFLGESKAHLGNAVEGIECIQNAFRLDPYPPGRCYWLRGYVEYAARRYEDAVDTLRHETTYRTGSRRILAAALAQLGRIEEAKEEARQFLAANPHFSARQWASTQPFRRDADRQHFVDGYLMAGLPE
>CP034447.1|AZO21349.1|2476390_2477635_-|ROK-family-transcriptional-regulator
MSVGIRHDDLRRRNRAMVLSAVRRAGQPSRTEIAATTGLSHSTISAISSDLIQEGILTEGKPSETASLKRGRPQVGLALNPEAAAVVTVVLSLNFLSVAVIDYAGQVIAEEQRRLDTLTMPRDELIGECMAIVRRRLEDPDLDVGSVARIAMGIQGITDSHARAMLWSPITPLTDIPFADILEHEFGIPATMENDCNMMAVALQWRDPDRYHDNFIAILLSHGIGMGLVLKGELFTGTHSSGGEFGHMIHRPGGALCRCGRRGCVEAYAGNYAIWRNAKGMSEDSEPVDVSDADMRALAAKAREKDGPEREAYRRAGEALGFGLGNLFALIDPAPVAVVGVSAAAFDLIEPALREAIAQTAGGQHSKSISFDTEPNELPLIREGCAMRALTFVDQEIFAPGVQARSGATGKNVA
>CP034447.1|AZO21350.1|2477995_2479036_+|D-xylose-ABC-transporter-substrate-binding-protein
MKRFAAAMLAGVAMSLTLASAAEAKDKVIGVSWSNFQEERWKTDEAAMKAAIEAAGDKYISADAQSNPGKQLTDVESLISQGANSLIILAQDASAIGPAVQKALDEGIPVVGYDRLIENKDVFYLTFDNKEVGRMQAREVFKAKPEGNYVFIKGSGSDPNADFLFSGSMEVLKEAIDSGKVKNVGEAYTDGWLPANAQKNMEQFLTANDNKVDAVVAANDGTAGGVVAALTAQGLAGTVPVSGQDGDHAALNRIALGTQTVSVWKDARELGKNAAEIASQLADGKKMTDIAGVKDFTTPGGNTVKSLFLTPVAITKDNLNVVIDAGWIKKDEVCAGVAAGSVAVCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_5

2677650-2677730

Orphan

Consensus_repeat	Method
CGCAATTCCGGACGGAAAAACGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_5

>merge|CP034447|5|2677650-2677730|CRISPRCasFinder
CGCAATTCCGGACGGAAAAACGCGACGCACTCTCCCTGGAATTGCCTTCTTTGTTTGTCGCAATTCCGGACGGAAAACCGC

>CP034447|5|5|2677650-2677730|CRISPRCasFinder
CGCAATTCCGGACGGAAAAACGC	GACGCACTCTCCCTGGAATTGCCTTCTTTGTTTGT
CGCAATTCCGGACGGAAAACCGC

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO25699.1\|2667696_2668281_-\|HupE/UreJ-family-protein	unknown	unknown	gnl\|CDD\|368209
CP034447.1\|AZO21515.1\|2673396_2673930_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|171551
CP034447.1\|AZO21520.1\|2679835_2680615_-\|rhomboid-family-intramembrane-serine-protease	unknown	unknown	gnl\|CDD\|223777
CP034447.1\|AZO21519.1\|2678807_2679557_-\|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein	unknown	unknown	gnl\|CDD\|224997
CP034447.1\|AZO21526.1\|2684269_2684557_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO21513.1\|2668879_2670088_-\|agmatinase	unknown	unknown	gnl\|CDD\|212516
CP034447.1\|AZO25700.1\|2670905_2671718_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
CP034447.1\|AZO21524.1\|2682381_2683233_+\|YihY/virulence-factor-BrkB-family-protein	unknown	unknown	gnl\|CDD\|224214
CP034447.1\|AZO21521.1\|2680640_2681222_-\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	unknown	unknown	gnl\|CDD\|225007
CP034447.1\|AZO21517.1\|2676703_2677582_-\|3-hydroxybutyryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|181018
CP034447.1\|AZO25701.1\|2674767_2676672_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|182070
CP034447.1\|AZO21518.1\|2677854_2678784_-\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	unknown	unknown	gnl\|CDD\|224936
CP034447.1\|AZO21527.1\|2684709_2685585_-\|tRNA-glutamyl-Q(34)-synthetase-GluQRS	unknown	unknown	gnl\|CDD\|235573
CP034447.1\|AZO21516.1\|2673931_2674570_+\|DUF1109-family-protein	unknown	unknown	gnl\|CDD\|227280
CP034447.1\|AZO21511.1\|2666293_2667301_-\|iron-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270261
CP034447.1\|AZO21523.1\|2681456_2682323_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180343
CP034447.1\|AZO21525.1\|2683202_2684105_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|183067
CP034447.1\|AZO21514.1\|2670099_2670909_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213260
CP034447.1\|AZO21512.1\|2668340_2668877_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236558
CP034447.1\|AZO21522.1\|2681240_2681432_-\|twin-transmembrane-helix-small-protein	unknown	unknown	gnl\|CDD\|380228

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO25699.1\|2667696_2668281_-\|HupE/UreJ-family-protein	gnl\|CDD\|368209	pfam04955, HupE_UreJ, HupE / UreJ protein. This family of proteins are hydrogenase / urease accessory proteins. The alignment contains many conserved histidines that are likely to be involved in nickel binding. The members usually have five membrane-spanning regions.	2.25042e-33
CP034447.1\|AZO21515.1\|2673396_2673930_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|171551	PRK12512, PRK12512, RNA polymerase sigma factor; Provisional.	1.37457e-82
CP034447.1\|AZO21520.1\|2679835_2680615_-\|rhomboid-family-intramembrane-serine-protease	gnl\|CDD\|223777	COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism].	1.23238e-46
CP034447.1\|AZO21519.1\|2678807_2679557_-\|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein	gnl\|CDD\|224997	COG2086, FixA, Electron transfer flavoprotein, beta subunit [Energy production and conversion].	5.84651e-99
CP034447.1\|AZO21513.1\|2668879_2670088_-\|agmatinase	gnl\|CDD\|212516	cd09990, Agmatinase-like, Agmatinase-like family. Agmatinase subfamily currently includes metalloenzymes such as agmatinase, guanidinobutyrase, guanidopropionase, formimidoylglutamase and proclavaminate amidinohydrolase. Agmatinase (agmatine ureohydrolase; SpeB; EC=3.5.3.11) is the key enzyme in the synthesis of polyamine putrescine; it catalyzes hydrolysis of agmatine to yield putrescine and urea. This enzyme has been found in bacteria, archaea and eukaryotes, requiring divalent Mn and sometimes Zn, Co or Ca for activity. In mammals, the highest level of agmatinase mRNA was found in liver and kidney. However, catabolism of agmatine via agmatinase apparently is a not major path; it is mostly catabolized via diamine oxidase. Agmatinase has been shown to be down-regulated in tumor renal cells. Guanidinobutyrase (Gbh, EC=3.5.3.7) catalyzes hydrolysis of 4-guanidinobutanoate to yield 4-aminobutanoate and urea in arginine degradation pathway. Activity has been shown for purified enzyme from Arthrobacter sp. KUJ 8602. Additionally, guanidinobutyrase is able to hydrolyze D-arginine, 3-guanidinopropionate, 5-guanidinovaleriate and L-arginine with much less affinity, having divalent Zn ions for catalysis. Proclavaminate amidinohydrolase (Pah, EC 3.5.3.22) hydrolyzes amidinoproclavaminate to yield proclavaminate and urea in clavulanic acid biosynthesis. Activity has been shown for purified enzyme from Streptomyces clavuligerus. Clavulanic acid is the effective inhibitor of beta-lactamases. This acid is used in combination with the penicillin amoxicillin to prevent antibiotic's beta-lactam rings from hydrolysis, thus keeping the antibiotics biologically active.	8.65699e-132
CP034447.1\|AZO25700.1\|2670905_2671718_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	1.46475e-43
CP034447.1\|AZO21524.1\|2682381_2683233_+\|YihY/virulence-factor-BrkB-family-protein	gnl\|CDD\|224214	COG1295, Rbn, Ribonuclease BN family enzyme [Replication, recombination, and repair].	1.08526e-56
CP034447.1\|AZO21521.1\|2680640_2681222_-\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	gnl\|CDD\|225007	COG2096, COG2096, cob(I)alamin adenosyltransferase [Coenzyme transport and metabolism].	2.45097e-86
CP034447.1\|AZO21517.1\|2676703_2677582_-\|3-hydroxybutyryl-CoA-dehydrogenase	gnl\|CDD\|181018	PRK07530, PRK07530, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	0
CP034447.1\|AZO25701.1\|2674767_2676672_+\|PAS-domain-S-box-protein	gnl\|CDD\|182070	PRK09776, PRK09776, putative diguanylate cyclase; Provisional.	5.92149e-166
CP034447.1\|AZO21518.1\|2677854_2678784_-\|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.72989e-121
CP034447.1\|AZO21527.1\|2684709_2685585_-\|tRNA-glutamyl-Q(34)-synthetase-GluQRS	gnl\|CDD\|235573	PRK05710, PRK05710, tRNA glutamyl-Q(34) synthetase GluQRS.	7.60451e-113
CP034447.1\|AZO21516.1\|2673931_2674570_+\|DUF1109-family-protein	gnl\|CDD\|227280	COG4944, COG4944, Uncharacterized protein conserved in bacteria [Function unknown].	6.86489e-71
CP034447.1\|AZO21511.1\|2666293_2667301_-\|iron-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270261	cd13543, PBP2_Fbp, Substrate binding domain of ferric iron transporter, a member of the type 2 periplasmic binding fold superfamily. The periplasmic iron binding protein plays an essential role in the iron uptake pathway of Gram-negative pathogenic bacteria from the Pasteurellaceae and Neisseriaceae families and is critical for survival of these pathogens within the host. This periplasmic protein (Fbp) has high affinities for ferric iron and serves as the primary receptor for transport. After binding iron with high affinity, Fbp interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ferric iron-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	7.41828e-149
CP034447.1\|AZO21523.1\|2681456_2682323_-\|SDR-family-oxidoreductase	gnl\|CDD\|180343	PRK05993, PRK05993, SDR family oxidoreductase.	3.17821e-176
CP034447.1\|AZO21525.1\|2683202_2684105_-\|DMT-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	8.30767e-17
CP034447.1\|AZO21514.1\|2670099_2670909_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213260	cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters. NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.76341e-89
CP034447.1\|AZO21512.1\|2668340_2668877_-\|hypothetical-protein	gnl\|CDD\|236558	PRK09545, znuA, zinc ABC transporter substrate-binding protein ZnuA.	1.01124e-05
CP034447.1\|AZO21522.1\|2681240_2681432_-\|twin-transmembrane-helix-small-protein	gnl\|CDD\|380228	NF033233, twin_helix, twin transmembrane helix small protein. Members of the seed alignment for this family are small (average length 68 residues), strictly bacterial, and extremely hydrophobic. Pfam model PF04588 (HIG_1_N) includes both eukaryotic proteins, including a protein from the fish Gillichthys mirabilis, and the members of this family. Similarity between those eukaryotic proteins and the members o this model may represent convergent evolution related to the similar composition of their transmembrane alpha-helical regions, rather than a common origin or common function.	2.92925e-09

>CP034447.1|AZO21517.1|2676703_2677582_-|3-hydroxybutyryl-CoA-dehydrogenase
MSKIETIGIVGAGQMGGGIAHVAALAGYKVLIHDVTSDRIEKGIATISGNMARQVGSGKLEEKARNEAMGRISSAAAMADLAAADLVIEAATEDETVKRKIYAQLCPQLNPEAILATNTSSISITRLAAQTDRPERFIGIHFMNPVPVMKLVELVRGIATEDKTFEAAKAFVNHLDKTITVSEDFPAFIVNRILLPMINEAIYTLYEGVGTVDAIDTAMRLGANHPMGPLQLADFIGLDTCLSIMQVLHEGLSDSKYRPCPLLVKYVEAGWLGRKTGRGFYDYRGDHPVPTR
>CP034447.1|AZO25701.1|2674767_2676672_+|PAS-domain-S-box-protein
MTAGIIAVAASILSPGFQPGVAALRLCLQLSIAVIGASLFLFALFIRRIADDHRQIAESEQRFRRAMEDSAIGVAIVGLDGRILQTNPAFAAMLGYSRAEIEALTFFQITHPDDLQIGRETMIALKEGKIDSFHFEKRYLKKDGTPVWAQLAGSVIREEETHRPLYLVSQIEDIDARKRAEARIAEAETRWNFALTSAGQGVWSLDARKGGTTYSETWVRMLGYADGELDGDPDRWLTMIHPDDRELVAEADRAHLAGETPFFEAEFRMRHKEGHWVWILDRGKAIERDGEGRLIRAIGSLTDITQRKQAEERLKVSAAMLADEKERLKVTLQSIGDAVICTDAANRITFMNPVAEKLTCVAAGDALGKVLGHVYWAVDEETGQRIGLTRPSAVDRQHCDQNTRAVLVRRDDTRCSIRQVVSPIMNDRDEFCGLVIVFQDFTDARALQRQLAYAAAHDALTGLANRSSFIRTMEELVDQCRLNGGEHQFMFVDLDHFKAVNDTGGHAAGDALLKSIADAIRNGLGPEDIVARLGGDEFAVILKSGAPTRAMIAARSIIDAIRNLNFSWDGRPHSIGASIGLAPIRADCGEVDEIIARADAACYAAKAAGRGCVSAAPDEVSKDEAMPLPLAAAS
>CP034447.1|AZO21516.1|2673931_2674570_+|DUF1109-family-protein
MRTEDLIKALDADARSKAMPQDSAWWLAVAAAAVIGATVFWLTIGPRPDIMAAMHTMRFLAKFVFTIALGVSAFALIRALSTPGASTARAAAWMAVAPLLVVVAVALELFAVPSPEWGRRLVGTNWYICLTFIPLIGIGPLAVFLAALRHGAPTRPMLAGAVAGLLAGGLSATFYAAHCFDDSPLFVAIWYTLAIVILTALGAIGGRLFVRW
>CP034447.1|AZO21515.1|2673396_2673930_+|sigma-70-family-RNA-polymerase-sigma-factor
MTQDEAELSRLLRAAIAGDERAYADFLHRIAALVRGFVRRKIVQGGVDPEDVVQETLLAIHVKRHTWREDAPVLPWVYAIARFKLIDAFRRRGRRIEVEIDEIAETFAEPEAETVSERDIARALDGLPPAQRSVVSSISVDGRSIGETAAKLGVSETAVRVSLHRGLAAIAKRFGQQ
>CP034447.1|AZO25700.1|2670905_2671718_-|ABC-transporter-permease
MINATVSRGGAVLLGTLPFAAVAVAYLSASAQRLAVNANDKLLPSPAQMWSAFFDLATVPDKRSGDLILWADTYASLVRLFAGVGLATLVALLLGIAIGFIPRVRAFLLPFVTVVCVIPPLALLPILFIALGLGETAKITLIAIGVAPVMVRDIANRVMELPPELIAKAQTLGGNSWTMVLRLVLPQTMPRLITCVRLALGPAWLFLIAAEAIASTEGLGYRIFLVRRYLSMDVILPYVVWITLLAVATDWLLARLSHVVSPWAHPGSGK
>CP034447.1|AZO21514.1|2670099_2670909_-|ATP-binding-cassette-domain-containing-protein
MSRIVVHGLEKSYGDARVLERVSVTAEPGEFLSLVGASGCGKSTFLRILLGQEQQSGGVVVIGDRPIVPEPTPQRGIVFQRYSVFPHLTALQNLLLVEDFRSGGPFGRVFGARRRRARQEAETMLERVGLAHARDLYPASLSGGMQQRLAIAQTLLGRPQILLLDEPFGALDPGIRVEMHELLTELWNEHGMTVVMVTHDIGEAFKLGTRVLVFDKVRHDPQFPSAYGATITYDLKLDHKSRASAREVAEVAAMVGTTRLDNAITTTAS
>CP034447.1|AZO21513.1|2668879_2670088_-|agmatinase
MHRDIPARRHRRAGLFDRQPRQRLHHPNFEIRDMQGWKSIEAEGKLPEDGWRKEQKWALDMGLPGSDSITDKSIPTFARGELPHFAGINTFLKAPYVENVRDVGRYDAAVMGIPFDSGTTYRPGTRFGPQGIRRISALYTPYNYELGVDLREQMTLCDAGDVFTIPANLEKSFDQITKGVSHVASSGALPIMLGGDHSIGFPCVRGIADVTSKRIGIIHFDRHIDIQEKDLDERMHTTPWYWATNLPNVSAANLVQLGIGGWQVPRYGVAEARKRGTNVLTISDIEQMGLEKTAEIALELAWKDADAVYISFDVDSVDCGFVPGTGWPEPGGFLPREALKLLGLVSAPGICGLEVVEVSPPYDTSDITALFGVRVVVEALGSMVAHGTLGKHKSIIDKPTSF
>CP034447.1|AZO21512.1|2668340_2668877_-|hypothetical-protein
MHDDHHHHSHDHGDHHHHHGPTGHHHHPHAVGHNGPAGKPLQWQTPHLPRDRAPEPADQRATDLDLVETAFLDGFARAPDPSSFLRLAGIPFLGETADGSRLHLLRVETQDIVDVGAVMPLIGGAGLTYNPLPAKLTSHRRRLAFVYHDGNGQRPLDFSEARLLIDRSAAAEIAMPGQ
>CP034447.1|AZO25699.1|2667696_2668281_-|HupE/UreJ-family-protein
MLSILTRLAPAAAAVLIPSLAFAHSGGFHVHGLLSGLQHPLAGIDHLLAMLLVGIIAARTGGRAAILVPACFVAAMVAGTMLGIAGTVLPSLESGVALSLVIFGAMVALARPFPLALAATLTALFGLFHGNAHGLEIPETVGGMAYAIGFLASTLALHATGALAALTLRSRPAAIRAAGIGTSLVGVALAAQLI
>CP034447.1|AZO21511.1|2666293_2667301_-|iron-ABC-transporter-substrate-binding-protein
MKLALSILAGAAALALGLIAGPANAEDKGIIVYNAQHESLAKEWAKGFTKETGIKVTLRNGGDSDFSNQIVAEGAASPADVFLTENSPAMALVEAAGLFAPVEADTLAQVPKEYQPSTGKWVGVAARSTVFVYNKDKLKEEQLPKSLLDLADPSWKGRWAASPSGADFQAIVSAMLQLKGEAATADWLKAMKENSTAYKGNSTVMKAVNAGEIDGGVIYHYYYFGDQAKTGENSKNIGQHYFKNQDPGAFVSISGGGVLASSKHPKEAQAFLKWVTGKGGQEVLKTGTSYEYAVGKDAGSNPKLVPLPDLQAPKVDPATLNSKKVIDLMTQAGLL
>CP034447.1|AZO21518.1|2677854_2678784_-|electron-transfer-flavoprotein-subunit-alpha/FixB-family-protein
MAILLIAEHDNATLSDQTAKALSATLQIGSDVDVLVAGKGAKAAADAAAKLKGIRKVLLAEADELAERLAEPLAALVVSLAGSYDAIVAPATSVGKNVSPRVAALLDVAQVSEIIEVVSPDTFKRPIYAGNAIQTVQATDAKKVITVRTASFQAAPEGGSASVETVNAAANPGLSTFVENKLSETDRPELTSAKIIISGGRALGSAEKFQEVILPVADKLGAAVGASRAAVDAGYAPNDWQVGQTGKVVAPDLYIACGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVADYGLVGDLFVILPELQKAL
>CP034447.1|AZO21519.1|2678807_2679557_-|electron-transfer-flavoprotein-subunit-beta/FixA-family-protein
MKILVPVKRVVDANVKVRVKADGLGVELANVKMAMNPFDEIAVEEAIRIKEAGKAEEIIVVSIGPQQAQETLRTALAMGADRAILVKTDEQTEPLGVAKVLKGVVEAEKPGLVILGKQAIDDDSNQTGQMLAALLGWAQGTFASKVELAGDHAKVTREVDGGLQTVELKMPVIVTADLRLNQPRYASLPNIMKAKKKPLDEKSPADYGADVKPRLKVIKTEEPGGRKAGVKVKSVAELVEKLKNEAGVL
>CP034447.1|AZO21520.1|2679835_2680615_-|rhomboid-family-intramembrane-serine-protease
MFIPLYDTNRLRHIRLQYVTISLIVVNALVYLATTLGGENFTNAAVLGLGFIPSVVHDKVELSPEFVVIPESLSYLTYSFLHADIFHLGGNMLFLWVFGDNVEDALGHVRYLIFYLACAAAGAFVQGLVGWDSQVPLIGASGAIAGVVAAYLILYPRVKVWVLAFARIPLRIPAFIPLILWILFQIVMFAAGGEDQVSWACHIGGIIAGAVLVLVLRRRGVPLLAGADGEPDPTPNVQQAPVPTEPGPTPETSAPPSPQ
>CP034447.1|AZO21521.1|2680640_2681222_-|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase
MVKLNKIYTRTGDDGTTGLGTGQRRLKSDLRVEAYGTVDEANACIGMARTHTAVSHPPIDAMLSRIQNDLFDLGADLAVPDEGKPLDYEPLRIVAAQTERVEKDIDLLNKDLRPLKSFVLNGGAPAAAALHLARTVARRAERIMVALAQDPAEHVNREALRYINRVSDFLFVAARAVNDNGNADVLWVPGKNR
>CP034447.1|AZO21522.1|2681240_2681432_-|twin-transmembrane-helix-small-protein
MASVFNILAIIVMAAVVVVLIRGLVNMMRGGSGITSNKLMQARVLLQFIALVLIMLTVYFTRK
>CP034447.1|AZO21523.1|2681456_2682323_-|SDR-family-oxidoreductase
MATPGETTIPAAKELRTIIVTGASSGIGAHCARALKAEGWRVFATARKAGDIAALEADGIEAFYLDYREPESIAALADAVLERTGGTLAALFNNGAYAQPGAIEDLPVEALREQFEANFFGWHDLTRRIVPVMRRQGHGRLVHCSSILGLAPVRFRGAYSASKHAIEGLMLCLRQELEGSGIHLSLIEPGPVTSKIASNGLVWFLKNIDIENSVHRADYQAQLARLQAGGSVSRLKPGPEVVHTALRHALLSQRPRPHYVVTVPARIGVVLKRILPASALYRVLARRA
>CP034447.1|AZO21524.1|2682381_2683233_+|YihY/virulence-factor-BrkB-family-protein
MLRNIVAVKRVLYDAIGHFNTDDGWAMASHLAITSLMALFPFLIFATTLASFLGARAFADTAVHLVFDTWPEQIAKPIAREVQNVLTVRRTDLLTYGVLLAAYFASNGIEALRTSLNRAYRVAETRGIIYRRVQSIIFVLIATACFLAVSVLLVFAPLLARLAEAHFEWIKPYMGTITIWRYVIASTVIVIGLFSVHIWLPAGKRRFVSIIPGIVFTLIAWLAGSTIFAAYLDHFSSYVTTYAGLASIMIAVVFLYIISAIFILGGELNAAISRYLEARARVG
>CP034447.1|AZO21525.1|2683202_2684105_-|DMT-family-transporter
MHSIKRFIPASFVVLWATGFIGARYAMPWAEPFTFLAIRFVLAAVLFAGLTVLLGSRRASREEALHATVAGVLMHGVYLGGVFWAIHRGMPAGLSALIVGLQPLITAVLAGKFLGEAILPRHWAGLAVGLLGVVVVLWPKLGMIGGGVTAATLAASLVSVLGMAAGTIWQKRYASGGDLIPATMWQYVGGSVVTILGSLAFETRTITVNGELIFAMAWLVLVLSVGAIFLLMVMIRDGEMSKVASLFYLVPAVTAVFAWALFGEQLNLLQIAGMAIATLGVGLATARQGKDQPTLARASR
>CP034447.1|AZO21526.1|2684269_2684557_+|hypothetical-protein
MLLHLGTTWLLFAVATVAVFGFFFGTALDAIMKDDGFGSTGNTLLFTLGFFVAVMVANEHGISFKDIRLAVGWGLSGAFVFISVMALIKAGLARL
>CP034447.1|AZO21527.1|2684709_2685585_-|tRNA-glutamyl-Q(34)-synthetase-GluQRS
MTLLTFRFAPSPNGELHLGHAYSALLNQQMAARAGGRLLLRIEDIDITRCTPEFEAGIFHDLKWLGLDWEEPVRRQSEHFAEYRAVLDQLIAEELVYPAFMSRGEIRAFIAETGKRGRDWPRDPDGVPLYPPLDRALPMKERKRRIAGNMPFAWRLDVEAAMARMPGALSWTEFADETMAATRTVEAMPRAWGDVIVARRDIPTSYHLAVVVDDALQQVSHVVRGQDLYAATGVQRLLQELLGLPPPRYFHHRLVLGPDGRKLSKSLKDTGLAALRQAGMSPQDIRPLIGL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_6

3131520-3131599

Orphan

Consensus_repeat	Method
AAAACACTTTTCCTGGAATTGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_6

>merge|CP034447|6|3131520-3131599|CRISPRCasFinder
AAAACACTTTTCCTGGAATTGCGCTTTGTCAGACGCAATTCCGGACGGAAAACCGTAAAACACTTTTCCTGGAATTGCTC

>CP034447|6|6|3131520-3131599|CRISPRCasFinder
AAAACACTTTTCCTGGAATTGCGC	TTTGTCAGACGCAATTCCGGACGGAAAACCGT
AAAACACTTTTCCTGGAATTGCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO21888.1\|3129372_3129954_+\|sarcosine-oxidase-subunit-gamma-family-protein	unknown	unknown	gnl\|CDD\|226949
CP034447.1\|AZO21898.1\|3138231_3139050_+\|N-formylglutamate-amidohydrolase	unknown	unknown	gnl\|CDD\|226441
CP034447.1\|AZO21890.1\|3130346_3130583_-\|DUF680-domain-containing-protein	unknown	unknown	unknown
CP034447.1\|AZO21897.1\|3137256_3138084_-\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
CP034447.1\|AZO21895.1\|3134948_3136190_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173844
CP034447.1\|AZO21885.1\|3124744_3125998_+\|sarcosine-oxidase-subunit-beta	unknown	unknown	gnl\|CDD\|273585
CP034447.1\|AZO21894.1\|3134022_3134838_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187646
CP034447.1\|AZO21899.1\|3139069_3140632_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|273331
CP034447.1\|AZO21886.1\|3126078_3126375_+\|sarcosine-oxidase-subunit-delta	unknown	unknown	gnl\|CDD\|226761
CP034447.1\|AZO21884.1\|3123299_3124058_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180993
CP034447.1\|AZO21893.1\|3133490_3133970_-\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
CP034447.1\|AZO25736.1\|3132393_3133443_-\|phosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|215473
CP034447.1\|AZO21883.1\|3122802_3123189_-\|SET-domain-containing-protein-lysine-N-methyltransferase	unknown	unknown	gnl\|CDD\|225491
CP034447.1\|AZO21891.1\|3130749_3131394_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP034447.1\|AZO21889.1\|3130043_3130268_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO21901.1\|3142263_3143652_+\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143420
CP034447.1\|AZO25735.1\|3124162_3124531_-\|DUF2568-domain-containing-protein	unknown	unknown	gnl\|CDD\|378498
CP034447.1\|AZO21887.1\|3126371_3129380_+\|sarcosine-oxidase-subunit-alpha	unknown	unknown	gnl\|CDD\|273584
CP034447.1\|AZO21900.1\|3140714_3142085_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP034447.1\|AZO21896.1\|3136195_3137233_+\|NADH-oxidoreductase	unknown	unknown	gnl\|CDD\|176251

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO21898.1\|3138231_3139050_+\|N-formylglutamate-amidohydrolase	gnl\|CDD\|226441	COG3931, COG3931, Predicted N-formylglutamate amidohydrolase [Amino acid transport and metabolism].	3.44816e-132
CP034447.1\|AZO21885.1\|3124744_3125998_+\|sarcosine-oxidase-subunit-beta	gnl\|CDD\|273585	TIGR01373, Sarcosine_oxidase_subunit_beta, sarcosine oxidase, beta subunit family, heterotetrameric form. This model describes the beta subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms. [Energy metabolism, Amino acids and amines].	0
CP034447.1\|AZO21897.1\|3137256_3138084_-\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	7.89271e-64
CP034447.1\|AZO21895.1\|3134948_3136190_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173844	cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2. FadE2-like Acyl-CoA dehydrogenase (ACAD). Acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACAD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. ACAD's are generally homotetramers and have an active site glutamate at a conserved position.	0
CP034447.1\|AZO21888.1\|3129372_3129954_+\|sarcosine-oxidase-subunit-gamma-family-protein	gnl\|CDD\|226949	COG4583, COG4583, Sarcosine oxidase gamma subunit [Amino acid transport and metabolism].	1.2732e-60
CP034447.1\|AZO21894.1\|3134022_3134838_-\|SDR-family-oxidoreductase	gnl\|CDD\|187646	cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs. Pseudomonas aeruginosa RhlG is an SDR-family beta-ketoacyl reductase involved in Rhamnolipid biosynthesis. RhlG is similar to but distinct from the FabG family of beta-ketoacyl-acyl carrier protein (ACP) of type II fatty acid synthesis. RhlG and related proteins are classical SDRs, with a canonical active site tetrad and glycine-rich NAD(P)-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.5305e-100
CP034447.1\|AZO21901.1\|3142263_3143652_+\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143420	cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp. PCC 7335 (EDX86601). Uncharacterized aldehyde dehydrogenase of Synechococcus sp. PCC 7335 (locus EDX86601) and other similar sequences, are present in this CD.	0
CP034447.1\|AZO21886.1\|3126078_3126375_+\|sarcosine-oxidase-subunit-delta	gnl\|CDD\|226761	COG4311, SoxD, Sarcosine oxidase delta subunit [Amino acid transport and metabolism].	6.16733e-50
CP034447.1\|AZO21884.1\|3123299_3124058_-\|SDR-family-oxidoreductase	gnl\|CDD\|180993	PRK07478, PRK07478, short chain dehydrogenase; Provisional.	6.21665e-151
CP034447.1\|AZO21893.1\|3133490_3133970_-\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	3.34017e-81
CP034447.1\|AZO25736.1\|3132393_3133443_-\|phosphotransferase-family-protein	gnl\|CDD\|215473	PLN02876, PLN02876, acyl-CoA dehydrogenase.	9.51189e-108
CP034447.1\|AZO21883.1\|3122802_3123189_-\|SET-domain-containing-protein-lysine-N-methyltransferase	gnl\|CDD\|225491	COG2940, COG2940, Proteins containing SET domain [General function prediction only].	1.88411e-28
CP034447.1\|AZO21891.1\|3130749_3131394_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.5345e-19
CP034447.1\|AZO21899.1\|3139069_3140632_+\|amino-acid-permease	gnl\|CDD\|273331	TIGR00907, Choline_transport_protein, amino acid permease (GABA permease). [Transport and binding proteins, Amino acids, peptides and amines].	6.6194e-54
CP034447.1\|AZO25735.1\|3124162_3124531_-\|DUF2568-domain-containing-protein	gnl\|CDD\|378498	pfam10823, DUF2568, Protein of unknown function (DUF2568). One member in this family is annotated as yrdB which is part of a four gene operon however currently no function is known.	7.26095e-16
CP034447.1\|AZO21887.1\|3126371_3129380_+\|sarcosine-oxidase-subunit-alpha	gnl\|CDD\|273584	TIGR01372, sarcosine_oxidase_alpha_subunit, sarcosine oxidase, alpha subunit family, heterotetrameric form. This model describes the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members are share the same function. The model is designated as subfamily rather than equivalog for this reason.Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate. The enzyme is known in monomeric and heterotetrameric (alpha,beta,gamma,delta) forms [Energy metabolism, Amino acids and amines].	0
CP034447.1\|AZO21900.1\|3140714_3142085_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	2.58411e-164
CP034447.1\|AZO21896.1\|3136195_3137233_+\|NADH-oxidoreductase	gnl\|CDD\|176251	cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1. 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the 2-enoyl thioester reductase (ETR) like proteins. ETR catalyzes the NADPH-dependent dependent conversion of trans-2-enoyl acyl carrier protein/coenzyme A (ACP/CoA) to acyl-(ACP/CoA) in fatty acid synthesis. 2-enoyl thioester reductase activity has been linked in Candida tropicalis as essential in maintaining mitiochondrial respiratory function. This ETR family is a part of the medium chain dehydrogenase/reductase family, but lack the zinc coordination sites characteristic of the alcohol dehydrogenases in this family. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Candida tropicalis enoyl thioester reductase (Etr1p) catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis. Etr1p forms homodimers, with each subunit containing a nucleotide-binding Rossmann fold domain and a catalytic domain.	4.24708e-131

>CP034447.1|AZO21891.1|3130749_3131394_-|TetR/AcrR-family-transcriptional-regulator
MALSVQKRREKQKAELRSELVDAAHKLVQEEGYEGLTIRKLAKRVGYAPMSVYSYFADKQDILFALAEDAFETLARRIEEHPSDDPIEALRAVMTEYAAFGLGNPNEYRTVFMTEKTRLPEGRSYEDMEEGNPAMQVLISRVEACVAAGKLKGDPRAIATMLWTVGHGTISLLITFPFYPFGDPQAYVKRMCDFMLASLSAQDIPPLTETPVNC
>CP034447.1|AZO21890.1|3130346_3130583_-|DUF680-domain-containing-protein
MKKTILALATVLAFSGAAFAGADQPAKHGPAACAQTKANVTLDCTATGSVEKPDASNTQATKGPRLGIDVDPWFVPGL
>CP034447.1|AZO21889.1|3130043_3130268_+|hypothetical-protein
MLSKSAPKSPKKTAAVRSLEREQHHDIEDEELEEGLEDTFPASDPVSITSTSITGAPAKPAKAKTVSRQKQRKR
>CP034447.1|AZO21888.1|3129372_3129954_+|sarcosine-oxidase-subunit-gamma-family-protein
MAKAAVKTKAAASPSVERRPALAGRVTSAPGVKVEILPPAERISLRAPEASLAALSKALGVTLPTKPKTSAAKSGRTALWLGPDEWLIIDEAGNDPLADCAKAPALHSAVGISHRNVAISVAGPAAAVTVNSGCPQDLSLEAFPVGAASRTILGKSEIVLSRMAADAFRVECWRSFSDYVFTLLSEAASDAAN
>CP034447.1|AZO21887.1|3126371_3129380_+|sarcosine-oxidase-subunit-alpha
MNAAFRIPGAGHLSQAKTASFSFDGKSYVGIEGDTLASALLANGVHLVGRSFKYHRPRGFLSAGAEEPNALVQIVRDDTRKTPNVRATVQELYDGLTANSQNRWPSLAFDVSAVNDLASPMFSAGFYYKTFMWPKSAWKSLYEPQIRSAAGLGVSPDRPDPDHYAARYAHCDVLVLGGGAAGIAAALAAAETGARVIFADEQAEFGGSLRFESGAKIDGENGYAWAQAAIAKLKAMDNVRVLSRTTAFGYYAQNFVGLVERVSDHLKSPGRELARERLWQVRASRVVLATGAIERHMVFANNDRPGIMLASAARIYLNHYGVAVGRNVGVYTANDSAYAAAIDLKKAGVNIAAIVDLRDNPTGPMIDEARGLGIEINFGRAVIRAGGKLRVSSMTVQPKNGGGERTIPVDAILMSAGWTPSVHLFSQSRGKVAFNEETRRFVPGTYAQDCVSVGACNGTDGLDAAIDEAYAAGVKAAKEAGGKDSSVKTGKGAKPKVDASESWSRGMLGAAPGAGPGTTVKAFIDFQNDVTAKDIRQAVHEGMHSIEHVKRFTTNGMATDQGKTSNMHGLAIAAETLGKPIPQVGLTTFRPPYTPVTFGSIVGHARGALFDPTRRTATHGWAAAQGAVFEDVGQWKRAWYFPKAGEDMHAAVNRECVTVRKTAGLFDASTLGKIEVVGPDAAKFMELLYTNPWEKLEPGRCRYGIMLREDGFIYDDGVVGRLAPDRFHVTTTTGGAPRVMHHMEDYLQTEFPHLNVWLTSITEQWAVIAVQGPKSREIIAPLVEGIDMSDEAMPHMSVREGKICGVPTRLFRMSFTGERGFEVNVPADYGEAVWEALWAEGRKHGATAYGTETMHVLRAEKGYIIVGQDTDGTVTPNDAGLDWAVGKKKTDFVGIRGMMRSDLVAKGRKQLVGLKTKDPKVVLEEGAQIVADPKQAIPMKMIGHVTSSYWSENCGHSIALALVAGGRDRMGQTLYVPMPNGTIEVEVTGTVFVDEKGGRLNG
>CP034447.1|AZO21886.1|3126078_3126375_+|sarcosine-oxidase-subunit-delta
MLLIRCPYCEEERPELEFRNAGEAHVVRSTNIAGESDDDFEKFFFIRSNPKGVIYERWRHIHGCARFFNAVRDTVTDKFVMTYKAGEPKPAKLPGASK
>CP034447.1|AZO21885.1|3124744_3125998_+|sarcosine-oxidase-subunit-beta
MKKYSVFAIAREAMRGHKGWEEQWTSPEPKKEYDVIIVGAGGHGLATAYYLASEHGITNVAVLEKGWLGGGNTGRNTTIIRSNYLYDESAGIYDHALKLWDGLSQELNYNVMYSARGVMMLAHNVHDVQVFKRHIHANRLNGIDNEWLTPEQAKEFCPPLNIAKEARYPVMGAALQRRGGTARHDAVAWGYARGASARGVHIIQNCEVTGIKRAANGAVTGVETTRGFIGAKKVGVVAAGHSSVIMDMAGVRMPLESYPLQALVSEPVKPVVPCVVMSNTVHAYISQSDKGELVIGAGTDQYISYSQTGGLRILQHTLDAICEMFPIFTRMKMLRSWGGIVDVTPDRSPILAKTPVKGLYVNCGWGTGGFKATPGSGNVFAHTIARDDPHPINAPFTLERFRTGRLIDEAAAAAVAH
>CP034447.1|AZO25735.1|3124162_3124531_-|DUF2568-domain-containing-protein
MGNAWWNLTLRFLLELAALLGLGMAGWSLSEGWWRWLLALALPLIAAALWGTFAVPDDPSRSGRAPVPVPGAVRLMLELVMLFGGAAGFYLTGHTAAGIIMALLIALSYAFSLDRLGWLLRQ
>CP034447.1|AZO21884.1|3123299_3124058_-|SDR-family-oxidoreductase
MFTLTNKVAIVTGASSGIGRATARLFAEQGASLVVAARRKAELDALVGEIEEAGGTAIALAGDVRDEAYAKALVELAAERFGGLDIAFNNVGAVGQMGSISDLSLEGWRETLDTNLTSAFLGAKYQVPAMIERGGGSLIFTSTFVGHTVGMPGMTGYAASKAGLIGLTQVLAAEYGPKAIRVNALLPGGTDTPAATFKTPESRTFVENLHALKRVAQPEEIARSALYLASDASSFTTGTALFADGGVSINRT
>CP034447.1|AZO21883.1|3122802_3123189_-|SET-domain-containing-protein-lysine-N-methyltransferase
MLLIRTYVAQSAIEGVGVFAAEPIRKGASIWRLDPDFDRLIPMEKYEAAPPHLKELLDRYAYPSPDKPGFMVYEVDNGRFMNHAERPNTDFSQYGGATAIRDIAVGEEITCDYGEFFEDFARLHLAMA
>CP034447.1|AZO25736.1|3132393_3133443_-|phosphotransferase-family-protein
MALALDKSALALDRAALAPYLEAHVPGFAGLSAIEKFKSGQSNPTYLLTAASGRYVLRAKPPGQLLKSAHQVDREFRVMRALAGTAVPVPRMLHLSREESPIGRMFYVMEFLDGRIFWDPSLPEAPGNDERAAIYDAMNATLAALHDVDVEAVGLGDFGKPGSYFERQFARWTSQYRASETETIADMDRLIAWLETHMPADDGRVSLVHGDYRLDNMIFAKDEPKVIAVLDWELSTLGHPFADLAYQCMQWRLPHASGFRGLGGVDRATLGLPSEEAYVAAYCRRRDIEGIGKWTFFLAFSFFRLAAICQGVYRRALDGNASNPEKAKTYGEAVKLLAALAVDLIDKKT
>CP034447.1|AZO21893.1|3133490_3133970_-|MaoC-family-dehydratase
MEPISLDTLLASVGKEVGVSPWRTVTQRMIDQFADATDDHQFIHCDPERAARETPFGGTIAHGFLSLSLLSAMTFETMPPIENTKMGVNHGFDTLRFLTPVKTGSRIRTRFVLADVKVRPSGWVQTAHDVTIEIEGSKKPALTARWLTLTLIERQPETA
>CP034447.1|AZO21894.1|3134022_3134838_-|SDR-family-oxidoreductase
MSYLDKLFSVAGKTALVTGAATGIGRMVATGLVRAGATVMIASRKGEDCVKVANELNALGGSGRAEGFAGDVSSEAGIAALVAEVKVRTDRLHILVNNAGISWGAPLEEFPYHAWAKVFGVNVTAVFHLTRELLPLLDAAASDEDPARVINLGSVMGTQPLADDAYSYTASKAAVHHLTRTLALEFAARRITVNAFAPGPFQSRMTAFATATEEQAKHVGNHVPLGRIGVADDIAGATLYLCSRAGSYVTGAILPIDGGQSVQHGMTLFKE
>CP034447.1|AZO21895.1|3134948_3136190_+|acyl-CoA-dehydrogenase
MADMNLGMSERLKPIHQRVAAMVRDEIAPLSEAFLAEVGRNGDRWTYTARQTEILEGLKKTARERGLWNFWLTDSKRGYGLSTVEYAYLAEEMGKAHLGAETFNCSAPDTGNMEVLERYGSEEHKRQWLEPLLDGRIRSAYLMTEPDVASSDATNISMRCERRGDDYVLNGEKWWASGAGDPRCAIYIVMVRTGSDEEPQHRRHSMILVPAGSKGVTKLRAMQVYGEDDAPHGHMHLRFEDVRVPAANLILGEGSGFEIAQGRLGPGRIHHCMRAIGQAEMALEMLCQRSVRREAFGQSLAKLGANFDIIAECRMEIEMARLLCLKAAWMIDQGDARAAAPWISQIKVVAPRVALKVTDEAVQMFGAQGISQDTPLARSWTHLRTLRLADGPDAVHRRQVARTELKKYTQEKV
>CP034447.1|AZO21896.1|3136195_3137233_+|NADH-oxidoreductase
MALPSEMKALLLVGDGYTRTPSAGALEATEPYLRPGNIAVPAPGPTQALIKVNLASINPSDIAFIKGQYGQPRVKGRPAGFEGVGIVVATGSDPYAKSLEGKRVAFATGVSNWGSWADYAVAEAASCIPLLDTVRDEDAAAMIVNPLTALAMFDIVKQEGDKAFIMTAGASQLCKLIIGLAKEEGFRPIVTVRRDEQIPLLKELGAAHVLNEKAADFETALREVVKAEQPRIFLDAVTGPLASAIFNAMPKRSRWIVYGRLDAEPTIIREPGQLIFQHKHIEGFWLAEWMRQFRDRLGPAVLEAQKRFSDGRWSTDVTAVVPLDEAMARLPAELAKPNGKVFIKP
>CP034447.1|AZO21897.1|3137256_3138084_-|MurR/RpiR-family-transcriptional-regulator
MISSIAELISDRIGTMPAGERRAAQTLIANYPLTGLKTVAEFSAAAGVSSPTILRFVARLGFQNYPEFQSALQDELAAQLQSPASRTLDPASPAGGAVSPMLEATLDNLRETFRHLSDRQLADIAKTLAERRGKTFLIGGRFTDPLARYMAAHLTIIQPDVYHLAGQESIWRDRLIDMGKRDVLVIFDIRRYQESLIRFAEKAHQRGVQIVLFTDQWLSPIARFARHVIAGRTAVPSAWDSSAALFVVAETLIGAITRQLETAGAKRIRDLESLR
>CP034447.1|AZO21898.1|3138231_3139050_+|N-formylglutamate-amidohydrolase
MEKARLTSLAPSETVRVTNPGGSSPFVFTCDHASNYLPAEFGTLGLPVEDLSRHIAWDPGALPVARRMADQLDATLIETRVSRLVIDCNRPLDAPDLVPPLSETTAIPGNTGLSDKQRTARVDLAWRPFHDAIAEIIDRRLAHGQETRLVSVHSFTPIYKGRSRPWHIGIIHDDDRRLAAPLISALRRLAGVTVGVNEPYSPADRVYFTLERHARPRGLACAMIEIRNDEISGETGQRKWADLLTGIFSNLEPEEARGSRQRAMGKSVQSAS
>CP034447.1|AZO21899.1|3139069_3140632_+|amino-acid-permease
MSAQDYTEHDKHEDLKVLHGMGYAQELSRSMSRFSNFAISFSIICILSGGINSFAQATSSIGGAGAGVGWIVGCAVSGFFALAMAQIASAFPTAGGLYHWASILGNRFTGWLTAWLNLLGLITVLGAINIGTAFFFVGTFGSWFGMTGTAGEIVGFVAAITVIQALCNHFGIKLTAMLTDASGFLILGATAVLIVACLVFAPAIDVTRLWTFTNYSGDAGGGVFPQSDSISYLFLLSLLLPVYTITGYDASAHTSEETLKAAHSVPRAIISSVLWSSLIGWAMVCAITLAIPDLAAGAKQGWSVFFSTMDAILPVWLKELLYLAILISQFLCGLATVTSASRMLFAFSRDGGMPVGSTSLAKVSPTWRTPVHAIWTAAALEIIYVFLAQFISIGGTNIYTIVVNSTLVFLFLSFIIPIVLGMMAFGTSKWPNPGPWNLGGGVFKLFCILSIIGMAIIFYIAIQPPNDKVLYITIGFLLLTAVLWFGFENRRFQGPPIGDEIAKRQAAIKVAEQAVGETGN
>CP034447.1|AZO21900.1|3140714_3142085_+|glutamine-synthetase
MAGNFSFDQLKQAVSNGEIDTVLACIVDMQGRLAGKRFLAQYFVDSAHGETHGCNYLLACDIDMEPVPGYKAASWSKGYGDFVMKPDLSTLRRIPWLEKTALVICDVLDHHDHEDLAHSPRAILKKQVKRLQERGYIGYFASELEFYLFSETYDSARKKHWQGLDSASPYIGDYQIGVTTKEEGVMRRLRNEMEAAGIPIENSKGEWGPGQEEINVRYAEALEMADRHVILKNGAKEIAHSEGKAISFMAKYNYGLAGNSSHIHNSLWSADGKTPLFFDKNAEWTLSALGQQWAAGQLKYAKEFTWFLAPYINSYKRFQAGTFAPTKIMWSEDNRTAGFRLCGEGTKGIRMECRIGGADLNPYLAFAALIASGLAGIDEKLELQKPFVGDAYQASQLPEIPKTLRDATETLVHSTMLKQAFGEDVVEHYVHTARWEQFEYDRRITDWELHRGFERY
>CP034447.1|AZO21901.1|3142263_3143652_+|aldehyde-dehydrogenase-family-protein
MTETVKLKSPIDGSIYAERPVATDQAINAAVERAKAAQEKWAETPIVERGKYMLAMLEALVGMTDEIVPEIAWQMGRPVRYGGEFGGVKERASYMVEIAEQALKPVMASNPKDGFRRYVKKVPLGVVLVIAPWNYPYLTAVNTIVPALMAGSAVILKHAAQTLLVGERFQQAFDKAGLPKGLFQNLVMNHVQTEGLLGSGKIDHINFTGSVAGGRAIEKAAAGTFMTLGLELGGKDPAYVLPDAKMDHAVANLVDGAFYNSGQCCCGIERVYVHEKVYDEFVEGFVAETRNYVVGNPLEQATTMGPMAQARFADLIREQKAEALRKGARAHINMKVENDRPGSPYLAPEVLTAVDHQMSVMREESFGPIVGIMKVRDDEEAIALMNDSPYGLTASIWTRDTERAVAIGDRVETGTVFMNRCDYLDPALVWTGVKDTGKGAALSAIGYDNLTRPKSYHLREAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_7

3644595-3644706

Orphan

Consensus_repeat	Method
GCAAAAAGTGGGAACCGGTTTTCGGAGAAGATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_7

>merge|CP034447|7|3644595-3644706|CRISPRCasFinder
GCAAAAAGTGGGAACCGGTTTTCGGAGAAGATCATGCTCCGGCAAAAGAGCATGATCCCGAACCGGAGGTCAGCGAACGCAAAAAGTGGGAACCGGTTTTCGAAGAAGATCA

>CP034447|7|7|3644595-3644706|CRISPRCasFinder
GCAAAAAGTGGGAACCGGTTTTCGGAGAAGATCA	TGCTCCGGCAAAAGAGCATGATCCCGAACCGGAGGTCAGCGAAC
GCAAAAAGTGGGAACCGGTTTTCGAAGAAGATCA

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO22331.1\|3645248_3646541_-\|histidinol-dehydrogenase	unknown	unknown	gnl\|CDD\|234853
CP034447.1\|AZO22334.1\|3648599_3648797_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO22333.1\|3647163_3648456_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	unknown	unknown	gnl\|CDD\|236486
CP034447.1\|AZO22339.1\|3652237_3652507_-\|DUF2282-domain-containing-protein	unknown	unknown	gnl\|CDD\|370796
CP034447.1\|AZO22327.1\|3642743_3642965_-\|DNA-gyrase-inhibitor-YacG	unknown	unknown	gnl\|CDD\|234943
CP034447.1\|AZO25771.1\|3644129_3644531_-\|low-molecular-weight-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|223471
CP034447.1\|AZO22328.1\|3642978_3643605_-\|Maf-like-protein	unknown	unknown	gnl\|CDD\|167232
CP034447.1\|AZO22329.1\|3643624_3643843_-\|translation-initiation-factor-IF-1	unknown	unknown	gnl\|CDD\|178954
CP034447.1\|AZO22326.1\|3641050_3642241_-\|DUF4102-domain-containing-protein	unknown	unknown	gnl\|CDD\|170049
CP034447.1\|AZO22330.1\|3644760_3645246_-\|UPF0262-family-protein	unknown	unknown	gnl\|CDD\|235077
CP034447.1\|AZO22336.1\|3649908_3650385_-\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|225168
CP034447.1\|AZO22335.1\|3649174_3649882_-\|flavodoxin-family-protein	unknown	unknown	gnl\|CDD\|376808
CP034447.1\|AZO22323.1\|3635192_3638153_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO22337.1\|3650396_3651182_-\|DUF2063-domain-containing-protein	unknown	unknown	gnl\|CDD\|378264
CP034447.1\|AZO22325.1\|3640131_3640770_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO22324.1\|3639580_3639796_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO22338.1\|3651168_3652194_-\|DUF692-domain-containing-protein	unknown	unknown	gnl\|CDD\|377459
CP034447.1\|AZO22321.1\|3628457_3628991_-\|DNA-mismatch-endonuclease-Vsr	unknown	unknown	gnl\|CDD\|226250
CP034447.1\|AZO22332.1\|3646546_3646981_-\|DUF2948-family-protein	unknown	unknown	gnl\|CDD\|371401
CP034447.1\|AZO22322.1\|3629127_3635301_-\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|350681

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO22331.1\|3645248_3646541_-\|histidinol-dehydrogenase	gnl\|CDD\|234853	PRK00877, hisD, bifunctional histidinal dehydrogenase/ histidinol dehydrogenase; Reviewed.	0
CP034447.1\|AZO22330.1\|3644760_3645246_-\|UPF0262-family-protein	gnl\|CDD\|235077	PRK02853, PRK02853, hypothetical protein; Provisional.	1.85085e-104
CP034447.1\|AZO22327.1\|3642743_3642965_-\|DNA-gyrase-inhibitor-YacG	gnl\|CDD\|234943	PRK01343, PRK01343, zinc-binding protein; Provisional.	1.67893e-28
CP034447.1\|AZO25771.1\|3644129_3644531_-\|low-molecular-weight-phosphatase-family-protein	gnl\|CDD\|223471	COG0394, Wzb, Protein-tyrosine-phosphatase [Signal transduction mechanisms].	5.45098e-36
CP034447.1\|AZO22328.1\|3642978_3643605_-\|Maf-like-protein	gnl\|CDD\|167232	PRK01441, PRK01441, Maf-like protein; Reviewed.	1.51786e-134
CP034447.1\|AZO22329.1\|3643624_3643843_-\|translation-initiation-factor-IF-1	gnl\|CDD\|178954	PRK00276, infA, translation initiation factor IF-1; Validated.	1.10566e-45
CP034447.1\|AZO22326.1\|3641050_3642241_-\|DUF4102-domain-containing-protein	gnl\|CDD\|170049	PRK09692, PRK09692, integrase; Provisional.	1.84558e-72
CP034447.1\|AZO22333.1\|3647163_3648456_-\|UDP-N-acetylglucosamine-1-carboxyvinyltransferase	gnl\|CDD\|236486	PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated.	0
CP034447.1\|AZO22336.1\|3649908_3650385_-\|DoxX-family-protein	gnl\|CDD\|225168	COG2259, COG2259, Predicted membrane protein [Function unknown].	4.16267e-09
CP034447.1\|AZO22335.1\|3649174_3649882_-\|flavodoxin-family-protein	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	9.84442e-58
CP034447.1\|AZO22337.1\|3650396_3651182_-\|DUF2063-domain-containing-protein	gnl\|CDD\|378264	pfam09836, DUF2063, Putative DNA-binding domain. This family represents the N-terminal part of a Neisseria protein, UniProtKB:Q5F5I0, Structure 3dee. It runs from residues 31-117 as a helical bundle with 4 main helices. \From genomic context and the fold of the C-terminal part, it is suggested that this protein is involved in transcriptional regulation.	5.31793e-14
CP034447.1\|AZO22339.1\|3652237_3652507_-\|DUF2282-domain-containing-protein	gnl\|CDD\|370796	pfam10048, DUF2282, Predicted integral membrane protein (DUF2282). Members of this family of hypothetical bacterial proteins and putative signal peptide proteins have no known function.	5.50789e-21
CP034447.1\|AZO22338.1\|3651168_3652194_-\|DUF692-domain-containing-protein	gnl\|CDD\|377459	pfam05114, DUF692, Protein of unknown function (DUF692). This family consists of several uncharacterized bacterial proteins.	9.12977e-138
CP034447.1\|AZO22321.1\|3628457_3628991_-\|DNA-mismatch-endonuclease-Vsr	gnl\|CDD\|226250	COG3727, Vsr, DNA G:T-mismatch repair endonuclease [DNA replication, recombination, and repair].	2.27161e-49
CP034447.1\|AZO22332.1\|3646546_3646981_-\|DUF2948-family-protein	gnl\|CDD\|371401	pfam11164, DUF2948, Protein of unknown function (DUF2948). This family of proteins with unknown function appear to be restricted to Proteobacteria.	7.38962e-66
CP034447.1\|AZO22322.1\|3629127_3635301_-\|DEAD/DEAH-box-helicase	gnl\|CDD\|350681	cd17923, DEXHc_Hrq1-like, DEAH-box helicase domain of Hrq1 and similar proteins. Yeast Hrq1, similar to RecQ4, plays a role in DNA inter-strand crosslink (ICL) repair and in telomere maintenance. Hrq1 lacks the Sld2-like domain found in RecQ4. Hrq1 belongs to the type II DEAD box helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.50714e-53

>CP034447.1|AZO25771.1|3644129_3644531_-|low-molecular-weight-phosphatase-family-protein
MCGLNAVRSPMAEQLARRFLPTTTFVASAGVRSGERDPFVDAVLAEEGLTLGERQPRTLDELEDDYFDLIVTLAPEAHHAALELTRSLAVEVEYWPMPDPTDTGGTREHIMAAYRDVRERLKARIAKRFAPPE
>CP034447.1|AZO22329.1|3643624_3643843_-|translation-initiation-factor-IF-1
MPKEEVLEFPGVVTELLPNAMFRVKLENEHEIIAHTAGRMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK
>CP034447.1|AZO22328.1|3642978_3643605_-|Maf-like-protein
MSILQKLVLASGSPRRIELLQQAGIEPDRILPADVDETPLRAEHPRSLAKRLAKEKAEKALTSLKSEEDHAPAFILAADTVVAVGRRILPKADTIDDAVNCLGLLSGRSHRVYSGICLITPGGKLRQRLVETRVRFKRLPREEIDAYIASGEWRGKAGGYAVQGLAGSFVVKLVGSYTNVVGLPLYESVALLSGEGFKAHRNWHVARP
>CP034447.1|AZO22327.1|3642743_3642965_-|DNA-gyrase-inhibitor-YacG
MSLDDKVTPLRPKRPCPECGKPSAREHYPFCSARCKDIDLNRWLKGAYVIPGRDGEEEEEDSSKQGSSPKDEG
>CP034447.1|AZO22326.1|3641050_3642241_-|DUF4102-domain-containing-protein
MALSDVKCRNARPASKLLKLSDGGGLQLWVQPTGSRLWRLAYRFDGKQKLLALGSYPLISLAEARKARDDAKRLLLTGIDPAQERKLRKVGSAKDSFRSIAEEYVDKLKKEGRADRTITKVKWLLDFAYLTCGHKCIRDIDAATILAALRSVEVRGRYESARRLRSTIGSVFRYAIATARADTDPTSALRGALIRPTVTPRAAITDPKAFGGLLRAIETFDGQPATRAALRLMALLFPRPGELRAAEWGEFDFESSVWTIPEARMKMRRPHRVPLSTQALDILAELKKISGAGTLLFPSVRSPSRPISDNTLNAALRRMGFSKNEATAHGFRATASTLLNECGKWHPDAVERQLAHIENNDVRRAYARAEHWEERVKMMQWWADYLEKIENAGTRG
>CP034447.1|AZO22325.1|3640131_3640770_-|hypothetical-protein
MSTRQKMDAAANLIEGWTLPSAATLGSSVRARGIVREVRAHLPLAAKKLLGIEVGVLTLRMPEGAYGDFRTASAIVSKTLEGIEGLPVIPREVEDILTISSAERHRWLKDGRLQSTGTRTVKLRGRARKVTFHVFDPRHIEDVLDRDLVTVWREDDAIAAAENRRRAAGKAALKRAQKSGRRAASAPDSTRDEVSRQKLKGWDEFESDGLLR
>CP034447.1|AZO22324.1|3639580_3639796_-|hypothetical-protein
MSEPTVAEATDSIYASLRANNADIDANIAALKAALTREGIEQAVLDPTRLAQNNRSSRKVMQAYFRQRGVT
>CP034447.1|AZO22323.1|3635192_3638153_-|hypothetical-protein
MRYAVVREAAEAGLKRWRRPQPTDVPLLFGVVREAGFPAAAIKEGTLGLWLKRSILAIEMGFTPAEAVASEAWRAGETLVQALVEPAVALSTVIVRFRQQLPPLHERNDRDPVLHLDSVVPAWRNDLPFDLEEGDFRSLVEDLVRTRRVEGGALAASRLLRRTAEGWAPRAELTLSGELDVVRTSPQLQAAMEGATRLRIFPRGDLPGLNRPIAVLEQVESDEATAWESRPLVKAFEVPARLNQAIRLAAVAGETLVEEFTAFAGEPVDAPVLLFQPDPGVDFENALELRFIGSSPFRSTRPWLAMAVTQEARSALKFEHPPSDLGDCILDGRCLLAFVGQASLDLGDGRLTWRSAAEREDTKRLILTGETLRRVRETVFLGTPKAWLSDGQHHTLVSSEDLIWRSLGRGSWRSSNKHAPLGRVEIAMRRGGELVAWTCADVAPRELVLSGEPRTHSLKIENLLGASVAAKGGQILPISRNGDDARVDLRLHTPGAMLHVALRWDTQLDLTLADPIAEPLLLTPDMRPAVSRAQISIDRLHGFRLLAPGGRDLWLVVRQGAGQPVQATRRIDGLVPLSAFQDELRDLLGSFPDLDAEVRLSWAGRGDHFAEIAWYDEDQPLVAEKGISPFSGLSSILGWNLDALALTQPTAKLSNNLPRLSLQELQTRLLQELGPGPWLIFGRTNDGTSLRPKVVAQPPGDDDRGSALRLAFRIARRDARDDAFATVLKHPEALNRADLRLLVDLSVAARDRNVPVPAIDALRSLCRAPQAAPWILSTCDTLEERDAVIRLQSELPFLWCATEVEHWVSAFRTRIDELERRLERLELPTADAGRNVAAALGQIADLEPGLATHAWITFLLVAPRADLEPGLIGRLCRRPKETLRELAEAFVTRQSEHREPPTGLHLAGLLPERRELWERYDPAFADLIAAPLVAARMAAGKLHQNPQVVGRCRAAWLHDRQLFESALAVALGRETIDPGTTQRMDL
>CP034447.1|AZO22322.1|3629127_3635301_-|DEAD/DEAH-box-helicase
MSGRLAPRPSALRERSRRRPWTRDYRPRHHPTNGPVMEIERLLARLPRDAADAIVGMARLRSVDLNRHLREGLGARAGQPNSALSEPFVEGAYPWLPLEGGWGGLPAGLLHPRTLEVLREVAYPPYTHQVDAWKQLCGERAASVIVSSGTGSGKTECFLTPILDGLVRSSDSGAKPLEGVRALMLYPLNALIASQEERLSKWFAPFGGALRYCLYNGDTPESVRSTAARGEPWKVADRTTLRRSPPPVLVTNVTMLEYMLIRQKDAPILRASQGTLDFVVLDEAHSYVGAQAAEIALLLRRVALAFGRKPEELRYVATSATIGGPDAAELRSFLRDLSGAPEQNIHVVRGVRASLPASPALNSNLIELDEIAGMEPLQAGEIFAKSAPLRVLREQFRAGAIVGWSGWSAQARQIGGADVDPRRLLVEASRAKDPHSDPALASAGGDSILPVRLHLFHRTLSGLWACVNPTCPGRPAASEAADWHFGAVFLESREHCSHCGSLVLEWAYCIQCGDGALKAEETADGSHLVAWTGGTGDGEFEQTLDRDETFGAEDDTQDDAPLTTSPVVNRRYLGARGARPSPIIRFEPKTGAIVETVDGAGLPTTASRHVGECPCCGWAPKKVDLEAGVLRSLVAGAPYLMSQITPGLVGHLSPKPDADEPLPLDGRQLITFTDARQGTARHAANLQVASERGFVRSFLYHFVQDRPVRDDQAIAAIEAKLKRLASDEQDGITLSLMADLRLARIRLEGVATPKAWRQLVDRLAAEPTINRFLSNLWVEREETFSDPARLAEFMLYREIMRRPVRANSAETLGLLRLTIPGLDEPNVVVPASATRLGLNADDWRDLVRLLLTHFVRTNVILDFDAKRWMRWIDRRQSHVEMVPFEPALPSSRYVRFWPHPYGPRPSRVVRMLVQALGLDRDDPSVRDDLNELLRAAWSTLQRFMTVSPNGFRLRLGDMNVTPIERAFWCPNTRRLVDTTFRGLSPYDKLGVHPKAEAVDMPTLPFPWRRDAHGGRVSDSILDDWLATDERVSLLRAKGAWGDQQDRAARFSPWLRAAEHSAQQPSFLLRDYENAFKSGKVNVLGCSTTMEMGVDIGSIEAVLNTNAPPAIANYRQRVGRAGRARQPIALGLTICKDRPLDRLAFADPGAFLAREAPAPVVSLESPTIARRHAHALLLARFLATQGAELHKLTNGAFFGLGLSAEVLNNLPWRRFLAWLDAAAAGLKTMTSDLEEVLRGTPVRPDPDLFEGVRDTIERIQSDLSAEWDALRGDEPDAETSVVSKARDFQRRRLQGNYLLGELAGRGFLPSYGFPSDVVSFVTETGVERHKREDSGENRFSSRGYPSRQRDIAIFEYAPGRSLVVDGVVRESAGVTLNWKRPADKAGVREVQSLRQMRHCQSCGALLSAPSAVSPGACPDCGSSDFKIMRFLAPAGFAVDARYEVHDDPSDTGTSMLVDPWVSARTLAWRALPDPNVGRLRTGSDGLVFWFNPGPHGHGFEVCLHCGRAEAEHQADGAGSLAGHRPLRGGPRAADERTCTGAPEINPYAVARHLRLGHEIRTDVCEIQLYDCASREVALTVALAIREAAARRLGVDADEMGFAAPPAIHPAGQRNWTAAVFDRASGGAGFSATIARDPIGILNEARDLLDCSKLGRCGDPDAVFACPRCVLSVDSQHAVEGTDRRAAHSLLTAIGRSLDLPKRFRLFGPATEYESAPLPQALSDRLGDDASNTLVVFMSGPPAEWELETWQMAPVLERWGARGRGVQIAVDASALTATDAVTRRNVVLWAQRARVDIVARNEVDNDAWLAGVVSTRGLTAWASSSASAKAVGIGWGSVSDAPVVRGATALAAPRERLDVSALLSAGGSEAIFEIADELDGPAAGFGARLRALLRARSTELAQVFAAPCLEIRYSDKYLFNPLSIRLLTEVVAAFSDYDTNVKVQTLAAKTGGGARTGPWLHRDWADLVTRTAVMEQSLVEVVPKVQVSQVQSAPHRRRLEFRTPRGSGTIFFDQGMGSWRVTDEHHDHASSISEQVTSLKRPFSVLNGLDGTFLAVRLD
>CP034447.1|AZO22321.1|3628457_3628991_-|DNA-mismatch-endonuclease-Vsr
MTCDHIDNDDYPVSSQRSRIMRSVRQKDTSPEMKVRSALHAAGLRYRLHVKGLPGTPDLVFPRRKVVVFVHGCFWHRHPGCHLATTPKSRVAFWTEKFRRNRERDAAAAGALRSRGWAVVEVWECEIKRNDYLEPLLQILRLAIDARMSQPHRLHRSFNASLRRKTSESGTRGAEGG
>CP034447.1|AZO22330.1|3644760_3645246_-|UPF0262-family-protein
MSGHHQNRDRLIDVELDDTIGRSTPDVEHERAVAIFDLIEENSFRPVNDDGAGPYRLKLSLAEQRLVFAVSRENGADVVTHILSLTPLRRIVKDYYLICESYYEAIRSSTPSHIEAIDMGRRGLHNEGSQTLMDRLAGKIEIDFDTARRLFTLVCVLHWRG
>CP034447.1|AZO22331.1|3645248_3646541_-|histidinol-dehydrogenase
MAITLNQQDADFDQRFTAFLSTKREVSADVEAVVRDIIARVRAEGDKALTDYTLKFDKADLGKLGIAVSKDDIARAFAAADPATVEALKFARDRIRSHHERQKPKDDRYTDAAGVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVERIVIVVPASGGVINPLVLVAADLAGVSEIYRVGGAQAVAALAYGTETIRPVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVLVVADKDNDPDWIAADLLAQAEHDASAQSILVTDNAAFGQAVEQAVERQLKTLPRAETAAASWRDFGAVILVPSIEASLPLVDRIAAEHVELAFDDAESFLARMRNAGAVFVGRHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILKLGPEQLKALAPAAIALARAEGLDAHARSVAIRLNM
>CP034447.1|AZO22332.1|3646546_3646981_-|DUF2948-family-protein
MAALKLIALDDQDLSIVSAHVQDAVMKVSDLEYLPAAKRFVLTMNRFVWEAKPGFLRQHNERRQSVLHFDRVLGAKTSGIARDKPAEVLSLLAISFVAISKPAGIIELVFSGGGTIMLDVECIEARLADVGGSWEAASRPVHRS
>CP034447.1|AZO22333.1|3647163_3648456_-|UDP-N-acetylglucosamine-1-carboxyvinyltransferase
MDRIRIVGGNKLAGTIPISGAKNAALPLMIASLLTDDTLTLENVPHLADVEQLIRILGNHGVDYSVNGRRESQQKGYSRTINFSARNIVDTTAPYELVSKMRASFWVIGPLLARMGEAKVSLPGGCAIGTRPVDLFLEGLQALDAELDVDNGYVIAKTKNGRLHGNRYVFPKVSVGATHVLMMAASLAKGETVLENAAREPEIVNLAECLIAMGAKIHGAGTSTITIEGVEALSGARIRVIPDRIETGTYAMAVAMTGGDVMLEGARPDLLQTALDVLVETGAEITPTNEGIRVKRNGAGIVPVDVTTAPFPAFPTDLQAQFMGLMTMAKGKSRITETIFENRFMHVQELARLGAHITLSGQTAIVDGVTRLKGAPVMATDLRASVSLVIAGLAAEGETTVNRVYHLDRGFERLEEKLSGCGAVIERISG
>CP034447.1|AZO22334.1|3648599_3648797_-|hypothetical-protein
MNDKANPAKKGDGERKDRLAEALRANLQKRKAQARSRRAGDANKRACDVDERPEGLPTAGKMQKK
>CP034447.1|AZO22335.1|3649174_3649882_-|flavodoxin-family-protein
MRIFIVHAHPEPKSFNGALTRTAQEALSASGHEVVVSDLYAMGFNPVSDRRNFTAVRDPNYYRQQVEEANAAAHDGFAPDIQTEMDKLFWCDVLILQFPLWWFGLPAILKGWVDRVFASGGRIYGGGKWYDRGVLAGKRAMCSVTIGGPPPIYSDRGLNGPIAEILFPINHGMLYFVGFTVIEPFLVHAPARIGDNERRMCLDRYRERVLSLAHAPTIAYPKLAEFDDMHVLKST
>CP034447.1|AZO22336.1|3649908_3650385_-|DoxX-family-protein
MTAISEQSLSSPAGFVGLYKRIIKLPEHIPLSLVQLAARVAVAHVFWQSAQSKLASWPVTLQLFANEYNLPFIDPSIAAPLATAVELTGSVLIFFGLFSRLAALMLLGVVSVIQIFVYPENWAEHLLWSSLLLLVLTRGAGVFSLDCVAARVLSTSRK
>CP034447.1|AZO22337.1|3650396_3651182_-|DUF2063-domain-containing-protein
MLPLEHLQTTMARSVLAIEPMVSAKMLTAGKADPLARLRIYQNNTRSSLTAVLMAVFPVTVRLVDERFFRYVASEFIRRHPPAESRLARYGAGFPRFLKTIDTLSDMPIVAETARLEWAIAEALDRASLPPRSLADYDNTDLGLSPDILLQPSLRLIVSHWSILSVWMAHQQKTAVDENVTWIRRPERVALWRSGNYVRLFLLDRASFAFWHSLKHGLGLEHATGRALALDPAFDLVSALVRLFRDRLVTDVRVVSNSPSN
>CP034447.1|AZO22338.1|3651168_3652194_-|DUF692-domain-containing-protein
MSRAFQPLAIPASAGIGLRSPHISEMLTRRPSAGWLEVHAENYMGDGAGVEALERLRQIYPLSVHGVGLSLGSARGLDLDHLERLRRVCERFQPDLVSEHLAWSVADGAYLNDLLPLRYDEEALAIVARNVDTVQEMLKRQVLIENLSAYVAFADSSVNEAEFLAELVARTGCGLLLDVNNVHVSAHNLQYDAKTFIDALPAGAIGEIHLAGHATNQVGTDTVLIDDHGSRVPPVVWALYEHAITRLGPRPTLIEWDTDVPVLDVLLGEAMWADMLTASIMFGRKQAARQAATTKPRPASPTPFENVRTSMPVLAACAAAKAGLVMANALTPMEGRYDVAA
>CP034447.1|AZO22339.1|3652237_3652507_-|DUF2282-domain-containing-protein
MINTKTLIGSALAAATSLAATAAYSGPAAKPGFAFEKCYGVVKAGQNDCQTATHSCAGTATADNQPDSWLYVPAGNCAKIAGGSDKPKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_8

5312398-5312485

Orphan

Consensus_repeat	Method
AAGGGCTTCGCCCTGGGGAGGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_8

>merge|CP034447|8|5312398-5312485|CRISPRCasFinder
AAGGGCTTCGCCCTGGGGAGGGTGTGATGAAACGAACACATAAGTTCATCCTCACCACCATCGCCAAGGGCTTTGCCCTGGGGAGGGT

>CP034447|8|8|5312398-5312485|CRISPRCasFinder
AAGGGCTTCGCCCTGGGGAGGGT	GTGATGAAACGAACACATAAGTTCATCCTCACCACCATCGCC
AAGGGCTTTGCCCTGGGGAGGGT

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO23716.1\|5316243_5316777_-\|BA14K-family-protein	unknown	unknown	gnl\|CDD\|369573
CP034447.1\|AZO23719.1\|5319586_5320126_+\|J-domain-containing-protein	unknown	unknown	gnl\|CDD\|274090
CP034447.1\|AZO23714.1\|5312857_5314585_+\|carbohydrate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224567
CP034447.1\|AZO23717.1\|5317555_5317822_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO23720.1\|5320307_5320490_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO23704.1\|5301618_5302560_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225189
CP034447.1\|AZO23703.1\|5301195_5301555_+\|four-helix-bundle-protein	unknown	unknown	gnl\|CDD\|183395
CP034447.1\|AZO23711.1\|5310641_5311508_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP034447.1\|AZO23718.1\|5318363_5318567_-\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO23706.1\|5303409_5304141_+\|peptidase	unknown	unknown	gnl\|CDD\|226015
CP034447.1\|AZO23708.1\|5306923_5308444_+\|glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|237027
CP034447.1\|AZO25881.1\|5304251_5305880_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|181337
CP034447.1\|AZO23722.1\|5321845_5322982_-\|DNA-protecting-protein-DprA	unknown	unknown	gnl\|CDD\|223829
CP034447.1\|AZO23709.1\|5308483_5309563_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226359
CP034447.1\|AZO23705.1\|5302581_5303376_+\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|224224
CP034447.1\|AZO23713.1\|5312492_5312780_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227764
CP034447.1\|AZO23715.1\|5314677_5316171_+\|glycerol-kinase	unknown	unknown	gnl\|CDD\|198361
CP034447.1\|AZO23710.1\|5309573_5310641_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226359
CP034447.1\|AZO23721.1\|5320692_5321838_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO23707.1\|5306029_5306797_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO23716.1\|5316243_5316777_-\|BA14K-family-protein	gnl\|CDD\|369573	pfam07886, BA14K, BA14K-like protein. The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.	8.92903e-08
CP034447.1\|AZO23719.1\|5319586_5320126_+\|J-domain-containing-protein	gnl\|CDD\|274090	TIGR02349, Chaperone_protein_DnaJ, chaperone protein DnaJ. This model represents bacterial forms of DnaJ, part of the DnaK-DnaJ-GrpE chaperone system. The three components typically are encoded by consecutive genes. DnaJ homologs occur in many genomes, typically not near DnaK and GrpE-like genes; most such genes are not included by this family. Eukaryotic (mitochondrial and chloroplast) forms are not included in the scope of this family.	4.15177e-21
CP034447.1\|AZO23714.1\|5312857_5314585_+\|carbohydrate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224567	COG1653, UgpB, ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism].	4.77599e-27
CP034447.1\|AZO23704.1\|5301618_5302560_+\|hypothetical-protein	gnl\|CDD\|225189	COG2307, COG2307, Uncharacterized protein conserved in bacteria [Function unknown].	6.64211e-134
CP034447.1\|AZO23703.1\|5301195_5301555_+\|four-helix-bundle-protein	gnl\|CDD\|183395	PRK12275, PRK12275, hypothetical protein; Reviewed.	6.11191e-49
CP034447.1\|AZO23711.1\|5310641_5311508_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	1.24925e-68
CP034447.1\|AZO23706.1\|5303409_5304141_+\|peptidase	gnl\|CDD\|226015	COG3484, COG3484, Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones].	9.90045e-150
CP034447.1\|AZO23708.1\|5306923_5308444_+\|glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|237027	PRK12266, glpD, glycerol-3-phosphate dehydrogenase; Reviewed.	0
CP034447.1\|AZO25881.1\|5304251_5305880_+\|hypothetical-protein	gnl\|CDD\|181337	PRK08266, PRK08266, hypothetical protein; Provisional.	0
CP034447.1\|AZO23709.1\|5308483_5309563_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226359	COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].	1.36265e-124
CP034447.1\|AZO23705.1\|5302581_5303376_+\|transglutaminase-family-protein	gnl\|CDD\|224224	COG1305, COG1305, Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism].	5.94744e-50
CP034447.1\|AZO23713.1\|5312492_5312780_+\|hypothetical-protein	gnl\|CDD\|227764	COG5477, COG5477, Predicted small integral membrane protein [Function unknown].	2.5688e-43
CP034447.1\|AZO23715.1\|5314677_5316171_+\|glycerol-kinase	gnl\|CDD\|198361	cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases. This subgroup is composed of mostly bacterial and archaeal glycerol kinases (GK), including the well characterized proteins from Escherichia coli (EcGK), Thermococcus kodakaraensis (TkGK), and Enterococcus casseliflavus (EnGK). GKs contain two large domains separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. The high affinity ATP binding site of EcGK is created only by a substrate-induced conformational change, which is initiated by protein-protein interactions through complex formation with enzyme IIAGlc (also known as IIIGlc), the glucose-specific phosphocarrier protein of the phosphotransferase system (PTS). EcGK exists in a dimer-tetramer equilibrium. IIAGlc binds to both EcGK dimer and tetramer, and inhibits the uptake and subsequent metabolism of glycerol and maltose. Another well-known allosteric regulator of EcGK is fructose 1,6-bisphosphate (FBP), which binds to the EcGK tetramer and plays an essential role in the stabilization of the inactive tetrameric form. EcGK requires Mg2+ for its enzymatic activity. Members in this subgroup belong to the FGGY family of carbohydrate kinases.	0
CP034447.1\|AZO23710.1\|5309573_5310641_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226359	COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism].	4.98542e-134
CP034447.1\|AZO23722.1\|5321845_5322982_-\|DNA-protecting-protein-DprA	gnl\|CDD\|223829	COG0758, Smf, Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion].	1.37376e-130
CP034447.1\|AZO23707.1\|5306029_5306797_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	8.25498e-96

>CP034447.1|AZO23711.1|5310641_5311508_+|sugar-ABC-transporter-permease
MEKTWNNKAWFLVLPVLVLVAFSAVIPLMTVVNYSVQDTFGNNVFFWAGTEWFEELLASDRFWEAMVRNLIFSFIILAIEVPLGIFIALNMPKKGWGVPVCLVLMALPLLIPWNVVGTIWQVFGRNDIGLLGYYVNALGIDYNYVQDPIDAWVTVIIMDVWHWTSLVVLLCYAGLVSIPDAFYQAAKIDGASRWAVFRYIQLPKMQRVLLIAVLLRFMDSFMIYTEPFVVTGGGPGNSTTFLSIDLVKTALGQFDLGPAAAMSLVYFLIILLLSWVFYTVMTNYDAER
>CP034447.1|AZO23710.1|5309573_5310641_+|ABC-transporter-ATP-binding-protein
MARIEVNHIRHSYLPNPKKDSDFALKEVHHTFEDGGAYALLGPSGCGKTTLLNIISGLLHPSHGQLLFNGRDVTRLSTQERNIAQVFQFPVIYDTMTVYDNLAFPLRNRRVPEADVDRKVRETLDMIDLASMANRKARRLTADQKQKISLGRGLVRSDVNAILFDEPLTVIDPHMKWVLRSQLKQLHRRFGYTMVYVTHDQTEALTFADRVVVMYDGEIVQIGTPAELFERPRHTFVGYFIGSPGMNVLPVALEGRTAMLGAQRIELPGVPKAEAGAVELGIRPEYVRLGREGMTVQVSKVEDVGRHKVVRANLEGKEIAAVIGEDDEVPSEPKVRFDPAGINIYADSWRVEMGA
>CP034447.1|AZO23709.1|5308483_5309563_+|ABC-transporter-ATP-binding-protein
MLELRNVTKTVGAQEHIRDVSLTLQHGSLNVLLGPTLSGKTSLMRLMAGLDAPSSGSVWFDGKDVTVQPVQKRNVAMVYQQFINYPAMTVYENIASPLRVAGVEQARIDKDVRNAAALLKLTPYLDRTPLSLSGGQQQRTALARAIVKNASLVLLDEPLANLDYKLREELRAELPKIFAAAGTIFVYATTEPHEALLLGGNTATLSEGRVTQFGPTIEVFRKPADLVTARTFADPPLNSIVLAKKGSDFLLEGGVKLPVPPELLGIPDASYTIGFQPHHLSLERPNASAVPVRAKVTITEITGSESFVHLDFADARWVMLAHGILDFETDDEVEVFIDPRHIMVFDQNGSAVTASKLAA
>CP034447.1|AZO23708.1|5306923_5308444_+|glycerol-3-phosphate-dehydrogenase
MDSSPIHDIFVIGGGINGCGIARDAVGRGFSVFLAEMNDLASGTSSGSTKLIHGGLRYLEFYEFRLVREALMEREILWKNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLLPATKTLDMATDPAGKPLKPLFRKAFEYSDGWVNDARLVALNARDAADRGAIIRTRTKVVSARRDGALWTIKIRNVLTGETEEVRARLLVNAAGPWVDQVLAKAVGQNDVHNVRLVQGSHIVIRKKFDDPRAYFFQNKDGRIIFAIPYEEEFTLIGTTDRDYPGDPHDVKISDAEIDYLCAAASEYFAQAVKRSDIVWTYSAVRPLYDDGASKAQEATRDYVLKADGGEGAAPLLNSFGGKITTFRRLAESMLEKIEGFLGKRGKPWTANAPLPGGDFPATGFDAQVSKLKNVYPFLDQRLARRLTRLYGTRAEKLLGLAKSNADLGRNFGADLYEAEVRYLVENEWAVTAEDVLWRRTKRGLHFSREQTAALEEFMRGRRHVAAAE
>CP034447.1|AZO23707.1|5306029_5306797_+|DeoR/GlpR-transcriptional-regulator
MFLSPRHTEIIQMAKDHGRVLVEDLATHFSVTPQTIRKDLNDLCDQRLLTRVHGGALFPSGIENMEYEARRKIAAEEKEAIGRAAARLIPDNASLFINIGTTTEAVSKALLDHNGLMVITNNINVANRMRIYPSIEVVIAGGVVRGSDGGVVGEAAVDFIRQFKVDYAVIGASAIDHDGALLDFDFREVKVAQAIIANARHVILVSDQTKFERTAPVRIGHLSQVNTFITDRCDIPSVRRICEEKEVRLIETALE
>CP034447.1|AZO25881.1|5304251_5305880_+|hypothetical-protein
MAKSETTAEAITRALVEHSIDTVFGIPGVHMYDFNDALHRAGDKIKFIHTRHEQGAAYMAYGYAKATGRIGAFTVVPGPGVLNAGAALCTALGANAPVLCITGNIMSHLIGRGRGQLHELPDQLATLRGITKVAERIDHQSEAGFVVSEVISKMISGRKGPGSIEAPWDVFGQKGPEVPIVSAARAESARPDPLAIEQAIQLISNAKRPLIMVGGGAVDARKQVRELAERLGAPVTAHRSGKGVLPDDHPNALNLVAAYDYWKDTDLLIGVGSRLELQFMRWRYIPKNLKVIRIDIDPKEMVRLRPDAAIVADAADGVDALLEQAPRSSIDMRLEDFARLNNAARERFAAVEPQVSYVNAIRRALPRDGFFVEEISQVGFTARFAFPVFAPLQYVTCGYQETLGFGFNTALGVKVAHPDKMVISVSGDGGFMFGLQELATAVQHRINVIAIVFNNGSFGNVLRDQRQSYDGRYLGSELTNPDFVKLAESFNIPAFKATTPEELERLITTCATLDSPVLIEVPVDRGSEVSPWTYLHPAPHPD
>CP034447.1|AZO23706.1|5303409_5304141_+|peptidase
MTYCVGLKIDRGLVFMSDTRTNAGMDSISTFKKMHVWEEPGERVIVLMSAGNLATTQAVVSLLDERTKAVGDRHEKLLETPSMYQAVRLVGDTVKEVIAHSSPAGDKADSYFNASFILGGQIKGSPPRLFMIYPEGNFIESTDDTPFFQIGETKYGKPIIIRAYDRTMSLAETVKLLLVSFDSTLKSNLSVGLPLDLLFLEEDAFKVGLKKRIGQDDQYYRTISDGWSNALKAAFASLPDFPG
>CP034447.1|AZO23705.1|5302581_5303376_+|transglutaminase-family-protein
MRLKITHRTEYRYDAPVQYLLQRLRLLPQSGHTQTVASWAIKVDGAREEVRFVDQFGNDTRLVSAEGGHNTIKVEASGEVMTRDTAGVSGPHQGFAPLWLFGQQTPLTIAGDGIRELIGSAGEGTDIERLHRLMGTIRERVAYRPGATSVVTPAEEALALKSGVCQDHSHIFIAAARAMGFPARYVSGYLMTDAAVEQAASHAWAEAHVPGLGWVAFDPANGISPDERYVRVATGRDYRDAAPVSGILLGQAEEKLAVTVTVEQ
>CP034447.1|AZO23704.1|5301618_5302560_+|hypothetical-protein
MLLGRTANGLYWMNRYIERAENMARLVDAGLRMALTRTQNASEEWNSVLLSAGSDVAFSQKYQDYTVANVSDFLLRDISNPSSTMSSIETARNNARMVRTALTRETWESINEAWMSLKRILARPIDERDLPTVLDAIKRETALIRGSFYGTMLRNEIFDFSQLGTYVERADNTARILDVKYYVLLPSISWVGSTLDNYQWESILRSVSAHRSYRWVYDAEYKPTNIADYLILNVRMPRSLTFCYRFLAEHLKFLADDYGERHACHATAEKTQAMLRKGSIKDIFDHGLHEFLAEFIADNTRLGDEIAQDYRFY
>CP034447.1|AZO23703.1|5301195_5301555_+|four-helix-bundle-protein
MNSYRDLIVWKAALKLAVNCYSATKGFPNSEAYGMTSQIRRSAASIAANVAEGHGRESTGAFIQFLRTAQGSLKELETHLILSGEVGLMVEAEVASLLGQTDEIGKMLRSMIRSLQQKS
>CP034447.1|AZO23713.1|5312492_5312780_+|hypothetical-protein
MNLDFSWMAWTLPTAAFFIVIVLMLCGMGVWEYVSPGGNPRVGVLRFETTRGDRLFLSLLGSAFIHLAWLGFVGPNLWWALALSVVYAIGVFRYV
>CP034447.1|AZO23714.1|5312857_5314585_+|carbohydrate-ABC-transporter-substrate-binding-protein
MRRQILTSTTAIALLLGAGNAYAGMDEAKAFLDKEIGPLSTLSRADQEKEMQWFIDAAKPFAGMDIKVVSETIATHSYESQVLAPAFSAITGIKVTHDTIQEGDVVEKIQTQMQTGQNLYDGWVNDSDLIGTHWRYQQVRNLSDWMEGDGKDVTNPNLDLKDFIGTSFTTAPDKKLYQLPDQQFANLYWFRYDWFNDEKNKADFKAKYGYDLGVPVNWSAYEDIAEFFTGREIDGKKVYGHMDYGKKDPSLGWRFTDAWLSMAGNGDKGIPNGLPVDEWGIKVDENSRPVGSCTARGGDTNGPAAVYSIQKYLDWLKAYAPAEAQGMTFSEAGPVPAQGAVAQQMFWYTAFTASMVDAGAKAVLNDDGTPKWRMAPSPHGVYWKDGMKLGYQDVGSWTLMKSTPTDRAKAAWLYAQFVTSKTVDVKKSHVGLTFIRESTIHDKSFTERAPKLGGLIEFYRSPARVQWSPTGTNVPDYPKLAQLWWQAIGDASSGAKTAQEAMDSLCAEQEKVMSRIEKSGVQGDIGPKMAEEHDLAYWNADAVKKGNLAPQLKIENEKEKPITINYDELVKSWQK
>CP034447.1|AZO23715.1|5314677_5316171_+|glycerol-kinase
MSGFVLAIDQGTTSTRAILFDDEMKVAGIGQQEFPQHYPASGWVEHDPEDIWSSVVATVKAALKAAGRAAFDVAAIGITNQRETVVIWDKATGKPIHNAIVWQDRRTAPLCQKLRKQGLEKKFTRKTGLLLDPYFSGTKIAWMLDKVKGARKRAEKGELLAGTIDSFLIWRLTGGKVHATDATNASRTLIYNIEKNAWDDELLSILNIPAAILPQVKDCADDFGVAEKSLFGAEMRIFGVAGDQHAATIGQACFEPGMMKSTYGTGCFALLNTGADLVRSKNRLLTTIAYRLNGRTTYALEGSIFIAGAAVQWLRDGIKVIGKAEQSGALAAAADPAQAVYLVPAFVGLGAPHWDADARGSIFGLTRNSGPAEFARAALESVAYQTRDLLDAMRKDWKGASARTVLRVDGGMVASDWTMQRLADILDAPVDRPTILETTALGAAWLAGSKAGVWPKAKEFAKTWALDRRFKPDMDAGTRSAKLAGWRDAVRRTLSTN
>CP034447.1|AZO23716.1|5316243_5316777_-|BA14K-family-protein
MRPGVWRNYRTARPLPPQGTTTTLEEKTMNKISSGLLATALSVSFAAAEIVPVNAQPNYVPQGQDLSNVQTVQYQDWRKRRSFNRSQSAMYERNGAVYWNGHRGYREYHRGYRRHGDFWFPLAAFATGALITGAIVNSQNRYADAHVQWCYDHYRSYRASDNTYLSRYGRRECRSPY
>CP034447.1|AZO23717.1|5317555_5317822_-|hypothetical-protein
MTMKFPFTEDTLGKKLEAGTGLSVDCLTCKRKATLDVAELVKRLGPDHGAMLWSLIKVLFCHECRDAGRDDRNLQFTNHAMTPDKRKG
>CP034447.1|AZO23718.1|5318363_5318567_-|hypothetical-protein
MSKTTLIAIAILAISVGYAEAGGRKIPPVCTASSPLFEVLDGRCSLVKGSMIYGDIADLSQIIHLGW
>CP034447.1|AZO23719.1|5319586_5320126_+|J-domain-containing-protein
MFIDYYELLEISPNANSETIERIFRYFAMRYHPDNRDTGDESRFSEIVEAHNTLKDPVKRAQYDVQYKDNLSLRRELTEEAGNAKGLERDIVIQAKLLSLLYVKRRQDVNNPGIGDEELERLSGCPREHLEFHLWYLKAKGWIARIENGMFAITVDGIDRANSEHRRETAATRLLNHAS
>CP034447.1|AZO23720.1|5320307_5320490_+|hypothetical-protein
MPEKKVIAVKDWTCAMSDELGRVALMVNPTDGEPIMVLMTIFQAAKMGRELQSPKRVQSI
>CP034447.1|AZO23721.1|5320692_5321838_+|hypothetical-protein
MALDLSVDTSAAKAATPPGKYLFGPVADFLMLGGGAFVILPVLLLVPLEYEGLVAATMVVVAYLVNYPHFAHSYQIFYRNFGRKVSGNGYDRSLQLRYIFAGIVVPVIMGAFFAYGAATANTRLLGYAANAMFFFVGWHYVKQGYGMLMVDAVLKRKFFDGRDKKVLLVNSYAVWILAWLQTNTAVTQGKYYGLEYYTFAAPAWITNIALLVAVASTAVTILMLINRWRRNGRALPYNGIVAYVASLYLWILIARINPLWLLVVPALHSLQYLAVVWRYQTNVERDGPDAVGYPQLKILSVVGPLYRLRVLGFIVGGAALGYLGFWLIPMAMTALIPYDRQVLGSSLFFFIVLIFINVHHYFLDNVMWRRGNPEVSRYLFR
>CP034447.1|AZO23722.1|5321845_5322982_-|DNA-protecting-protein-DprA
MIAPAAGPRLSDRQRLAWLRLIRTPNVGPASFRELINRFGSAEAALEMLPELMISGGANRIVRIPSIAEAEAELEAARRAGARFVGIGEADYPALLKTMDNPPPLLAAKGEGAVFRLPAVAIVGARNASLAGIKMARMLAADLGRDGYAIVSGLARGIDTAAHQGSLSTGTVGVLAGGLDVPYPPENAGLCDDIAERGGAIVSEMPFGWQPRAQDFPRRNRLVAGMAMGLVVVEAAQRSGSLISARLANEMGRLVFAVPGSPLDPRAAGSNALLKDGAMLVTEAADILGALAPLAGTRPPRTAPLAEAPDLSSMPPPGENERADVLEALGPTPIGVDEIIRHTGLSAAQIAMVLLELDLAGRLERHAGGNVSLVFGRS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_9

6177643-6177725

Orphan

Consensus_repeat	Method
GTTTTGACGCAATTCCGGACGGAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_9

>merge|CP034447|9|6177643-6177725|CRISPRCasFinder
GTTTTGACGCAATTCCGGACGGAAAATCGCTGCGCACTTTTCCTGGAATTGGTATTCGTTTTGGCGCAATTCCGGACGGAAAA

>CP034447|9|9|6177643-6177725|CRISPRCasFinder
GTTTTGACGCAATTCCGGACGGAAAA	TCGCTGCGCACTTTTCCTGGAATTGGTATTC
GTTTTGGCGCAATTCCGGACGGAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO24501.1\|6176627_6177527_-\|catechol-1,2-dioxygenase	unknown	unknown	gnl\|CDD\|225312
CP034447.1\|AZO24504.1\|6180770_6181754_+\|xanthine-dehydrogenase-family-protein-subunit-M	unknown	unknown	gnl\|CDD\|224238
CP034447.1\|AZO24507.1\|6185771_6186701_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP034447.1\|AZO25938.1\|6179226_6179841_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP034447.1\|AZO24506.1\|6184663_6185674_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176237
CP034447.1\|AZO25937.1\|6180291_6180774_+\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|224991
CP034447.1\|AZO24503.1\|6178120_6178951_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381357
CP034447.1\|AZO24499.1\|6174482_6175859_-\|amidase	unknown	unknown	gnl\|CDD\|223232
CP034447.1\|AZO24502.1\|6177771_6178071_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO25940.1\|6184231_6184633_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO24500.1\|6175971_6176574_-\|sulfotransferase-family-protein	unknown	unknown	gnl\|CDD\|380018
CP034447.1\|AZO24495.1\|6170113_6170695_-\|GNAT-family-N-acetyltransferase	unknown	unknown	unknown
CP034447.1\|AZO24497.1\|6173428_6173617_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO24492.1\|6167754_6168966_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
CP034447.1\|AZO25939.1\|6180077_6180281_+\|hypothetical-protein	unknown	unknown	unknown
CP034447.1\|AZO24505.1\|6181750_6184045_+\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
CP034447.1\|AZO24493.1\|6169003_6169300_-\|DUF1330-domain-containing-protein	unknown	unknown	gnl\|CDD\|377765
CP034447.1\|AZO24494.1\|6169439_6170054_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
CP034447.1\|AZO24496.1\|6170796_6173094_-\|potassium-transporter	unknown	unknown	gnl\|CDD\|223551
CP034447.1\|AZO24498.1\|6173730_6174462_+\|DUF2270-domain-containing-protein	unknown	unknown	gnl\|CDD\|227817

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO24501.1\|6176627_6177527_-\|catechol-1,2-dioxygenase	gnl\|CDD\|225312	COG2514, COG2514, Predicted ring-cleavage extradiol dioxygenase [General function prediction only].	7.22849e-42
CP034447.1\|AZO24504.1\|6180770_6181754_+\|xanthine-dehydrogenase-family-protein-subunit-M	gnl\|CDD\|224238	COG1319, CoxM, Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion].	3.34082e-76
CP034447.1\|AZO25938.1\|6179226_6179841_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.07321e-09
CP034447.1\|AZO24506.1\|6184663_6185674_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176237	cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines.	1.01805e-150
CP034447.1\|AZO24499.1\|6174482_6175859_-\|amidase	gnl\|CDD\|223232	COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis].	1.38621e-119
CP034447.1\|AZO24500.1\|6175971_6176574_-\|sulfotransferase-family-protein	gnl\|CDD\|380018	pfam17784, Sulfotransfer_4, Sulfotransferase domain. This family of proteins are distantly related to sulfotransferase enzymes. This protein in S. mansonii has been shown to be involved in resistance to oxamniquine and to have sulfotransferase activity.	1.49527e-70
CP034447.1\|AZO25937.1\|6180291_6180774_+\|(2Fe-2S)-binding-protein	gnl\|CDD\|224991	COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion].	3.0258e-87
CP034447.1\|AZO24503.1\|6178120_6178951_-\|aldo/keto-reductase	gnl\|CDD\|381357	cd19131, AKR_AKR5C2, Escherichia coli 2,5-diketo-D-gluconic acid reductase A (DkgA/YqhE) and similar proteins. Escherichia coli DkgA/YqhE is a founding member of aldo-keto reductase family 5 member C2 (AKR5C2). DkgA/YqhE (EC 1.1.1.274), also called 2,5-DKG reductase A, or 2,5-DKGR A, or 25DKGR-A, or AKR5C, catalyzes the reduction of 2,5-diketo-D-gluconic acid (25DKG) to 2-keto-L-gulonic acid (2KLG). It is also capable of stereoselective -keto ester reductions on ethyl acetoacetate and other 2-substituted derivatives.	2.27849e-163
CP034447.1\|AZO24492.1\|6167754_6168966_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.61801e-66
CP034447.1\|AZO24507.1\|6185771_6186701_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.33118e-80
CP034447.1\|AZO24505.1\|6181750_6184045_+\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	0
CP034447.1\|AZO24493.1\|6169003_6169300_-\|DUF1330-domain-containing-protein	gnl\|CDD\|377765	pfam07045, DUF1330, Domain of unknown function (DUF1330). This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.	1.02484e-39
CP034447.1\|AZO24494.1\|6169439_6170054_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	3.16943e-31
CP034447.1\|AZO24496.1\|6170796_6173094_-\|potassium-transporter	gnl\|CDD\|223551	COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism].	6.30751e-72
CP034447.1\|AZO24498.1\|6173730_6174462_+\|DUF2270-domain-containing-protein	gnl\|CDD\|227817	COG5530, COG5530, Predicted integral membrane protein [Function unknown].	1.33945e-102

>CP034447.1|AZO24501.1|6176627_6177527_-|catechol-1,2-dioxygenase
MDDGLLSQATRLGPVHLRVTDIPAALTVWRDTLGLDPIGEDAVTAELGAGGRALIVLHAGAVTALPQKSRDLFHVAIHVTTRRDLAHAAARLKASRLRYSAQDHLISESLYVSDPSGNGIEICFDTPERFLRREVSADGRVTLIAVDGSAHSGLEALDVPGLLRDLGNSGHVEPRMAADAFIGHIHMRARAPEALMQFYVGVLGFRPHIQSRTFGMFDCGTGRRPHMVAFNIWAREELREPPPNAAGLDHFTVELASTEELDAVASRLNDANVPAKRIGDAIEAADPEGSRLRLVVQGV
>CP034447.1|AZO24500.1|6175971_6176574_-|sulfotransferase-family-protein
MSLRVVGTGFGRTGTDSMREALTMLGFGPCHHMSEVMAHEEQKRLWRALAKGAAPDWGKLFAGYISCVDWPSAHYWRELIQAYPLARVILTWRSPESWWESFAKTIVPAISDSQDQESLGIALIKKQVFGGRPQDRAHAIAVYEANVEAVLKTVPAGRLLIHKLGDGWEPLCAHLGVPVPAEPYPNRNTAKEFRTALSLN
>CP034447.1|AZO24499.1|6174482_6175859_-|amidase
MIYPETTFLTATQLAAAIREKKVSAVEAMEAQLARIALVNPLLNAIVTLDEEAARAGAKAADLAIARGEAVGPLTGVPVTLKDGHATAGMRTTVGLEACADHVPTTDSTIAARLRKAGAIIIGKTNVPPRLRDFQTVNPIFGRTVNPWDVTRTPGGSSGGAAAAVAAGLVPLEIGSDAGGSIRVPAHLTGIYGFKPTQATVPITGSYADPPDMPRSFRLLFDIGPLARDVDDLILAHRIIAGADGLDTEVPPVATDEMPEPALDELKVAWAPTFPGVPVAIDIADAITGFARALDIAGARVGQALPRHDFAAERTLFSVFITWYSEAFQPPREASPSLSAYLEALNQRDEFIIAWERFFDDWDVLVCPAMMCTAFRHRETGAPIPVDGVETPYWSALSHVCRFNLTGHPAVVIPIGLDREGLPIGAQLVGRRHSEMTLLAVAKALARLTDGFVRPPGL
>CP034447.1|AZO24498.1|6173730_6174462_+|DUF2270-domain-containing-protein
MSQVQTIKPAEAAAAPRGSDAFALKLTSSEFATTMSHFHRAEIARMAGWRDRLDRTSNWSITVVAAMLSVSLSTPSAHHGVLLFAMLLITLLLWIEARRYRFFDVYRARVRQFERYYFAQIFSPQPDYASNWLAIVGEGLRSPRFLISQRAALIRRLRRNYIFMYTILLLAWILKITTPSLSREGSPIGFGASLLDTFRVATLGPIPGIVVVCGVVVFYLALLAAAFLMRADDGELSFGDVHV
>CP034447.1|AZO24497.1|6173428_6173617_+|hypothetical-protein
MKSDFAAAHLHLDRACHYLRGDDETSRTALAALDLVIEAVATAQYARPEAEVLQFPATSKRA
>CP034447.1|AZO24496.1|6170796_6173094_-|potassium-transporter
MPNRRRLLSVSLALAPAALLLMPAVAWAAEKSGMSSEGIFVLEIILLLVVGRGIGELLERFGQPAVMGQLIGGILLGPSLLGWLWPAAERVVFTGDAAQKSMINAIAQLGVLMLLLLTGMETDLRLVRRVGRACFSISATGVAVPFVLGFAAAQFMPDTLLAAGSERVVAGLFLGTALSISSVKIVAMVVREMNFMRRDLGQIIVSSAIIEDTIGWVIIAITIGIATHGRIEAGSLAFTLAGVAAFMGFSFTLGRRIVFDAIRWTNDTFRSEYAVVTVILAIMGAMALITELIGVHTVLGAFVAGILVGESPILSRHIEGQLRGVITALFMPVFFGVAGLSADLTVLADPELALLTVALVAIASLGKFGGAFIGAELSGMSRAEGIAVGCGMNARGSTEVIVASIGLSIGVLSHNLFTMILTMAVITTLAMPPTLRWTLGRLTIGEAEKKRLEREEVDQRGFIANLERLLVVVDEGVVGRFAAYLAGVVGAGKPMTVLHASGESEAEPGEAAHLDEIEKGAEEGREAAKEADEEPVREAPLTRRRHEVQLSAEAVAKEARKGYGMLLIGLGRAVTAKGGFSHRLNEVAGAFDGPLCLVLKPVAAGRHMPRLGPESGRILVPVNGTSVARRGAELALAIAAVTGAPVKMLYVARVGRDQPRDAVSHRRREAVLKDIVALADRYGVEIETAIRSRPAAADAIARQAGRGVALIVMGVARRPGEELLFGETTSDVLQRCRCPVVLISDARLRRDDEGREALRSGTGTG
>CP034447.1|AZO24495.1|6170113_6170695_-|GNAT-family-N-acetyltransferase
MSFSVKPLDTTTWPHFAALVERHNGVWGGCWCMAFHAKGVGAAGNRAAKEVLVREGRAHAALVFDGPACVGWCQFGPTAELPRIKHQRAYREGLTALPDWRITCFFSDKAHRGKGVAAAALAGALTEIGRLGGGRVESYPEDSEGRPVAGAFLHNGTLAMFEAQGFSCNRQIGKHRWVVEKMVTAAGASPARG
>CP034447.1|AZO24494.1|6169439_6170054_-|LysE-family-translocator
MTLSGFAAYSGALAIAAIIPGPQIVAIVAQALRSGYRHAAWMTAGMVLGDVLYLAAVLAGLAFIAETFSFLLIAIKWAGIAYLCWLAVQFWRAGETFEVSDSGAARSGGNAFLSGVLVTLGNPKSVLFYISILPTVVDIGALSALDVPILLAITAVILAAVQFPFAIAGAGTRRTLQSPRAARLFNRGAAVCMGGAAATIALRN
>CP034447.1|AZO24493.1|6169003_6169300_-|DUF1330-domain-containing-protein
MPAYLIADVDVTDMAMFDEYRREVPATEARYGGHYLARGGTTKVLEGDWEPHRLVIIEFPDMAALTAWYDSPEYERLKQIRFRCAHTRIIALEGVAPA
>CP034447.1|AZO24492.1|6167754_6168966_+|MFS-transporter
MKLSYRWVIVAAGALMTCVALGAMFSLAIFLEPMSLDTGWSRAGISSAMTLNFLVMGVGGFAWGAIYDRFGARPVVLAGAVLLGLALVVASRANSLLVFQLSYGVIVGLAASAFFAPMIALTTAWFDTNRSLAVSLVSAGMGVAPMTISPFARWLISAYDWRTAMFDIGVMAWVLLLPAVFLVRQPPAAVAAHDGSMPAPAADDPGMSVGQALRSPQFLVLGMTFFACCAAHSGPIFHMVSYAMACGVAPMAAVSIYSVEGLAGLGGRVLYGVLADRLGVKPVLIAGLAIQGMVIAAYLGAARLEHFYVLAVIFGATYGGVMPLYAVLAREYFGGRIIGTVLGAATMLSSLGMSFGPLAGGMIYDAYASYSWLFVGSALVGLGAAGIAIAFPPQPSRQRLQMA
>CP034447.1|AZO24502.1|6177771_6178071_+|hypothetical-protein
MDETDHWRNMASAPRDGSRILVTVRSSEQGPAEVDMAYWSRADQFGEEGWRASDSSPGRVVEYAEPELRCWMPLPTAGRGSMPSPWEGEDVPLVDGEGI
>CP034447.1|AZO24503.1|6178120_6178951_-|aldo/keto-reductase
MSEQLKLNDGATIPQIGLGVWQVDPDITAKVVRWGIEAGYRLIDTAEGYRNEEGVGEAIRAAGLPRSELFITSKLRNGGHQRDAALRAFDDTMQKLGIDRIDLFLIHWPVPSQDKYVEAWKTLVELKQAGRIKSVGVSNFNQDHLERIIGETGVTPVVNQIELHPHFQQRDKREFHAKHDIKIESWSPLGSGRLLADPTLAAIAKKHGKSVAQVIIRWHLQQGLVVIPKSVHQDRIAGNFNVFDFELDAGDMETIQGMDSADGRTGPDPATAAFLF
>CP034447.1|AZO25938.1|6179226_6179841_-|TetR/AcrR-family-transcriptional-regulator
MSERPPASAEEKPDASAQKPLRADAQRNRDKLVEMAAQAFAADGVDASLEEIAKRAGVGIGTLYRHFPTREHLVEVVYRREVEGLCQAADELARDHPADVALEFWMQRFVDYIATKRGLATSLRLLLTTNSTLFSDTSGRVSGAMRSLVEAAAASGKIRADVDASDVMHALGGIYSAPNTPDWRERSGRLVKLLMDGLRFGARG
>CP034447.1|AZO25939.1|6180077_6180281_+|hypothetical-protein
MSLKKSRPPTPRSFAPPSALPGISPTWGEIGSSYALALLRASDLAPLLPSPISIRLASSNRSPTPHE
>CP034447.1|AZO25937.1|6180291_6180774_+|(2Fe-2S)-binding-protein
MSPTTLSINLTINGRDHALDIEPRVTLLDALRERLHLTGTKKGCDQGQCGACTVHVDGQRVLACLTLAAQVEGRSITTIEGLADEDGTLNAVQAAFLEQDAFQCGYCTPGQIMSAVACIREGHAGSDEEIREYMAGNLCRCGAYPHIVAAVRQAAKELRS
>CP034447.1|AZO24504.1|6180770_6181754_+|xanthine-dehydrogenase-family-protein-subunit-M
MKDFSYLRADSVEAARNAAALPGAMLLAGGTTLVDLAKCGVAEPSTVIDISHIEGLNAIDVSADRAVIGALARMSHVADDAGVKSLFPAVSEALWQAASAQLRNMATIGGNLMQRTRCPYFRDPQNFPTCNKRAPGSGCSAIGGVTRGHAVLGTSEACIATYPGDLAIALVAFDAEVDLGERRLKVEDFFLAPGATAEQEHDIRPGEVIVGIEIPGSAAARRSTYLKIRDRQSYEFAAASAAVGLELESDGRAIRDIRVALGGVATKPWRARAVEEALKGKTLDEATVRKASELAMEGAVDHGANHYKIALAPRVIARAILELGETA
>CP034447.1|AZO24505.1|6181750_6184045_+|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MTVHDMKHAASDSARLEAVGGRLSRVDGPAKITGAAQYAVEQQLEGLTHAVLVGATIAAGKVTAIDTRAAETAPGVLAVLTPDTIMPLKTASDWFGNRPSDGPYCPLAREVTFSGQHVAAVVAETFEQAVAAAALVKVWYDEMPAIVDLSDGKAGDGIPIDAMTKEWGDAQAAFAEAPVRICAAYNTQREFQAAMEPHGLIARWQGDELTIWEPSQWLDGMARTYAEWFGVPFENVRLVSPYIGGGFGSKALALAHSAVAAAAARMLGRPVKLMLNRPQNFTSYGGRAATRQTVAIGADGEGRIQSIVHRGVNETAVDGMWVEPLGSVTSIMYATPNFSSKQNVVRVNTVVPGAKRAPGENPSAFGIECAIDELAYELGLDPLEIRLRNYAEQDPEAKKAWSTRQLREAFATGADAFGWAKRSREPRSMRDGHQLIGWGVAAGTYPVRRAYGEAVVRLSADGSAEVESSSIDMGQGTYTILAQTAAETLGVPVGKVSVKLGDSRLARAGVTGGSRLAGVMTGAVYKAAGQALDELIGLALSDPRSPFHGLQANTLVVNDGRVASPRGDGPELSIAELMGMLGREKIEARGDTVPASFTREQRYNNYTTIATALPHTEGDYSRHSWCAHFVEVRVDEDFGTVRVSRVVSALDSGRLYNPKLAESQWKGGIIMGIGQALLEEGIVDRRHGRIVNGNFADYMLPTNADIPDIQTISVGIPDPHSSALGGKGVGELAIVGIAPAIANAVFHATGKRVRDLPITLEKLI
>CP034447.1|AZO25940.1|6184231_6184633_+|hypothetical-protein
MEEDEGGSVMTASVCGGPKGDAHLMLTCFAKPVLSYDIGAAGGQLEPGINASFTFKAGGKIVTRKLDLEAMYNYFTAELSGPADPLLALLRGKGEATVSAAKYGEASFPLKGSGAAIGKVLAACGKGSGDEAD
>CP034447.1|AZO24506.1|6184663_6185674_-|NAD(P)-dependent-alcohol-dehydrogenase
MKAIELTQPRLDAFRTASVATPEPQRGEVLIRQRAASLNFVDVAVASGNYPGPVFPLIPVADGAGEIVALGEGVTRFAVGDRVVAHAKPRWIGGRPRPYEMTQMRGISLPGSLAEYVALPANSVVPVPAHLSFEAASTLPIAGTTAWNALRAADVGPGSVVVLLGTGGVSIFTLQLAKAAGATVIITSSSDEKLERAKALGADHLINYRATPDWDGKVLELTGGLGADLVVETGGTATFACAVNATAPGGTLFTIGFVTGAEATVNLLPIIIKALKVVGNNTGSVSDLRDAARAIGAAGIEPVVDKVFSQNEATEAYTHMAAGGLHFGKLVFGLEW
>CP034447.1|AZO24507.1|6185771_6186701_+|LysR-family-transcriptional-regulator
MQQSHEPAALAEMAAFAAVAEARSFTRAAARVGRDATILSRRLQSLEERLGVRLLHRTTRSVSLTEAGAEFLVRVRAILASVDEAEAAASAHAGGGPRGLLRLALPGTFGRMWVAPFLPQFLAEFPNVRIEAEFSNRFADLVAENFDVAVRLGSLEDSRLVARKVATRRRLLCASPSYLARRGRPETPQALLEHSCLGFTGFQTFPAWEMTDREGRRVRVEVSGPLVSDDAEVLVEAAVQGVGLMMSTDWLVGRELADGRLVPILEDWTLADEGAVYVVMPSAKGQAAKTRAFADWIGKRFSPEPPWRR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP034447_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP034447_10

6830789-6830885

Orphan

Consensus_repeat	Method
GCATGCCGTGATCCCAAAAGCGTTGTGCACTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP034447_10

>merge|CP034447|10|6830789-6830885|CRISPRCasFinder
GCATGCCGTGATCCCAAAAGCGTTGTGCACTTTTGGGCGGCATGCACCAGTCTTTGTTTTGGCGCATGCCGTGATCCCAAAAGCGCTGTGCACTTTT

>CP034447|10|10|6830789-6830885|CRISPRCasFinder
GCATGCCGTGATCCCAAAAGCGTTGTGCACTTTT	GGGCGGCATGCACCAGTCTTTGTTTTGGC
GCATGCCGTGATCCCAAAAGCGCTGTGCACTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP034447.1\|AZO26001.1\|6816735_6817182_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227296
CP034447.1\|AZO25080.1\|6824065_6825694_-\|alpha-D-glucose-phosphate-specific-phosphoglucomutase	unknown	unknown	gnl\|CDD\|100087
CP034447.1\|AZO25083.1\|6828537_6830751_-\|1,4-alpha-glucan-branching-protein-GlgB	unknown	unknown	gnl\|CDD\|235445
CP034447.1\|AZO25086.1\|6834328_6835393_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
CP034447.1\|AZO26002.1\|6839699_6840842_+\|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223476
CP034447.1\|AZO25092.1\|6842804_6844748_-\|sulfate-adenylyltransferase-subunit-CysN	unknown	unknown	gnl\|CDD\|180120
CP034447.1\|AZO25079.1\|6822695_6823826_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP034447.1\|AZO25076.1\|6817181_6818936_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227002
CP034447.1\|AZO25091.1\|6842008_6842842_-\|3'(2'),5'-bisphosphate-nucleotidase	unknown	unknown	gnl\|CDD\|130398
CP034447.1\|AZO25090.1\|6838472_6839396_+\|carbohydrate-kinase	unknown	unknown	gnl\|CDD\|238572
CP034447.1\|AZO25081.1\|6825697_6827143_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP034447.1\|AZO25089.1\|6838029_6838476_+\|transporter	unknown	unknown	gnl\|CDD\|226632
CP034447.1\|AZO25082.1\|6827210_6828476_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|234824
CP034447.1\|AZO25077.1\|6818944_6820594_-\|DUF3459-domain-containing-protein	unknown	unknown	gnl\|CDD\|200469
CP034447.1\|AZO25075.1\|6814853_6816446_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
CP034447.1\|AZO25084.1\|6830935_6833398_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP034447.1\|AZO25087.1\|6835554_6836589_-\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380628
CP034447.1\|AZO25088.1\|6836800_6838027_+\|ROK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224851
CP034447.1\|AZO25085.1\|6833543_6834326_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
CP034447.1\|AZO25078.1\|6820593_6822591_-\|glycogen-debranching-enzyme-GlgX	unknown	unknown	gnl\|CDD\|131155

Protein	Function_ID	Function_description	E-value
CP034447.1\|AZO26001.1\|6816735_6817182_+\|pilus-assembly-protein	gnl\|CDD\|227296	COG4961, TadG, Flp pilus assembly protein TadG [Intracellular trafficking and secretion].	8.71076e-23
CP034447.1\|AZO25080.1\|6824065_6825694_-\|alpha-D-glucose-phosphate-specific-phosphoglucomutase	gnl\|CDD\|100087	cd03085, PGM1, Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes. In one direction, G-1-P produced from sucrose catabolism is converted to G-6-P, the first intermediate in glycolysis. In the other direction, conversion of G-6-P to G-1-P generates a substrate for synthesis of UDP-glucose which is required for synthesis of a variety of cellular constituents including cell wall polymers and glycoproteins. The PGM1 family also includes a non-enzymatic PGM-related protein (PGM-RP) thought to play a structural role in eukaryotes, as well as pp63/parafusin, a phosphoglycoprotein that plays an important role in calcium-regulated exocytosis in ciliated protozoans. PGM1 belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
CP034447.1\|AZO25083.1\|6828537_6830751_-\|1,4-alpha-glucan-branching-protein-GlgB	gnl\|CDD\|235445	PRK05402, PRK05402, 1,4-alpha-glucan branching protein GlgB.	0
CP034447.1\|AZO25086.1\|6834328_6835393_-\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	7.58978e-79
CP034447.1\|AZO26002.1\|6839699_6840842_+\|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein	gnl\|CDD\|223476	COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane].	6.49365e-151
CP034447.1\|AZO25092.1\|6842804_6844748_-\|sulfate-adenylyltransferase-subunit-CysN	gnl\|CDD\|180120	PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional.	0
CP034447.1\|AZO25079.1\|6822695_6823826_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	6.28393e-23
CP034447.1\|AZO25076.1\|6817181_6818936_+\|hypothetical-protein	gnl\|CDD\|227002	COG4655, COG4655, Predicted membrane protein [Function unknown].	4.85222e-162
CP034447.1\|AZO25091.1\|6842008_6842842_-\|3'(2'),5'-bisphosphate-nucleotidase	gnl\|CDD\|130398	TIGR01331, 3'2'5'-bisphosphate_nucleotidase_CysQ, 3'(2'),5'-bisphosphate nucleotidase, bacterial. Sulfate is incorporated into 3-phosphoadenylylsulfate, PAPS, for utilization in pathways such as methionine biosynthesis. Transfer of sulfate from PAPS to an acceptor leaves adenosine 3'-5'-bisphosphate, APS. This model describes a form found in bacteria of the enzyme 3'(2'),5'-bisphosphate nucleotidase, which removes the 3'-phosphate from APS to regenerate AMP and help drive the cycle. [Central intermediary metabolism, Sulfur metabolism].	1.56161e-117
CP034447.1\|AZO25090.1\|6838472_6839396_+\|carbohydrate-kinase	gnl\|CDD\|238572	cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.	1.77969e-91
CP034447.1\|AZO25081.1\|6825697_6827143_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP034447.1\|AZO25089.1\|6838029_6838476_+\|transporter	gnl\|CDD\|226632	COG4154, FucU, Fucose dissimilation pathway protein FucU [Carbohydrate transport and metabolism].	1.06419e-59
CP034447.1\|AZO25082.1\|6827210_6828476_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|234824	PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP034447.1\|AZO25077.1\|6818944_6820594_-\|DUF3459-domain-containing-protein	gnl\|CDD\|200469	cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins. Oligo-1,6-glucosidase (EC 3.2.1.10) hydrolyzes the alpha-1,6-glucosidic linkage of isomalto-oligosaccharides, pannose, and dextran. Unlike alpha-1,4-glucosidases (EC 3.2.1.20), it fails to hydrolyze the alpha-1,4-glucosidic bonds of maltosaccharides. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
CP034447.1\|AZO25075.1\|6814853_6816446_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
CP034447.1\|AZO25084.1\|6830935_6833398_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP034447.1\|AZO25087.1\|6835554_6836589_-\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380628	cd19973, PBP1_ABC_sugar_binding-like, monosaccharide ABC transporter substrate-binding protein. Periplasmic sugar-binding domain of active transport systems that are members of the type 1 periplasmic binding protein (PBP1) superfamily. The members of this family function as the primary receptors for chemotaxis and transport of many sugar based solutes in bacteria and archaea. The sugar binding domain is also homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR. Moreover, this periplasmic binding domain, also known as Venus flytrap domain, undergoes transition from an open to a closed conformational state upon the binding of ligands such as lactose, ribose, fructose, xylose, arabinose, galactose/glucose, and other sugars. This family also includes the periplasmic binding domain of autoinducer-2 (AI-2) receptors such as LsrB and LuxP which are highly homologous to periplasmic pentose/hexose sugar-binding proteins.	7.40716e-160
CP034447.1\|AZO25088.1\|6836800_6838027_+\|ROK-family-transcriptional-regulator	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	5.70493e-48
CP034447.1\|AZO25085.1\|6833543_6834326_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	9.24191e-110
CP034447.1\|AZO25078.1\|6820593_6822591_-\|glycogen-debranching-enzyme-GlgX	gnl\|CDD\|131155	TIGR02100, Glycogen_operon_protein_GlgX_homolog, glycogen debranching enzyme GlgX. This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0

>CP034447.1|AZO25083.1|6828537_6830751_-|1,4-alpha-glucan-branching-protein-GlgB
MRKPRATAATSGPDGLAQAGDVAAIVAGTHGDPFAVLGVHEADKGFVARCFVPNAEFVTAYTLTGKEVGQLIRSNDAGFFEGRLSIRKRQPLRYHARNAGGDWWLTDPYSFGPVLGPMDDYYMAEGSHLRLFDKLGAHIIEHEGATGVHFAVWAPNARRVSVVGAFNDWDGRRHTMRDRKDTGIWELFIPDLRAGQPYKFEIIGPDGVRLPLKADPFAFESEMRPATASVTAPPMAHQWGDEAHHKFWQDVDPRREAISIYEVHAGSWQRRDDGTFLTWDELAARLIPYVVDAGFTHIEFLPVSEHPYDPSWGYQTTGLYAPTARFGDPDGFARFVDGAHRAGVGVILDWVPAHFPVDEHGLVQFDGTALYEHADPRQGFHPDWNTAIYNFGRREVVSFLVNNALFWAEKYHVDGLRVDAVASMLYLDYSRKAGEWIPNEKGGRENLQAVSFLQKMNKELYGHHPGVMTIAEESTSWPKVSRPVHEGGLGFGFKWNMGFMHDTLEYLSKEPIFRKHHHNDITFGLTYAFSENFVLPLSHDEVVHGKGTLLHKMAGDDWQKFATLRAYYAFMWGYPGKKLLFMGQEFAQRREWSEARALDWNLLDYAPHRGVWQVVRDLNYLYRSRPALHARDCEPEGFSWLIVDDRDNSVFAWLRSAPDGNPIAVISNFTPVPRENYRVPLPKAGEWREIMNTDAAVYGGSGMGNGGRVAASGEGGGTSATMLLPPLSTIMLEFVAD
>CP034447.1|AZO25082.1|6827210_6828476_-|glucose-1-phosphate-adenylyltransferase
MAEIKRTQPLARDAMAYVLAGGRGSRLKELTDRRAKPAVYFGGKTRIIDFALSNALNSGIRRLGVATQYKAHSLIRHLQRGWNFLRPERNESFDILPASQRVSETQWYEGTADAVYQNIDIIEAYGPEYMVILAGDHIYKMDYELMLRQHVDAGADVTVGCLEVPRMEATGFGVMHVDAKDNIIAFVEKPADPPGIPDKPEFALASMGIYVFKTKFLMEQLRRDAAEPGSSRDFGKDIIPYIVQHGKAIAHRFAKSCVRSSHEAEPYWRDVGTVDAYWEANIDLTDVTPELDLYDRDWPIWTYAELKPPAKFVHDEDGRRGEAISSLVSGDCIVSGASLRRSLIFTGARINSYSKLEEVVMLPDVQVGRKARLTRVVIDHGVHIPEGLVVGEDPALDAKRFRVSEKGICLITQDMINKLST
>CP034447.1|AZO25081.1|6825697_6827143_-|glycogen-synthase-GlgA
MQVLSVTPEIFPLIKTGGLADVTGALPIALAGKGVAMRTLVPGYPVVMEAFKKKKAVYQYPLLQGGKASVHAVKIGELDLFVLDAPHLFDRVGGPYGNSSGADWSDNWRRFAALSQVGGDIAGGAISGYQPDIVHAHDWQSAMTLAYMRYGKAVGVPSLITVHNLAFQGQFGAGIFGELGLPGVAMQLDGVEYYGGVGYLKAGLQAAWAITTVSPTYAQEIRSPEFGMGLDGLINMRAVDLHGIVNGIDVDIWNPATDKHLVANYSADTLEARGLNRKAVEDRFNLESDDSPIVCVISRLTWQKGMDILAAVVDGVVQRGARLAVLGSGDAGLEGSLLAAAARHRGRVGVVVGYDEGLSHIMQGGCDAIVIPSRFEPCGLTQLYGLRYGCVPVVARTGGLADTIIDANEAALSAGVATGFQFAPNNGGALLHAIRQLVEVHARPAAWASIQRQGMKADVSWDKSAEKYIELYRLLLSKRAA
>CP034447.1|AZO25080.1|6824065_6825694_-|alpha-D-glucose-phosphate-specific-phosphoglucomutase
MIKTVSTKPYTDQKPGTSGLRKKVPVFQQEHYAENFIQSIFDALEGFEGKTLVIGGDGRFYNREVIQKAIAMAAANGFGKVMVGQGGILSTPAASNIIRKYKTFGGIILSASHNPGGPHEDFGIKYNAGNGGPAPEKITDAIFEKTKTISSFKIADIGQIDIDKIGTVEAGGMTVEIIDPVTDYAELMESLFDFDAIRANFKYGFRMRFDAMHAVTGPYAKEILERRLGAPNGTCRNFKPLPDFGGHHPDPNLVHAKHLYDEMMGPDAPDFGAASDGDGDRNLIIGKGIFVTPSDSVAMLAANAHLAPGYKEGLKGIARSMPTSGAADRVAEKLGIGIYETPTGWKFFGNLLDAGMATICGEESAGTGSNHVREKDGLWAVLLWLNILAVRGESCKEIVTKHWETYGRNYYSRHDYEEVETERANALVDELRAKLGSLPGISVRGMTIASADDFAYHDPVDGSVSKNQGIRILFEGGSRVVFRLSGTGTSGATLRVYIERYEPDKARHDLDTQEALADLIAAADDIAGIKSHTGRDKPSVIT
>CP034447.1|AZO25079.1|6822695_6823826_+|IS481-family-transposase
MPFEARSVMSQKEEFVRLALAPGANVSALCRRFGIGRTCGHKLLSRYRMEGAAGLAEQSRRPLSSPARSAPEVEAAAVSVRVAHPAWGGRKIARVLAREGIGTPAASTVTGILRRNGIELGALGGGAQPFIRFEHAAPNHLWQMDFKGHVALRAGRLHPLTVLDDHSRFSIALSACADQTTETVKARLIAAFRRYGLPWRIATDNGPPWGDGGRNDFTLLTVWLIEIGIAVSHSRPCHPQTLGKDERFHRSLKAEALQGPPFANLAEAQDAFDQWRHVYNAQRPHDALGGGVPLDRYQASPRQYRETVEPFEYAKDDLIRRVQQHGFVSILGRTIRLCRAFAGKSVAFRPTATDGVFDAWFRHQKIETIDLNALAR
>CP034447.1|AZO25078.1|6820593_6822591_-|glycogen-debranching-enzyme-GlgX
MIHLGATVTSEGIRFAAWSSSARRLWVSIFDDSGTHEVERPELKPEGEGVHALFVSGLASDTRYGFRADGDYAPESGLWFDPDKLLSDPYAVEIDRPYQYHWRLAAKRSEGVDTAPLMPKTIARPLPKPLASKPPLFQPGGLIYELNVRSFTKLHPDVPEAQRGTVAALAHPAIIEHLKRLGVSAVELMPVTASIDERHLPPLGLSNVWGYNPVTFMTLDPRLAPGGLMELRDTVAALREAGMGTILDLVFNHTGESDRLGPTLSLRGLDAQAYYKHLPDGRLANDTGTGNAVACDHPVVREMVLDTLRHFVRFAGVDGFRFDLAPVLGRVDGAFDPDAPLLQAIAGDPLLADRVLIAEPWDVGPGGYQLGNFRPPYLEWNDRYRDDVRRFWRGDAGAISALATRLAGSSDVFGREGQPVSRSVNFIAAHDGMTLADLVAYEEKHNAANGEQNRDGHDDNLSWNNGVEGETDDATVAKARFNDQCALLATLFASRGTIMLTAGDEFGRTQQGNNNAYAQDNAITWLDWAGRDEALECYASALSAMRRAFPALSDTHFLTGESSYASAIPDVEWLTETGAPLGEAEWNDPGRHRFVMMLGDSRDGRLAVMVNGDRRQCVFTLPARDGFEWRPAIETQPVDLARPLPGRGVYFMIERRVKTRARKGS
>CP034447.1|AZO25077.1|6818944_6820594_-|DUF3459-domain-containing-protein
MASENAERGVEWWRGCVIYQIYPRSFQDTTGNGSGDLKGITSRLAHVASLGVDAIWLSPIFKSPMADMGYDVSDYRDIDPMFGSLDDFDALVAEAHRLGLKLIIDQVISHSSDRHEWFVESRASRDNAKADWYVWADAKPDGGAPNNWLSLFGGPAWEWDATRRQYYMHNFLAAQPDLNFHTPQVQDALLDTVRFWLERGVDGFRLDTVNYYVHDRWLRDNPPLASSVAGTNMATTTYAFQEHLFDKTRPENLDFLKRLRALLDEYPDRAAVGEVGDEERSLQTLAAYTSGGDKLQMCYTFDLLGPQFSAAHMRGCVEAFENAVADGWVCWAFSNHDVVRHVSRWTRPGEDPDALAKFAIALLCSLRGSICIYQGEELGLEEAELAYEDLRDPLGIRFWPGVKGRDGCRTPMVWEAGAVNGGFTTAKPWLPVPQAHRARAVDVQNGEDGSVLAAYRSILALRKRHPALIGGSIRFLDAEGDVLAFVREHEDEQLLCVFNFAVEPVNWTLPAEIRDVEITPLDVAGVLGGVLEEIALALPPVGCFVGRIG
>CP034447.1|AZO25076.1|6817181_6818936_+|hypothetical-protein
MRKRAGGLMGATRRLIADRRGNFAVMTALCTPVALVLTAFAVDEGSLYNERRAAQSIVDLAAITAAAHINNAEQAVLTTLKDNGITSVAVQQQGADIAPTGSKAVVQVVPGRYSAISSIAAGSRFEAGKLPYNAVQVSLKKQGTLYFAASMMTPPVIGTTATASAQPEAAFSVGSRLASVNGGILNALLGGLLGGNISLSVMDYNSLISADVDVLSFTDALATQLHLTGVTYSDVLASKATIGQIATAMANVPGLDRTAKLALQTMASSATNNVKIPLSHLVDLGSVGSLGLGQKPAGLSVDASAMSMLSAAAALANGTNQVSVNLGATIPGLTSTTLQIAIGEPMQNSPWLAVGEMGTVVRTAQTRIKLNASVTVGTSNLGGGIKLLAVNLPLNVEVAYAEAKLTDISCPTGPSSIKVSIAAQPGVVEAHLANSNASGFADFTHPQSFSNADIADLKLSLIPLLQVTGSSAFSATNMTPTNLSFSATDIANKAVKTVSTKNLTQSLTTSLVNNLSLTVNALGLGIDVTALLGTVKPAVTTLLNGVTAPVDNLVYNVLAALGVHVGEADVRVTGAVCGRSVLVQ
>CP034447.1|AZO26001.1|6816735_6817182_+|pilus-assembly-protein
MLKNRKFLAPWSCFRADATGTSAVEFAMLAPIFILLLLGMVAYGIYFGASHSVQQIAADAARTAIAGLNQTERQALVSDFIAHDVDGYAFVDPNKLTVNAQDSAADGSQFVVSVSYDARNLPIWNLFPKLPLPGTTIQRQSTIRVGGI
>CP034447.1|AZO25075.1|6814853_6816446_-|peptide-ABC-transporter-substrate-binding-protein
MLKNLLKATVFATTMALATGAFYAPAFAETVYNRGSAAEAETVDPHKTSTVYEADIIRDLFQGLVMHDQKTNLIPGAAESWTVSDDGTVYTFKLRKDGLWSDGNPVTADDFVYSFHRLEDPATAAEYASMLYPVKGAEDFNTKKGKPEDMGVKAIDANTLEVTLKAPTPYFLEMLTHQATYPVNKASIDKLGADWIKPGKLVSNGAYTLAEWVPNDHMKLVKNPKFWDAASVKLDVVNYIPTEDRSSAMKRFEAGELDSYGDLPTEQLADLKTKFGDQVRVGPYLGTYYYAVKTDKAPWDNVELRNAISMAIDRDFLAEKVWQNSMLPGYSMVPPGIEGYTPALAKYADMSQIDREDAAKKILEKLGYTPEHPLKMEIRYNTSENHKNTAVAIQEQLKPLGVEVTLLNTDTKTHYGFLEQKGNYDVARAAWIADYKDPETFLGISRKASGNNYSNYNSPAYEAAMDKAAAAGGKPEERMKELAAAERILVDDVGEIPLLYYSYHDIVSSKVHGFDDNVMDIHPSRFISKD
>CP034447.1|AZO25084.1|6830935_6833398_-|glycogen/starch/alpha-glucan-phosphorylase
MTPAMTIEAPALDHPDPKTLAEEVLMSLKYRLGKDTTVATPHDWLTASIKVVRDRIVDHWIQATKEAYDQQEKRVYYLSLEFLIGRLMRDAFSNLDLMENMREALASLGVDLDLIAGLEPDAALGNGGLGRLAACFMESMATVDIPAHGYGIRYANGMFRQEIHDGWQVELPETWLDHGNPWEFERRERSFEVGFGGSVESITSKDGRLERHVWKPTEHVLAVAYDTPVAGWRARRVNTLRLWSGMPIDPILLDKFNAGDHIGALAESNKADALSRVLYPADSHKAGQELRLRQEYFFSTASLQDIIQRHLSQYGDLKSLPDKAAIHLNDTHPAIAVAELMRLLMDVHGVDFDLAWDVTKRTFAYTNHTLLPEALESWPVPLFERLLPRHMQIVYAINAQVLLEARATSQFSGEQIARISLIQENGDRRVRMGNLAFVGSHSINGVSALHTELMKETVFADLHKLYPDRINNKTNGITPRRWLIQCNPGLTALAREAIGDRFMDDIEAIKDLDPLADDAAFREKFAAVKRQNKARLANLVADRLGIRLDPSALFDIQVKRIHEYKRQLLNILEAIALYDQIRSHPEREWMPRVKFFGGKAAPSYHNAKLIIKLANDVARVINGDPSVRGLLKMVFMPNYNVSLAEVMMPAADLSEQISTAGMEASGTGNMKFALNGALTIGTLDGANVEIKEHVGDDNIFIFGLTTAEVADRRANGYDPRGVIEASPELSQAVSAISSGVFSPDDPNRYRDLMNGLYQGDWFMVAADFDSYAACQREVDAVWRNSPDWYARAIRNVARVGWFSSDRTIRQYAKEIWNVPV
>CP034447.1|AZO25085.1|6833543_6834326_-|sugar-ABC-transporter-ATP-binding-protein
MTEKAVLTARGLTKRYGRVTALNNCDFDLYPGEILAVIGDNGAGKSTLIKAISGAVHADEGVIELDGKQVQFKSPIEAREAGIETVYQNLALSPALSIADNMFLGREIRKPGPLGSWFRMLDRPAMEKRARDKLTELGLMTIQNISQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRVLELILDVKKRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVVDPKQISMSDAVALMTGAKKPPEDALAA
>CP034447.1|AZO25086.1|6834328_6835393_-|ABC-transporter-permease
MSQMQEFEKVLTGSDSSVAAFEEHGKSFVKRAQHFLHSTPAAVPLIVLVLSIIIFGIAIGGRFFSSYTLTLILQQIAIVGILGAAQTLVILTAGIDLSIGVIMVISAVIMGNCALTYGMPTLLAVIVGLAAGSACGLLNGLLVAYMKLPPFIVTLGTWNIVMATNFIYSANETIRDADVDAQAPLLHFFALSFRVGSAVLTAGVIAMVLLVMLLWYVLNHTAWGRHVYAVGDDPEAAKLSGIQTKKVLMAVYTLAGLIAAFAAWVSIGRNGSISPSAAVTDYNLQAITATVIGGISLFGGRGSILGTLFGAMIVGVVSMGLNMLGADPQWKVLLTGVLIIGAVAIDQWIRKVSV
>CP034447.1|AZO25087.1|6835554_6836589_-|sugar-ABC-transporter-substrate-binding-protein
MTKKSLLKSTVFAAAGLGLMAFASSASAAGVGACLITKTDTNPFFVKMKEGATAKAKELGVDLKTYAGKIDGDSESQVAAIESCIADGAKGILITASDTKGIVPTVKKARDAGLLVIALDTPLDPIDAADATFATDNLEAGKLIGAWAAATLGDKAKDAKIGFLDLTPSQPTVDVLRDQGFMMGYGIDVKDPNKIGDEDDPRIVGHDVTNGNEEGGRKAMENLLQKDNTINVIHTINEPAAVGAYQALKAVGLEKQVLIVSVDGGCPGVKSVTEGVIGATSQQYPLQMAALGIEAIAAYAKDGTKPKPTEGKNFFDTGVNLVTDKPANGVKSIDTKEGLAKCWG
>CP034447.1|AZO25088.1|6836800_6838027_+|ROK-family-transcriptional-regulator
METGIARHGSPEALGSRLHRGTNQSGMRDHNERLVLSLVRQHGSLAKSDIARMTGLSAQTVSVIMRELEEDKLLLRQAPLRGKIGQPSIPMALNPEGAFFIGLKIGRRSAELVLIDFLGNVRSMLRNSYRYPAPRETVEFVSAGIKKMRGELTPAQDKRIAGLGIAMPFELWSWADTAGAPREIMDEWRHRDIRSDIQSQCDFPVYLQNDATSACGAELVFGQAVGARDFVYFYIGAFAGGGIVLNGRLFGGPTGNAGALGSMPVPGPDGKPTQLIDVASIAMLEKALNAKGIDGSHLWTSPQEWGDIGAELDQWIASASQALAYAIVAASAVIDFEAAVIDGWMPLGVRRRLVDAVTDAIAGIDAEGLKLPVVREGTVGIHARALGGASLPLSERFLIGPTSISRSA
>CP034447.1|AZO25089.1|6838029_6838476_+|transporter
MLIGIPSLLGPQLLATLRAMGHGDEIAIVDGNYPAEEQARRLIRADGHHIIPVIDAILSVLPVDETVPEALFRASVRGDPALADPVHHEMEVVCAERAPGRKVIALAGADFYARVKAAHAIVATSEPRFYANIIIRKGVIHPPETKTQ
>CP034447.1|AZO25090.1|6838472_6839396_+|carbohydrate-kinase
MILCCGEALIDMLPRTTTEGEAAFAPYVGGAVFNTAIALGRLGAPAGFFSGLSSDLFGGQFREALGASKVSSTYAHTSARPTTLAFVRLTNGQATYTFYDENTAGRMLTVEDLPKLGAEIEAMLFGAISLISEPAGSAYEEFMRREHDSRVMMLDPNIRPNFIPDKAKHLRRIREMMAMADIVKLSDEDLNWFDEAGSHEDVVRNWLDRGPSLIVVTHGSEGAVGYSKEHKVTVVPQKVKVVDTVGAGDTFNAGILASLHEQGLLTKAAIGSLSEDAIRKALELGSKAAAVTVSRAGANPPWRHEIA
>CP034447.1|AZO26002.1|6839699_6840842_+|DegT/DnrJ/EryC1/StrS-aminotransferase-family-protein
MQFIDLGAQRERIRDRLKAAIDRVVEDGRYILGPQVAEFESKLAAFVGVKHVVACANGTDALLLPLFAAGIGPGDAVFVPSFTFAATAEVVALAKAEPVFVDVDPDTYNIDIASLEAAIDMIKKEGRLKPKAIIPVDLFGLAADYEAIMAIAKRENLLVIEDAAQSMGGSADGTMCGAFGHVGSTSFYPAKPLGCYGDGGAMFTNDAVLADKLRSFAFHGKGETQYDNVRVGINSRLDTLQAAILIEKLAILEEEMLARQAVADRYAKGLGDIVKASRNLGHGRSAWAQYAIETPKRDGLKAHLGEKGIPSVIYYVKPLHEQVAYKDYPRTPTGLGVSEKLPKQILCLPMHAYLTEADQDRIIETIRNYIGSNSAHVAAA
>CP034447.1|AZO25091.1|6842008_6842842_-|3'(2'),5'-bisphosphate-nucleotidase
MPKSSMTMAAVSDDEAMLGVFERLALAAGREVMRVFHEGCAVDSKVDNSPVTEADRESEKIILAGLRAAYPDIPCVAEEEVAAGVATPDLDGAFFLVDPLDGTKEFVNRRTDFTVNIALVRHGAPEVGVVFAPCTGRFFSGRPGRAESIEVDKDYGIVGRQPIGVREAGAPLAVVASRSHNTPETDAFIRDLGAAEIVSVGSSLKFCLVAAAEADIYPRFGRTMEWDTAAGDAVLRAAGGMTRSLDGQPLVYGKRNQASDTDFANPHFIATGKSAGA
>CP034447.1|AZO25092.1|6842804_6844748_-|sulfate-adenylyltransferase-subunit-CysN
MSMRHIMAKSLAPTDSIRDYMAAQEKKSLLRFLTCGSVDDGKSTLIGRLLSDTKQIFEDQLAALERDSRKHGTTGDDVDFALLVDGLEAEREQGITIDVAYRFFATPKRKFIVADTPGHEQYTRNMATGASTADLAIVLIDARQGVLRQTRRHSIIASLLGIRHIVLAVNKIDLVGFDKAVFDQIVEDYSEFAQNLGFTSIVPIPMSARFGDNVTSGSERTPWYCGPSLIEHLETVSVDEAVVELPFRFPVQYVNRPNLDFRGFAGTIASGTVSQGDEVVVAKSGRASRVKRIVAHGGDLELAVAGQAITLVLEDEVEVSRGNMLVSPAARPQVADQFTANIVWFDEQALLPGRSYVLRTETDQVSATVTDLKYRVNVNDFAHEAAKSLEINGVGVCNISTRAPIAFDPFAENRTTGAFILIDRITNATVGAGMILHSLRRAENIHWQSLDVGKRGRSDLKNQRPAVFWFTGLSGSGKSTIANLFEKKLFASGRHTYILDGDNVRHGLNRDLGFTDADRVENIRRVAEVAKLMADAGLIVIVSFISPFSAERRMARELMAEGEFVEVFVDTPFEECARRDPKGLYARALSGEIKNFTGVDSPYEAPENPEIHLETLGRTPEEMAEALEHWLTERDIAQEQYDNGGGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	CP034447.1	2392969-2393002	2	0.941
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	CP034447.1	6923152-6923185	2	0.941

1. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to position: 2392969-2393002, mismatch: 2, identity: 0.941

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgttttgacgcaattccggacggaaaaccg	Protospacer
*******.*** **********************

2. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to position: 6923152-6923185, mismatch: 2, identity: 0.941

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgttttgacgcaattccggacggaaaaccg	Protospacer
*******.*** **********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1454480-1454513	1	0.971
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1454458-1454491	1	0.971
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	654304-654337	2	0.941
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	653853-653886	2	0.941
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	788309-788342	3	0.912
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	369210-369240	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	360527-360557	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	143446-143476	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	155447-155477	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	472455-472485	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	293890-293920	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	769787-769817	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	506832-506862	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	1430163-1430193	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	430665-430695	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	172430-172460	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	136316-136346	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	143111-143141	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	1488467-1488497	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	580564-580594	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	29552-29582	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1239969-1239999	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	933901-933931	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1330998-1331028	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1417390-1417420	4	0.871
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	480836-480866	4	0.871
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	311149-311180	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	2033689-2033720	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032696	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525b, complete sequence	211853-211884	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP016080	Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence	147031-147062	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	669030-669061	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	594689-594720	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	788312-788343	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	303179-303210	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	668988-669019	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	281499-281530	5	0.844
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	617726-617757	5	0.844
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	463318-463348	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	654335-654365	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1099519-1099549	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1451898-1451928	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1454511-1454541	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	116599-116629	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	660145-660175	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1083210-1083240	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	34434-34464	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	294250-294280	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	463326-463356	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	653884-653914	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1100518-1100548	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1451876-1451906	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1454489-1454519	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	116599-116629	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	659694-659724	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1084209-1084239	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	34434-34464	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	40875-40905	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	49690-49720	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	297026-297056	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	361788-361818	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	369904-369934	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1145767-1145797	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1547227-1547257	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	185905-185935	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1662086-1662116	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1196380-1196410	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	401932-401962	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1249109-1249139	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1527789-1527819	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	503975-504005	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	291515-291545	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	294251-294281	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	40877-40907	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1451247-1451277	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1412011-1412041	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	683131-683161	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1002877-1002907	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1396833-1396863	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1429118-1429148	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	135204-135234	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	108398-108428	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	1042572-1042602	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	14073-14103	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1340040-1340070	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1056349-1056379	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	583388-583418	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	553015-553045	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1605720-1605750	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1440934-1440964	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1243305-1243335	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	550498-550528	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	550500-550530	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	897670-897700	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	525671-525701	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	630125-630155	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	1377393-1377423	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1323569-1323599	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	261010-261040	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_009621	Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence	2971-3001	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1441575-1441605	5	0.839
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025017	Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence	15281-15311	5	0.839
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1476670-1476703	6	0.824
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	301669-301702	6	0.824
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1944420-1944451	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	820850-820881	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	320914-320945	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	635378-635409	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	753377-753408	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	401105-401136	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	96934-96965	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	64442-64473	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	79160-79191	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	820398-820429	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	1071560-1071591	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	901846-901877	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	518859-518890	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	182813-182844	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	304035-304066	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	706097-706128	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	427316-427347	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	96807-96838	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	258382-258413	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	458235-458266	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	126175-126206	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	70094-70125	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1045016-1045047	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1231958-1231989	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	409220-409251	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_011371	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence	252187-252218	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	954039-954070	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	409220-409251	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	64442-64473	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	79344-79375	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	543176-543207	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	524896-524927	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	407661-407692	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	411908-411939	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	406026-406057	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	10604-10635	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	51945-51976	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	41509-41540	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	270381-270412	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	409220-409251	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	468553-468584	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	655495-655526	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	522842-522873	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1025533-1025564	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	971005-971036	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	290310-290341	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	292072-292103	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	64467-64498	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	251405-251436	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	204349-204380	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	628922-628953	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	224897-224928	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1000454-1000485	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1139051-1139082	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	47882-47913	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	198158-198189	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	412750-412781	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	630112-630143	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	224908-224939	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	143052-143083	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	308986-309017	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP020951	Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence	536456-536487	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	1500861-1500892	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	460061-460092	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1335964-1335995	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	41945-41976	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021374	Rhizobium sp. ACO-34A plasmid pRACO34Ab, complete sequence	162154-162185	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1252363-1252394	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	949234-949265	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1343392-1343423	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1429784-1429815	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	493231-493262	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	757392-757423	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	493383-493414	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	1417768-1417799	6	0.812
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	418270-418301	6	0.812
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	120608-120638	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	115568-115598	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	103666-103696	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	923543-923573	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	38344-38374	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1169372-1169402	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	507591-507621	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1583754-1583784	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	103666-103696	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	924542-924572	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	38344-38374	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1170371-1170401	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	67069-67099	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1542946-1542976	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	575126-575156	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1648687-1648717	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	53355-53385	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1148278-1148308	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	203278-203308	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	190401-190431	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1268098-1268128	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	806475-806505	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1391673-1391703	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1478380-1478410	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	419310-419340	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	858462-858492	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	111108-111138	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	707998-708028	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	496684-496714	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1474881-1474911	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	507592-507622	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1583769-1583799	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	163513-163543	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	163308-163338	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1124035-1124065	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1213899-1213929	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1398596-1398626	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	157471-157501	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	157358-157388	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1147771-1147801	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	117825-117855	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	501812-501842	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1587234-1587264	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	408471-408501	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	37300-37330	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1144218-1144248	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	271668-271698	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	946152-946182	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	310670-310700	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1312709-1312739	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1402056-1402086	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	160077-160107	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1227782-1227812	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	476526-476556	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1901396-1901426	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	543034-543064	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	1361691-1361721	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	491598-491628	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	320942-320972	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	753405-753435	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	635351-635381	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	178977-179007	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	401133-401163	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	64470-64500	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	89894-89924	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	618589-618619	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	399749-399779	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	518887-518917	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	295101-295131	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	236204-236234	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	304063-304093	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	824078-824108	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	706070-706100	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	187254-187284	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	427344-427374	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	151157-151187	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	458208-458238	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	126203-126233	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1045044-1045074	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1070500-1070530	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1231931-1231961	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1235970-1236000	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	64470-64500	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	89894-89924	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	517742-517772	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	543149-543179	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	203329-203359	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	484537-484567	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	270409-270439	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	468581-468611	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	494037-494067	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	655468-655498	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	290338-290368	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	1094116-1094146	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	360574-360604	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	295433-295463	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	303207-303237	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	64495-64525	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	89951-89981	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	251378-251408	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	248426-248456	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	299790-299820	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	45117-45147	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	96907-96937	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	79133-79163	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	180185-180215	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	425539-425569	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	1071533-1071563	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025016	Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence	182786-182816	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	290759-290789	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	44969-44999	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	96780-96810	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP006990	Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence	717132-717162	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP018232	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence	133757-133787	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	172033-172063	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	417894-417924	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	187518-187548	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	954012-954042	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	489357-489387	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	79317-79347	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	180369-180399	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	425723-425753	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	643365-643395	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	89504-89534	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	90776-90806	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	29302-29332	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	423457-423487	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1761451-1761481	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2165709-2165739	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	60139-60169	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	306001-306031	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	53653-53683	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	292045-292075	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022568	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence	167039-167069	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	155867-155897	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	204322-204352	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	304580-304610	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	562122-562152	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	611684-611714	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1545605-1545635	6	0.806
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	628790-628820	6	0.806
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	399759-399792	7	0.794
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	594690-594723	7	0.794
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	290307-290340	7	0.794
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	669031-669064	7	0.794
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1451870-1451901	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	298591-298622	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	729847-729878	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	149436-149467	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	89922-89953	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	183750-183781	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1451848-1451879	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	449538-449569	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	824050-824081	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	175600-175631	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1070528-1070559	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	181622-181653	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	13963-13994	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	11741-11772	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1471521-1471552	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	89922-89953	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	183934-183965	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	517713-517744	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	646932-646963	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	328737-328768	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	1079587-1079618	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	494065-494096	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	63706-63737	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	676723-676754	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	89979-90010	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	308147-308178	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	306595-306626	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	295128-295159	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	765122-765153	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	104468-104499	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	249324-249355	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	459737-459768	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	462460-462491	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	619540-619571	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	374133-374164	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1416771-1416802	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	223161-223192	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	817546-817577	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	16956-16987	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	81928-81959	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	175113-175144	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	177836-177867	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	388323-388354	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	96052-96083	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	161057-161088	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	253730-253761	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1674429-1674460	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1608156-1608187	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1392643-1392674	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	540668-540699	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1428588-1428619	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	516319-516350	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	451352-451383	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	295460-295491	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	765270-765301	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	303859-303890	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	238852-238883	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	306596-306627	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	104134-104165	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	249335-249366	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	458521-458552	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	461244-461275	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	63348-63379	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	299817-299848	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	344233-344264	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	550470-550501	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	553193-553224	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1438900-1438931	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	74562-74593	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	116475-116506	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	309372-309403	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	73745-73776	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015740	Shinella sp. HZN7 plasmid pShin-04, complete sequence	165360-165391	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1399665-1399696	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1464670-1464701	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017327	Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence	1527449-1527480	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	524783-524814	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	990530-990561	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1055538-1055569	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	433475-433506	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	1362544-1362575	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1384486-1384517	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1449499-1449530	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	344235-344266	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	550472-550503	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	553195-553226	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	73413-73444	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	491570-491601	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	402561-402592	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	740910-740941	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	68526-68557	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1559572-1559603	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1494604-1494635	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	253916-253947	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	90803-90834	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1278945-1278976	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	975809-975840	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1726-1757	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	66720-66751	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1369973-1370004	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1456369-1456400	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	519817-519848	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1208725-1208756	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1143721-1143752	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	730807-730838	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	466815-466846	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1261454-1261485	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1196449-1196480	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	1391180-1391211	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	391683-391714	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	488441-488472	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	53680-53711	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	253910-253941	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	133449-133480	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	160035-160066	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	97334-97365	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	123920-123951	7	0.781
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015006	Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence	243827-243858	7	0.781
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	346885-346915	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	820823-820853	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	499587-499617	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	820371-820401	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	58253-58283	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	500126-500156	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	508135-508165	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	567122-567152	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	387283-387313	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	890601-890631	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1467093-1467123	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	125960-125990	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	133983-134013	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	182396-182426	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1383651-1383681	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	684613-684643	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1436416-1436446	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1444424-1444454	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019483	Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence	2256-2286	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	699994-700024	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	1081400-1081430	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	488680-488710	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	499588-499618	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	58255-58285	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1255908-1255938	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1221921-1221951	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	665753-665783	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	799668-799698	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	807691-807721	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1165834-1165864	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1173857-1173887	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1228364-1228394	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1236386-1236416	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	1325118-1325148	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	1595259-1595289	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1411200-1411230	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1419208-1419238	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021824	Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence	1416156-1416186	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1152226-1152256	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	1502563-1502593	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	566010-566040	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	352261-352291	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	360283-360313	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1410078-1410108	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1235786-1235816	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	1269379-1269409	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	344261-344291	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	553166-553196	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	459765-459795	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	249352-249382	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	128358-128388	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	344263-344293	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	553168-553198	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	9416-9446	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	402534-402564	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	458549-458579	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	249363-249393	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	35074-35104	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	177809-177839	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	388296-388326	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	603498-603528	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	112115-112145	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050081	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence	594662-594692	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	573996-574026	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	322648-322678	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	167395-167425	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050099	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence	149409-149439	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050104	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence	230101-230131	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	314744-314774	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	449566-449596	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	637731-637761	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	112519-112549	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	515448-515478	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	175786-175816	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	149405-149435	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025507	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence	1211049-1211079	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	143813-143843	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_011371	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence	252215-252245	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	144179-144209	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050109	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence	230101-230131	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030761	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence	368675-368705	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	143813-143843	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	144179-144209	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	144182-144212	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	165066-165096	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	13774-13804	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	51918-51948	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	351041-351071	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	116571-116601	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	41482-41512	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	144182-144212	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	144182-144212	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	634586-634616	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054032	Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence	970978-971008	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	510954-510984	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	165066-165096	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	638921-638951	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	110604-110634	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP035000	Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence	434984-435014	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	230496-230526	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	186869-186899	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050101	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence	102956-102986	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	183723-183753	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	211121-211151	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	1045790-1045820	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053442	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence	102829-102859	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	27001-27031	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	175573-175603	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	183907-183937	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	524869-524899	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP030763	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence	646905-646935	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1842053-1842083	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1850075-1850105	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2259813-2259843	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	347942-347972	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	63679-63709	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	308120-308150	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	103427-103457	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	258410-258440	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	309014-309044	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	265643-265673	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013600	Rhizobium sp. N741 plasmid pRspN741e, complete sequence	97429-97459	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013504	Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence	97429-97459	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013510	Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence	97429-97459	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013521	Rhizobium sp. N113 plasmid pRspN113d, complete sequence	97429-97459	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013494	Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence	97429-97459	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	103102-103132	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	253944-253974	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013594	Rhizobium sp. N871 plasmid pRspN871d, complete sequence	97429-97459	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	103096-103126	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	253938-253968	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	580165-580195	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	80202-80232	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	669003-669033	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	167242-167272	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	645193-645223	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	651396-651426	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	156444-156474	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054022	Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence	10577-10607	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	138841-138871	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032696	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525b, complete sequence	211826-211856	7	0.774
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	321582-321612	7	0.774
CP034447_10	10.1\|6830823\|29\|CP034447\|CRISPRCasFinder	6830823-6830851	29	MN334766	Serratia phage PCH45, complete genome	32745-32773	7	0.759
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1438897-1438930	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	901847-901880	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1399662-1399695	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1384483-1384516	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1416768-1416801	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	16953-16986	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	96049-96082	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	540665-540698	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1428585-1428618	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	306596-306629	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	374134-374167	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1559573-1559606	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1674430-1674463	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1208726-1208759	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1261455-1261488	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	306597-306630	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP049731	Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence	628923-628956	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP053206	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence	630113-630146	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	990527-990560	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1723-1756	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	309373-309406	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	516320-516353	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	303860-303893	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP015063	Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence	13964-13997	8	0.765
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NC_014918	Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence	11738-11771	8	0.765
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	211093-211124	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	203880-203911	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	281140-281171	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	173113-173144	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	196765-196796	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	13801-13832	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP054029	Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence	323395-323426	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1114159-1114190	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1279860-1279891	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	65115-65146	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1180382-1180413	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1347408-1347439	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1482916-1482947	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1630093-1630124	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	438924-438955	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	426400-426431	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1731710-1731741	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	138868-138899	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	406572-406603	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	139865-139896	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1105931-1105962	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	572520-572551	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	794775-794806	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1461274-1461305	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1327701-1327732	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	325785-325816	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	606813-606844	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	753990-754021	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1227717-1227748	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	629270-629301	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1493597-1493628	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	1640493-1640524	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	459630-459661	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1411151-1411182	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1184152-1184183	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1114165-1114196	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1279867-1279898	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	65132-65163	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	120635-120666	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	359010-359041	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	104696-104727	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	573968-573999	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1657407-1657438	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	115595-115626	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	350328-350359	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	515420-515451	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	97475-97506	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	244412-244443	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	1597593-1597624	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	441379-441410	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1202490-1202521	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	31830-31861	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009145	Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence	73126-73157	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	1582232-1582263	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	225301-225332	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP029209	Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence	743772-743803	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1344838-1344869	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	213590-213621	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	1010891-1010922	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	490174-490205	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	1049688-1049719	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	569762-569793	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1593385-1593416	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	118698-118729	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	1658338-1658369	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	590322-590353	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019486	Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence	1043348-1043379	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1163306-1163337	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	229790-229821	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	205802-205833	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	205798-205829	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	203169-203200	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP029452	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence	66030-66061	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	205799-205830	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	205702-205733	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	204275-204306	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	697291-697322	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	209733-209764	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	216482-216513	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	205798-205829	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	204275-204306	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	205702-205733	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021372	Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence	239177-239208	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	207998-208029	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_012848	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence	613269-613300	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	298196-298227	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP020331	Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence	462848-462879	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	65215-65246	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	197009-197040	8	0.75
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP035002	Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence	219060-219091	8	0.75
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	355567-355597	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032686	Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence	305569-305599	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032691	Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence	300548-300578	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	898774-898804	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	1506921-1506951	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	899773-899803	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003037	Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence	1304151-1304181	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019585	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence	1387645-1387675	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	1573146-1573176	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017324	Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence	269057-269087	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1216258-1216288	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021821	Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence	96999-97029	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1196717-1196747	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	734685-734715	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021809	Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence	591800-591830	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021805	Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence	313127-313157	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	787055-787085	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021217	Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence	1248590-1248620	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026526	Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence	35503-35533	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	39640-39670	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1400603-1400633	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	1506930-1506960	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020527	Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence	1302488-1302518	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1263915-1263945	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	234675-234705	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021798	Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence	775959-775989	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1470003-1470033	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021827	Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence	233937-233967	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021801	Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence	4956-4986	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	574375-574405	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021830	Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence	1132566-1132596	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	479863-479893	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	109865-109895	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018683	Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence	35710-35740	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021794	Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence	673612-673642	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	383241-383271	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	233836-233866	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	389783-389813	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	540131-540161	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021813	Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence	437949-437979	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019848	Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence	48239-48269	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050098	Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence	762595-762625	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_008384	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence	89244-89274	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	334151-334181	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053440	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence	833253-833283	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	348831-348861	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	343158-343188	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	1562228-1562258	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	1580296-1580326	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	503068-503098	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP050093	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence	77423-77453	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	216689-216719	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	391978-392008	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	372281-372311	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP015737	Shinella sp. HZN7 plasmid pShin-01, complete sequence	203853-203883	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	496028-496058	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	297791-297821	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	197828-197858	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	30838-30868	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	29749-29779	8	0.742
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	19536-19566	8	0.742
CP034447_2	2.1\|1000468\|34\|CP034447\|CRISPRCasFinder	1000468-1000501	34	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	2099245-2099278	9	0.735
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	605465-605496	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	1273402-1273433	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	961182-961213	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	801770-801801	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	529642-529673	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1394256-1394287	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	304615-304646	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	1254917-1254948	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	1027293-1027324	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	1503863-1503894	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	619051-619082	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1084647-1084678	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP015739	Shinella sp. HZN7 plasmid pShin-03, complete sequence	265670-265701	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	607791-607822	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	204645-204676	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	612757-612788	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	687093-687124	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021374	Rhizobium sp. ACO-34A plasmid pRACO34Ab, complete sequence	256119-256150	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	866883-866914	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	324489-324520	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	402150-402181	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	759503-759534	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_007765	Rhizobium etli CFN 42 plasmid p42e, complete sequence	152481-152512	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021028	Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence	167269-167300	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP020909	Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence	152286-152317	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_021908	Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence	152277-152308	9	0.719
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP013516	Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence	156471-156502	9	0.719
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1321834-1321864	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	71375-71405	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	30018-30048	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1324312-1324342	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	71375-71405	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	1471607-1471637	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019586	Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence	30015-30045	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	97555-97585	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1075699-1075729	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021828	Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence	1275735-1275765	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021823	Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence	1396438-1396468	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021795	Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence	941802-941832	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021806	Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence	985918-985948	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019484	Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence	239399-239429	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP019487	Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence	30063-30093	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	30018-30048	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	234911-234941	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_019849	Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence	28980-29010	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017326	Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence	28671-28701	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_017323	Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence	1271218-1271248	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	229938-229968	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	28961-28991	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	228734-228764	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	28982-29012	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	358926-358956	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	281039-281069	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	1593192-1593222	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	1017528-1017558	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	817775-817805	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021218	Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence	182155-182185	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP026527	Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence	31665-31695	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	177218-177248	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP022999	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence	1476700-1476730	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	295071-295101	9	0.71
CP034447_9	9.1\|6177669\|31\|CP034447\|CRISPRCasFinder	6177669-6177699	31	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1350910-1350940	9	0.71
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_003078	Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence	94848-94879	10	0.688
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021799	Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence	162385-162416	10	0.688
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	228887-228918	10	0.688
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP021820	Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence	293830-293861	10	0.688
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NC_020560	Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence	94848-94879	10	0.688
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP018573	Marivivens sp. JLT3646 plasmid unnamed, complete sequence	60330-60361	10	0.688
CP034447_6	6.1\|3131544\|32\|CP034447\|CRISPRCasFinder	3131544-3131575	32	NZ_CP047143	Lactobacillus sp. C25 plasmid unnamed, complete sequence	115625-115656	10	0.688

1. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 1, identity: 0.971

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgtcttctcgcaattccggacggaaaaccg	Protospacer
********** ***********************

2. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 1, identity: 0.971

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgtcttctcgcaattccggacggaaaaccg	Protospacer
********** ***********************

3. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 2, identity: 0.941

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgttttctcgcaattccggacggaaaaccg	Protospacer
*******.** ***********************

4. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 2, identity: 0.941

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgttttctcgcaattccggacggaaaaccg	Protospacer
*******.** ***********************

5. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 3, identity: 0.912

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
cctttgttttgccgcaattccggacggaaaaccg	Protospacer
.******.***.**********************

6. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctcttg	Protospacer
.************************ * **

7. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctcttg	Protospacer
.************************ * **

8. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

9. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

10. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

11. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

12. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

13. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

14. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

15. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

16. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

17. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

18. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

19. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

20. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

21. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

22. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

23. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

24. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

25. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

26. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 4, identity: 0.871

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctac	Protospacer
.************************ * * *

27. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcaattccggacggaaaaccgt	Protospacer
** .   *************************

28. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcaattccggacggaaaaccgt	Protospacer
** .   *************************

29. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032696 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525b, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgt	Protospacer
**  *.  ************************

30. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP016080 (Mesorhizobium loti NZP2037 plasmid pML2037, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttgacgcaattccggacggaaaaccgc	Protospacer
**  *. ************************.

31. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaccgc	Protospacer
* * ** ************.***********.

32. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaccgc	Protospacer
* * ** ************.***********.

33. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttgccgcaattccggacggaaaaccgt	Protospacer
**  *. * ***********************

34. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttaaacgcaattccggacggaaaaccgc	Protospacer
**  *.*.***********************.

35. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcag--acgcaattccggacggaaaaccgt	CRISPR spacer
--cgtcagatacgcacttcgggacggaaaaccgt	Protospacer
  .*****  ***** *** **************

36. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccggacggaaaaccgt	Protospacer
** .** .***** ******************

37. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.844

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccggacggaaaaccgt	Protospacer
** .** .***** ******************

38. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

39. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctttaa	Protospacer
.************************ * *

40. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctttag	Protospacer
.************************ * *

41. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctaa	Protospacer
.************************ * *

42. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgatgggc	Protospacer
.************************.*.  *

43. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctgtag	Protospacer
.************************ *.*

44. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctgg	Protospacer
.************************ * *

45. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

46. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctagac	Protospacer
.**** ******************* **  *

47. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

48. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

49. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctttaa	Protospacer
.************************ * *

50. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctttag	Protospacer
.************************ * *

51. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctaa	Protospacer
.************************ * *

52. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgatgggc	Protospacer
.************************.*.  *

53. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctgtag	Protospacer
.************************ *.*

54. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctgg	Protospacer
.************************ * *

55. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

56. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctagac	Protospacer
.**** ******************* **  *

57. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

58. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

59. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

60. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

61. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

62. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

63. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

64. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

65. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

66. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

67. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

68. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

69. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctac	Protospacer
.**************** ******* * * *

70. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

71. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

72. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

73. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

74. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

75. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

76. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

77. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

78. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

79. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

80. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

81. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

82. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

83. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

84. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

85. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctac	Protospacer
.**************** ******* * * *

86. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

87. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

88. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

89. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

90. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgctctag	Protospacer
.************************ * *

91. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctac	Protospacer
.**** ******************* * * *

92. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctac	Protospacer
.**** ******************* * * *

93. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgctacgcacttttcctggaattgctctat	Protospacer
*****.******************* * * .

94. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

95. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctgcaattgctctac	Protospacer
.****************** ***** * * *

96. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcggtgcgcacttttcctggaattgctctag	Protospacer
*** ********************* * *

97. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggaattgctctac	Protospacer
..*********************** * * *

98. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgctgcgcacttttgctggaattgctttag	Protospacer
*************** ********* * *

99. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_009621 (Sinorhizobium medicae WSM419 plasmid pSMED02, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgctacgcacttttcctggaattgctctgg	Protospacer
*****.******************* * *

100. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctac	Protospacer
.****.******************* * * *

101. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025017 (Rhizobium leguminosarum strain Norway plasmid pRLN5, complete sequence) position: , mismatch: 5, identity: 0.839

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctac	Protospacer
.************** ********* * * *

102. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 6, identity: 0.824

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctttgtcttcacgcaattccggacggaaacggc	Protospacer
**********  ******************

103. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.824

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
tctcgttgttctcgcaattgcggacggaaaaccg	Protospacer
***.  * ** ******** **************

104. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaattacgcaattccggacggaaaaccgt	Protospacer
** .    ************************

105. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttctacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

106. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

107. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

108. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

109. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

110. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

111. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

112. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

113. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttctacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

114. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

115. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaacccc	Protospacer
* * ** ************.********** .

116. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

117. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

118. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

119. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

120. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

121. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

122. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

123. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

124. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

125. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

126. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

127. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

128. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

129. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_011371 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttaacgcaattccggacggaaaaccgc	Protospacer
**  *. .***********************.

130. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttaacgcaattccggacggaaaaccgc	Protospacer
**  *. .***********************.

131. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

132. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

133. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

134. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

135. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

136. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

137. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

138. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

139. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

140. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

141. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

142. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

143. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

144. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

145. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

146. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

147. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

148. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

149. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttgtgacgcaattccgaacggaaaaccgc	Protospacer
* * *  ************.***********.

150. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttcaacgcaattccggacggaaaaccgc	Protospacer
**  *. .***********************.

151. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

152. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

153. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaaaccgc	Protospacer
**  *.  ***********************.

154. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaacccc	Protospacer
* * ** ************.********** .

155. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatttcggacggaaaaccgt	Protospacer
**  *.  ********.***************

156. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
gttgtcttacgcaattccggacggaaagcagc	Protospacer
 *****  *******************.* *.

157. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttcttacgcaattccggacggaaagccgc	Protospacer
**  **  *******************.***.

158. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttggtttcacgcaattccggacgcaaaaccgg	Protospacer
** **.  *************** *******

159. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttggtttcacgcaattccggacgcaaaaccgg	Protospacer
** **.  *************** *******

160. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatttcggacggaaaaccgt	Protospacer
**  *.  ********.***************

161. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaacccc	Protospacer
* * ** ************.********** .

162. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatttcggacggaaaaccgt	Protospacer
**  *.  ********.***************

163. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

164. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 6, identity: 0.812

---tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
gagttttt---acgcatttccggacggaaaaccgc	Protospacer
   *** *   ***** *****************.

165. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP020951 (Rhizobium sp. CIAT894 plasmid pRheCIAT894d, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tttttttcacgcaattccggacgcaaaaccgc	Protospacer
*** *.  *************** *******.

166. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

167. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

168. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

169. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

170. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021374 (Rhizobium sp. ACO-34A plasmid pRACO34Ab, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttggtttcacgcaattccggacgcaaaaccgg	Protospacer
** **.  *************** *******

171. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

172. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

173. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

174. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

175. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

176. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

177. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

178. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

179. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.812

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgatccaacgcacttccagacggaaaaccgt	Protospacer
** .** .***** ****.*************

180. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgcttagg	Protospacer
.************************ *

181. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgcttagg	Protospacer
.************************ *

182. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgcttagg	Protospacer
.************************ *

183. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcccggaattgctgtag	Protospacer
.****************.******* *.*

184. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

185. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctcg	Protospacer
.****.******************* * *.

186. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

187. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

188. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaattgcttagg	Protospacer
.************************ *

189. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcccggaattgctgtag	Protospacer
.****************.******* *.*

190. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

191. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctcg	Protospacer
.****.******************* * *.

192. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

193. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

194. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

195. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

196. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

197. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

198. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

199. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

200. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

201. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

202. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

203. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctaa	Protospacer
.**************** ******* * *

204. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

205. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

206. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

207. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

208. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

209. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

210. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

211. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

212. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

213. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

214. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctaa	Protospacer
.**************** ******* * *

215. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

216. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

217. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

218. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

219. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctaa	Protospacer
.**************** ******* * *

220. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

221. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

222. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

223. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

224. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

225. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

226. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctaa	Protospacer
.**************** ******* * *

227. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

228. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

229. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctaa	Protospacer
.**************** ******* * *

230. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

231. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttcctggaattgctctag	Protospacer
.******.***************** * *

232. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

233. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
gcgctgcgcacttttgctggaattgctctga	Protospacer
 ************** ********* * *

234. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgctgagcacttttcctggaattgcgctat	Protospacer
****** ******************   * .

235. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

236. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

237. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

238. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

239. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

240. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

241. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

242. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

243. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

244. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctgg	Protospacer
.****.******************* * *

245. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

246. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctttag	Protospacer
.************** ********* * *

247. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

248. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

249. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

250. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

251. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

252. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

253. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

254. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

255. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctttag	Protospacer
.************** ********* * *

256. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

257. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

258. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

259. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctgg	Protospacer
.****.******************* * *

260. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctat	Protospacer
.**** ******************* * * .

261. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaaatgctttag	Protospacer
.********************* ** * *

262. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

263. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctgg	Protospacer
.****.******************* * *

264. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctgg	Protospacer
.****.******************* * *

265. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

266. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
gcgctgcacacttttcctggaattgctctga	Protospacer
 ******.***************** * *

267. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctat	Protospacer
.************** ********* * * .

268. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

269. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

270. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctgg	Protospacer
.****.******************* * *

271. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctat	Protospacer
.**** ******************* * * .

272. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctgg	Protospacer
.**** ******************* * *

273. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

274. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
gcgcttcgcacttttcctggaattgctctga	Protospacer
 **** ******************* * *

275. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

276. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

277. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

278. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctgg	Protospacer
.****.******************* * *

279. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctat	Protospacer
.**** ******************* * * .

280. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctttag	Protospacer
.************** ********* * *

281. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

282. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

283. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

284. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

285. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

286. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctac	Protospacer
.*****.******** ********* * * *

287. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctat	Protospacer
.**** ******************* * * .

288. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025016 (Rhizobium leguminosarum strain Norway plasmid pRLN4, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

289. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

290. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

291. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctag	Protospacer
.**** ******************* * *

292. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP006990 (Rhizobium sp. IE4771 plasmid pRetIE4771d, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctttag	Protospacer
.**** ******************* * *

293. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP018232 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

294. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

295. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctac	Protospacer
.*****.******** ********* * * *

296. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

297. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgcttcta	Protospacer
.**** ******************* * .*

298. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttgctggaattgctctac	Protospacer
.******.******* ********* * * *

299. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

300. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

301. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctac	Protospacer
.*****.******** ********* * * *

302. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

303. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctac	Protospacer
.*****.******** ********* * * *

304. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

305. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgggcacttttcctggaattgctctag	Protospacer
.***** ****************** * *

306. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggaatagctctag	Protospacer
.********************** * * *

307. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttccgggaattgctctaa	Protospacer
.**************** ******* * *

308. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaattgctctag	Protospacer
.****.******************* * *

309. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

310. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctac	Protospacer
.*****.******** ********* * * *

311. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

312. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctaa	Protospacer
.**** ******************* * *

313. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022568 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK04, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

314. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

315. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctctga	Protospacer
.**** ******************* * *

316. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctctag	Protospacer
.************** ********* * *

317. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctac	Protospacer
.*****.******** ********* * * *

318. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgcttcgcacctttcctggaattgctctaa	Protospacer
***** *****.************* * *

319. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcccttttcctggaattgctttac	Protospacer
.*****.** *************** * * *

320. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 6, identity: 0.806

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcccttttcctggaattgctttac	Protospacer
.*****.** *************** * * *

321. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 7, identity: 0.794

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
gccttttcttgtcgcaatttcggacggaaaaaac	Protospacer
 *.** *************.***********

322. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 7, identity: 0.794

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ttttatttctgacgcaattccgaacggaaaaccg	Protospacer
*.**  *..** **********.***********

323. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 7, identity: 0.794

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ttttatttgtgacgcaattccgaacggaaaaccg	Protospacer
*.**  *. ** **********.***********

324. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 7, identity: 0.794

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ttttatttctgacgcaattccgaacggaaaaccg	Protospacer
*.**  *..** **********.***********

325. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgtaattccggacggaaaaccgc	Protospacer
**  *.  ***.*******************.

326. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

327. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattctgggcggaaaaccgt	Protospacer
**  *.  *********.**.***********

328. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

329. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaaccg	Protospacer
* * ** ************.******** *

330. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

331. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgtaattccggacggaaaaccgc	Protospacer
**  *.  ***.*******************.

332. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

333. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcagttccggacggaaaaccgc	Protospacer
**  *.  *****.*****************.

334. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

335. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaaccg	Protospacer
* * ** ************.******** *

336. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgctttaacgcaactccggacggaaaaccgc	Protospacer
**  *. .******.****************.

337. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tagagttgacgcaattccggacggaaaactgt	Protospacer
*  . . **********************.**

338. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tagagttgacgcaattccggacggaaaactgt	Protospacer
*  . . **********************.**

339. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctgtttttacgcaattccggacggaaaaccgc	Protospacer
.*  *.  ***********************.

340. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaaccg	Protospacer
* * ** ************.******** *

341. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

342. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaaccg	Protospacer
* * ** ************.******** *

343. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

344. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

345. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

346. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaaccg	Protospacer
* * ** ************.******** *

347. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

348. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

349. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tatttctgacgcaattccgaacggaaaaaccg	Protospacer
* * ** ************.******** *

350. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

351. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

352. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

353. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattctgggcggaaaaccgt	Protospacer
**  *.  *********.**.***********

354. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

355. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

356. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

357. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

358. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

359. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

360. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

361. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcatttccggacgcaaaaccgt	Protospacer
**  *.  ***** ********* ********

362. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaaccacgcacttccggacggaaaaccgt	Protospacer
** .    ***** ******************

363. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

364. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

365. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

366. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

367. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

368. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

369. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

370. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccgaacggaaaaccgt	Protospacer
** .   ****** *****.************

371. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

372. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

373. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

374. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

375. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

376. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

377. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

378. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

379. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattctgggcggaaaaccgt	Protospacer
**  *.  *********.**.***********

380. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

381. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

382. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

383. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

384. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

385. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

386. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

387. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

388. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggaaacccgc	Protospacer
**  *.  ******************* ***.

389. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

390. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

391. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

392. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

393. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

394. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

395. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

396. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttattttgacgcaattctggacgcaaaaccgc	Protospacer
**  *. **********.***** *******.

397. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015740 (Shinella sp. HZN7 plasmid pShin-04, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctgtttaaacgcaattccggacgcaaaaccgc	Protospacer
.*  *.*.*************** *******.

398. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

399. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

400. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017327 (Sinorhizobium meliloti SM11 plasmid pSmeSM11c, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

401. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

402. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

403. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

404. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccgaacggaaaaccgt	Protospacer
** .   ****** *****.************

405. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

406. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

407. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

408. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttccacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

409. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgaaaaaccgc	Protospacer
**  *.  ***************.*******.

410. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

411. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

412. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaactccggacggaaaaccgc	Protospacer
**  *.  ******.****************.

413. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

414. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggtcggaaaaccgg	Protospacer
**  *.  ************ **********

415. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

416. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

417. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

418. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatttcggacggaaaaccgc	Protospacer
**  *.  ********.**************.

419. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgggaaaccgc	Protospacer
**  *.  ****************.******.

420. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

421. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaaacctt	Protospacer
** .   ****** **************** *

422. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

423. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

424. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

425. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccgaacggaaaaccgt	Protospacer
** .   ****** *****.************

426. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccgaacggaaaaccgt	Protospacer
** .   ****** *****.************

427. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

428. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

429. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccgaacggaaaaccgt	Protospacer
** .   ****** *****.************

430. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

431. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatggcgcacttccggacggaaaaccgt	Protospacer
** .   *.**** ******************

432. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctggttctacgcacttgcggacggaaaaccgt	Protospacer
.* **.  ***** ** ***************

433. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

434. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

435. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgcaaaaccgc	Protospacer
**  *.  *************** *******.

436. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacgggaaaccgc	Protospacer
**  *.  ****************.******.

437. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatttcggacggaaaaccgc	Protospacer
**  *.  ********.**************.

438. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

439. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tagatccaacgcacttccagacggaaaaccgt	Protospacer
*  .** .***** ****.*************

440. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaacgacgcacttccggacggaaagccgt	Protospacer
** .   ****** *************.****

441. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tagatccaacgcacttccagacggaaaaccgt	Protospacer
*  .** .***** ****.*************

442. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015006 (Aminobacter aminovorans strain KCTC 2477 plasmid pAA01, complete sequence) position: , mismatch: 7, identity: 0.781

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
gttcttcgacgcagttcctgacggaaaaccgc	Protospacer
 ** *. ******.**** ************.

443. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcagcgcacttttcctggaattgtctaac	Protospacer
.*** ******************** .   *

444. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctatgcacttttcctggaattgctctag	Protospacer
.****..****************** * *

445. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

446. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctatgcacttttcctggaattgctctag	Protospacer
.****..****************** * *

447. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

448. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

449. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctctag	Protospacer
.****.*****************.* * *

450. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

451. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

452. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgctacgcacttttcctggaattatcctag	Protospacer
*****.******************. . *

453. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttttcccggaattgctttag	Protospacer
.**** ***********.******* * *

454. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

455. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctttag	Protospacer
.****.*****************.* * *

456. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

457. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

458. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

459. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

460. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctctag	Protospacer
.****.*****************.* * *

461. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019483 (Sinorhizobium meliloti strain B401 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcatttttcctggaattgctcgag	Protospacer
.*********.************** *

462. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

463. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcatttttcctggaattgctcgag	Protospacer
.*********.************** *

464. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

465. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

466. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

467. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctctag	Protospacer
.****.*****************.* * *

468. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

469. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

470. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctttag	Protospacer
.****.*****************.* * *

471. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

472. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctttag	Protospacer
.****.*****************.* * *

473. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

474. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacgtttcctggaattgctctag	Protospacer
.****.***** ************* * *

475. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

476. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

477. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

478. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttcctggaatcgctctag	Protospacer
.****.*****************.* * *

479. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

480. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021824 (Sinorhizobium meliloti strain KH46 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

481. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

482. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

483. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctccgcacttctcctggaattgctctag	Protospacer
.**** *******.*********** * *

484. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacgtttcctggaattgctctag	Protospacer
.****.***** ************* * *

485. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

486. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

487. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

488. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ttgctacgcacttttcctggaattgctccag	Protospacer
*.***.******************* * .

489. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcactcttgctggaattgctctag	Protospacer
.***********.** ********* * *

490. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctag	Protospacer
.****.********* ********* * *

491. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaatttctctag	Protospacer
.**** ******************  * *

492. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcactcttgctggaattgctctag	Protospacer
.***********.** ********* * *

493. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgtgcacttttgctggaattgctctag	Protospacer
.*****.******** ********* * *

494. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcactcttgctggaattgctctag	Protospacer
.***********.** ********* * *

495. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctag	Protospacer
.****.********* ********* * *

496. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
atactgcgcacttttcctggaattgctctga	Protospacer
 ..********************** * *

497. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctag	Protospacer
.****.********* ********* * *

498. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaatttctctag	Protospacer
.**** ******************  * *

499. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcactcttgctggaattgctctag	Protospacer
.***********.** ********* * *

500. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcatttttcctggaattgctcgag	Protospacer
.*********.************** *

501. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaatttctctag	Protospacer
.**** ******************  * *

502. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcactcttgctggaattgctctag	Protospacer
.***********.** ********* * *

503. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctccag	Protospacer
.************** ********* * .

504. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcagttttgctggaattgctctat	Protospacer
.********* **** ********* * * .

505. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050081 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcatttttcctggaattgctctgg	Protospacer
.****.****.************** * *

506. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

507. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

508. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaactgcttacc	Protospacer
.************** ******.** *  .*

509. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050099 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcccacttttgctggaattgctctag	Protospacer
.****** ******* ********* * *

510. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050104 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b2, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgccctac	Protospacer
.************** *.******* . * *

511. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaactgcttacc	Protospacer
.************** ******.** *  .*

512. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

513. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctccag	Protospacer
.************** ********* * .

514. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcagttttgctggaattgctctat	Protospacer
.********* **** ********* * * .

515. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

516. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaactgcttacc	Protospacer
.************** ******.** *  .*

517. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcccacttttgctggaattgctctag	Protospacer
.****** ******* ********* * *

518. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025507 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvA, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgccctac	Protospacer
.************** *.******* . * *

519. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

520. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_011371 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG204, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgcttcag	Protospacer
.**** ******************* * .

521. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

522. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050109 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b2, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgccctac	Protospacer
.************** *.******* . * *

523. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030761 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgccctac	Protospacer
.************** *.******* . * *

524. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

525. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

526. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

527. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

528. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgtttcgcacttttcctggaattgctttag	Protospacer
.**.* ******************* * *

529. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctttgcacttttcctggaattgctctaa	Protospacer
.**** .****************** * *

530. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttgctggaattgctctaa	Protospacer
.******.******* ********* * *

531. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaactgctctaa	Protospacer
.**** ****************.** * *

532. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctctgg	Protospacer
.**** *.***************** * *

533. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

534. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

535. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgccctac	Protospacer
.************** *.******* . * *

536. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054032 (Rhizobium sp. JKLM13E plasmid pPR13E01, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctcgaattgctctaa	Protospacer
.**** ************ ****** * *

537. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttgctggaattgctctaa	Protospacer
.******.******* ********* * *

538. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgctccag	Protospacer
.**** ******************* * .

539. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctccag	Protospacer
.************** ********* * .

540. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcagttttgctggaattgctctat	Protospacer
.********* **** ********* * * .

541. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP035000 (Rhizobium acidisoli strain FH23 plasmid pRapFH23b, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
gcgctgcacacttttgctggaattgctctat	Protospacer
 ******.******* ********* * * .

542. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgccctac	Protospacer
.************** *.******* . * *

543. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaactgcttacc	Protospacer
.************** ******.** *  .*

544. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050101 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b6, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcactttttctggaattgctttaa	Protospacer
.**** *********.********* * *

545. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctgaaattgctctaa	Protospacer
.************** ***.***** * *

546. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctag	Protospacer
.****.********* ********* * *

547. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttaccggaattgctctat	Protospacer
.************** *.******* * * .

548. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053442 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eD, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcactttttctggaattgctttaa	Protospacer
.**** *********.********* * *

549. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaattgctccat	Protospacer
.************** ********* * . .

550. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctgaaattgctctaa	Protospacer
.************** ***.***** * *

551. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctgaaattgctctaa	Protospacer
.************** ***.***** * *

552. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctctga	Protospacer
.**** *.***************** * *

553. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP030763 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctgaaattgctctaa	Protospacer
.************** ***.***** * *

554. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacgtttcctggaattgctctag	Protospacer
.****.***** ************* * *

555. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgctctag	Protospacer
.** ******* ************* * *

556. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
atactgcgcacttttcctggaattgctctag	Protospacer
 ..********************** * *

557. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgcttcgcacttttcctggaattgctctag	Protospacer
..*** ******************* * *

558. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctgaaattgctctaa	Protospacer
.************** ***.***** * *

559. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctgaaattgctctaa	Protospacer
.************** ***.***** * *

560. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

561. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctctga	Protospacer
.**** *.***************** * *

562. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaaatgctttag	Protospacer
.**** **************** ** * *

563. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttgctggaattgctctag	Protospacer
.**** ********* ********* * *

564. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013600 (Rhizobium sp. N741 plasmid pRspN741e, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

565. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013504 (Rhizobium esperanzae strain N561 plasmid pRspN561d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

566. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013510 (Rhizobium sp. N1341 plasmid pRspN1341e, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

567. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013521 (Rhizobium sp. N113 plasmid pRspN113d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

568. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013494 (Rhizobium sp. N6212 plasmid pRspN6212d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

569. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

570. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctctga	Protospacer
.**** *.***************** * *

571. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013594 (Rhizobium sp. N871 plasmid pRspN871d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

572. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctacgcacttttgctggaattgctctaa	Protospacer
.****.********* ********* * *

573. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctctga	Protospacer
.**** *.***************** * *

574. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaatagctctag	Protospacer
.************** ******* * * *

575. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgctggaatagctctag	Protospacer
.************** ******* * * *

576. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattgctctgg	Protospacer
.***  ******************* * *

577. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttgctggaattgctctgg	Protospacer
.******.******* ********* * *

578. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcactttttctggaattgctctga	Protospacer
.**** *********.********* * *

579. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcccggaattgctctaa	Protospacer
.**** ***********.******* * *

580. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacacttttgctggaattgctctgg	Protospacer
.******.******* ********* * *

581. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054022 (Rhizobium sp. JKLM12A2 plasmid pPR12A201, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctcgaattgctctaa	Protospacer
.**** ************ ****** * *

582. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaaatgctttag	Protospacer
.**** **************** ** * *

583. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032696 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525b, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgtttcgcacttttcctggaattgctctag	Protospacer
.**.* ******************* * *

584. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 7, identity: 0.774

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcgtggaattgctctga	Protospacer
.**** ********** ******** * *

585. spacer 10.1|6830823|29|CP034447|CRISPRCasFinder matches to MN334766 (Serratia phage PCH45, complete genome) position: , mismatch: 7, identity: 0.759

gggcggcatgcaccagtctttgttttggc	CRISPR spacer
gtccggcacgaaccagtctttgttttcat	Protospacer
*  *****.* *************** ..

586. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

587. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ttttatttctgacgcaattccgaacggaaaaccc	Protospacer
*.**  *..** **********.**********

588. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

589. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

590. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

591. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

592. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

593. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

594. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

595. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

596. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

597. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

598. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

599. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

600. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

601. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

602. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP049731 (Rhizobium leguminosarum strain A1 plasmid pRL12, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ttttatttctgacgcaattccgaacggaaaaccc	Protospacer
*.**  *..** **********.**********

603. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP053206 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1D, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ttttatttctgacgcaattccgaacggaaaaccc	Protospacer
*.**  *..** **********.**********

604. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

605. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

606. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

607. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

608. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
ctcttgaaatggcgcacttccggacggaaaaccg	Protospacer
...***   ** **** *****************

609. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP015063 (Mesorhizobium ciceri strain CC1192 plasmid pMc1192, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
gactagagttgacgcaattccggacggaaaactg	Protospacer
  .* *  *** ********************.*

610. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NC_014918 (Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence) position: , mismatch: 8, identity: 0.765

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
gactagagttgacgcaattccggacggaaaactg	Protospacer
  .* *  *** ********************.*

611. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaatttcggacgcaaaaccgc	Protospacer
**  *.  ********.****** *******.

612. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tcgtttcaacgcaattccggacgcaaaaccgc	Protospacer
*.  *. .*************** *******.

613. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatcccggacgcaaaaccgc	Protospacer
**  *.  *******.******* *******.

614. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatcccggacgcaaaaccgc	Protospacer
**  *.  *******.******* *******.

615. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
acatctatacgcaattccggacggaaaaccgc	Protospacer
 .  ..* ***********************.

616. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tggattttacgcaagtcctgacggaaaaccgt	Protospacer
*  .*.  ****** *** *************

617. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP054029 (Rhizobium sp. JKLM19E plasmid pPR19E02, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattgcggacgcaaaaccgc	Protospacer
**  *.  ******** ****** *******.

618. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccggacggaaaaccgt	Protospacer
** ..   .**** ******************

619. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

620. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

621. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccggacggaaaaccgt	Protospacer
** ..   .**** ******************

622. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

623. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ccggttctacgcacttgcggacggaaaaccgt	Protospacer
.. **.  ***** ** ***************

624. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

625. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

626. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttctacgcagttccggacgcaaaaccgc	Protospacer
**  *.  *****.********* *******.

627. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcagttccggacgcaaaaccgc	Protospacer
**  *.  *****.********* *******.

628. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
gcgttttgacgcatttccggacggaaaaccgc	Protospacer
 .  *. ****** *****************.

629. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctgttttcacgcaattccggacgcaaaaccgg	Protospacer
.*  *.  *************** *******

630. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttcaacgcaattcctgacgcaaaaccgc	Protospacer
**  *. .********** **** *******.

631. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

632. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

633. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

634. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

635. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatcgcgcacttccggacggaaaaccgt	Protospacer
** .    .**** ******************

636. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

637. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ccggttctacgcacttgcggacggaaaaccgt	Protospacer
.. **.  ***** ** ***************

638. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

639. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

640. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccggacggaaaaccgt	Protospacer
** ..   .**** ******************

641. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ccggttctacgcacttgcggacggaaaaccgt	Protospacer
.. **.  ***** ** ***************

642. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

643. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

644. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

645. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

646. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccggacggaaaaccgt	Protospacer
** ..   .**** ******************

647. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

648. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

649. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctgcttctacgcaattctggacggaaaaccgc	Protospacer
.*  *.  *********.*************.

650. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcagttccggacgcaaaaccgc	Protospacer
**  *.  *****.********* *******.

651. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatcccggacgcaaaaccgc	Protospacer
**  *.  *******.******* *******.

652. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tcgtttttacgcaattccggacgaaaaaccgc	Protospacer
*.  *.  ***************.*******.

653. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

654. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ctgcttctacgcaattctggacggaaaaccgc	Protospacer
.*  *.  *********.*************.

655. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcagttccggacgcaaaaccgc	Protospacer
**  *.  *****.********* *******.

656. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tcgtttttacgcaattccggacgaaaaaccgc	Protospacer
*.  *.  ***************.*******.

657. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

658. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ccggttctacgcacttgcggacggaaaaccgt	Protospacer
.. **.  ***** ** ***************

659. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

660. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

661. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

662. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

663. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009145 (Sinorhizobium meliloti strain RMO17 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaactgcgcacttccggacggaaaaccgt	Protospacer
** .    .**** ******************

664. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

665. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtctccacgcaattccggacgcaaaaccgc	Protospacer
**  ..  *************** *******.

666. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP029209 (Nitratireductor sp. OM-1 plasmid pOM-1, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgaaattccggacgaaaaaccgg	Protospacer
**  *.  *** ***********.*******

667. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

668. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

669. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

670. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

671. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

672. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

673. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaatcgcgcacttccggacggaaaaccgt	Protospacer
** .    .**** ******************

674. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgagactacgcactcccggacggaaaaccgt	Protospacer
** .    ***** *.****************

675. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ccggttctacgcacttgcggacggaaaaccgt	Protospacer
.. **.  ***** ** ***************

676. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcaga----cgcaattccggacggaaaaccgt	CRISPR spacer
----taaaaactgcgcacttccggacggaaagccgt	Protospacer
    * *.*    **** *************.****

677. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019486 (Sinorhizobium meliloti strain B399 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgaaactgcgcacttccggacggaaaaccgt	Protospacer
** .    .**** ******************

678. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgcttttacgcaattccggacgcaaaatcgg	Protospacer
**  *.  *************** ****.**

679. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

680. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

681. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

682. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

683. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP029452 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509b, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cttggattgcgcaattccggacggagtaccgt	Protospacer
.***    .****************. *****

684. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

685. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

686. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

687. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

688. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

689. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

690. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

691. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

692. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

693. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021372 (Rhizobium sp. ACO-34A plasmid pRACO34Ad, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaattccggacacaaaaccgg	Protospacer
**  *.  **************. *******

694. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaatcccggacgcaaaaccgc	Protospacer
**  *.  *******.******* *******.

695. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_012848 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132501, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttcacgcaataccggacgcaaaaccgc	Protospacer
**  *.  ******* ******* *******.

696. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccggacggtgaaccgg	Protospacer
**  *.  **************** .*****

697. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP020331 (Martelella mediterranea DSM 17316 strain MACL11 plasmid pMM593, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgttttaacgcaattccggacggtgaaccgg	Protospacer
**  *. .**************** .*****

698. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cttggattgcgcaattccggacggagtaccgt	Protospacer
.***    .****************. *****

699. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

700. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP035002 (Rhizobium acidisoli strain FH23 plasmid pRapFH23d, complete sequence) position: , mismatch: 8, identity: 0.75

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgtttttacgcaattccgaacgcaaaaccgc	Protospacer
**  *.  ***********.*** *******.

701. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcagcgcacttttcctggaattgtctaat	Protospacer
.*** ******************** .   .

702. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032686 (Rhizobium sp. CCGE531 plasmid pRCCGE531c, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgtgcacttttcctggaattgcttgaa	Protospacer
..****.****************** *

703. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032691 (Rhizobium sp. CCGE532 plasmid pRCCGE532c, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgtgcacttttcctggaattgcttgaa	Protospacer
..****.****************** *

704. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcagcgcacttttcctggaattgcctgag	Protospacer
.*** ******************** .

705. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

706. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcagcgcacttttcctggaattgcctgag	Protospacer
.*** ******************** .

707. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003037 (Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

708. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019585 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

709. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

710. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017324 (Sinorhizobium meliloti BL225C plasmid pSINMEB01, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

711. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ggtctgcgcatttttcctggaattgctttgg	Protospacer
   *******.************** * *

712. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021821 (Sinorhizobium meliloti strain M162 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc-----	CRISPR spacer
ccgctgcgcacttttcctgcagt-----ttctcgag	Protospacer
.****************** *.*     ***

713. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

714. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

715. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021809 (Sinorhizobium meliloti strain Rm41 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

716. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021805 (Sinorhizobium meliloti strain T073 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

717. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

718. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021217 (Sinorhizobium meliloti RU11/001 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

719. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026526 (Sinorhizobium meliloti strain AK21 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

720. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

721. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

722. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

723. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020527 (Sinorhizobium meliloti 2011 plasmid pSymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

724. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgatgcgcacgtttcctggaattgcttagt	Protospacer
.** ******* ************* *   .

725. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

726. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021798 (Sinorhizobium meliloti strain USDA1106 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

727. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

728. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021827 (Sinorhizobium meliloti strain KH35c plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

729. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021801 (Sinorhizobium meliloti strain USDA1021 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

730. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

731. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021830 (Sinorhizobium meliloti strain HM006 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctgcagttgctcgag	Protospacer
.****************** *.*** *

732. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

733. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

734. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018683 (Sinorhizobium meliloti Rm41 plasmid pSYMA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

735. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021794 (Sinorhizobium meliloti strain USDA1157 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctgcagttgctcgag	Protospacer
.****************** *.*** *

736. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

737. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

738. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacccttcctggaattgcttcaa	Protospacer
.**********..************ * .

739. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcactttccctggaattgctccag	Protospacer
.**** ********.********** * .

740. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021813 (Sinorhizobium meliloti strain M270 plasmid psymA, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctgcagttgctcgag	Protospacer
.****************** *.*** *

741. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019848 (Sinorhizobium meliloti GR4 plasmid pRmeGR4c, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcgtttttcctggaattgctcgag	Protospacer
.********..************** *

742. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050098 (Rhizobium leguminosarum bv. trifolii strain 9B plasmid pRL9b4, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattactctgg	Protospacer
.***  ******************. * *

743. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_008384 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattgccctaa	Protospacer
.***  ******************* . *

744. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcccacttttgctggaattgctccga	Protospacer
.****** ******* ********* * .

745. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053440 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eF, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattactctgg	Protospacer
.***  ******************. * *

746. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcatttttcctggaattgctccag	Protospacer
.**** ****.************** * .

747. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattgagctaa	Protospacer
.***  *******************.  *

748. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctgcaattgcttcga	Protospacer
.**** ************* ***** * .

749. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttgcgggaattgcttaga	Protospacer
.************** * ******* *

750. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattgagctaa	Protospacer
.***  *******************.  *

751. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP050093 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b5, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcgtcgcacttttcctggaattgccctaa	Protospacer
.***  ******************* . *

752. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttcctggaattgcccaag	Protospacer
.**** ******************* .

753. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
tcgctgcgcgcttttgctggaatgctctatc	Protospacer
*********.***** *******   .  **

754. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttgctggaattgctccgg	Protospacer
.**** ********* ********* * .

755. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP015737 (Shinella sp. HZN7 plasmid pShin-01, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcgcacttttgctggaattgccttag	Protospacer
.**** ********* ********* . *

756. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcacttttcctggagtttccaggt	Protospacer
.********************.**  .*  .

757. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcgcactcttgctggaattgctccag	Protospacer
.***********.** ********* * .

758. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
gcgctgcacacttttgctggaattgctccag	Protospacer
 ******.******* ********* * .

759. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctcaat	Protospacer
.**** *.***************** *   .

760. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgctcaat	Protospacer
.**** *.***************** *   .

761. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 8, identity: 0.742

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctgcacgcttttcctggaattgctcgag	Protospacer
.******.*.*************** *

762. spacer 2.1|1000468|34|CP034447|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 9, identity: 0.735

tctttgtcttgtcgcaattccggacggaaaaccg	CRISPR spacer
caaatagtttatcgcagttccggacggaaaaccg	Protospacer
.   *. .**.*****.*****************

763. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

764. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

765. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

766. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

767. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

768. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

769. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cgcttttaacgcactcccggacggaaaaccgt	Protospacer
. . *. .***** *.****************

770. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

771. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

772. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ccggatctacgcacttgcggacggaaaaccgt	Protospacer
.. * .  ***** ** ***************

773. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

774. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

775. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP015739 (Shinella sp. HZN7 plasmid pShin-03, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
caattctaacgcagttccggacgcaaaaccgc	Protospacer
.   ** .*****.********* *******.

776. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

777. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

778. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

779. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

780. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021374 (Rhizobium sp. ACO-34A plasmid pRACO34Ab, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
tcgttttcacgcaattccggacacaaaaccgg	Protospacer
*.  *.  **************. *******

781. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

782. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

783. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

784. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
ttgacgctgcgcacttccgcacggaaaaccgt	Protospacer
** ..   .**** ***** ************

785. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_007765 (Rhizobium etli CFN 42 plasmid p42e, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
atgttttcacgcaattccgaacgcaaaaccgc	Protospacer
 *  *.  ***********.*** *******.

786. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021028 (Rhizobium sp. TAL182 plasmid pRetTAL182d, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
atgttttcacgcaattccgaacgcaaaaccgc	Protospacer
 *  *.  ***********.*** *******.

787. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP020909 (Rhizobium etli strain NXC12 plasmid pRetNXC12c, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
atattttcacgcaattccgaacgcaaaaccgc	Protospacer
 *  *.  ***********.*** *******.

788. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_021908 (Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1d, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
atgttttcacgcaattccgaacgcaaaaccgc	Protospacer
 *  *.  ***********.*** *******.

789. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP013516 (Rhizobium sp. N1314 plasmid pRspN1314e, complete sequence) position: , mismatch: 9, identity: 0.719

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
atgttttcacgcaattccgaacgcaaaaccgc	Protospacer
 *  *.  ***********.*** *******.

790. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgttgcgcacttttcctgaaattgcctcag	Protospacer
.**.***************.***** . .

791. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctcagcacttttcctggaattgcaccaa	Protospacer
.****  ******************   .

792. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

793. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgttgcgcacttttcctgaaattgcctcag	Protospacer
.**.***************.***** . .

794. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgctcagcacttttcctggaattgcaccaa	Protospacer
.****  ******************   .

795. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggagtttccaggt	Protospacer
..*******************.**  .*  .

796. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019586 (Sinorhizobium meliloti strain CCMM B554 (FSM-MA) plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

797. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

798. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggagtttccaggt	Protospacer
..*******************.**  .*  .

799. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021828 (Sinorhizobium meliloti strain KH35c plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

800. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021823 (Sinorhizobium meliloti strain KH46 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

801. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021795 (Sinorhizobium meliloti strain USDA1157 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

802. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021806 (Sinorhizobium meliloti strain T073 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

803. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019484 (Sinorhizobium meliloti strain B401 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

804. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP019487 (Sinorhizobium meliloti strain B399 plasmid pSym, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

805. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

806. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggagtttccaggt	Protospacer
..*******************.**  .*  .

807. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_019849 (Sinorhizobium meliloti GR4 plasmid pRmeGR4d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

808. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017326 (Sinorhizobium meliloti SM11 plasmid pSmeSM11d, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

809. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_017323 (Sinorhizobium meliloti BL225C plasmid pSINMEB02, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

810. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggagtttccaggt	Protospacer
..*******************.**  .*  .

811. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

812. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggagtttccaggt	Protospacer
..*******************.**  .*  .

813. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

814. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

815. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

816. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

817. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcacttttcctggagtttccaggt	Protospacer
..*******************.**  .*  .

818. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

819. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021218 (Sinorhizobium meliloti RU11/001 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

820. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP026527 (Sinorhizobium meliloti strain AK21 plasmid pSymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctag	Protospacer
  ******* *******.******* . *

821. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ctgctgcgcatttttgctggaattgctccag	Protospacer
..********.**** ********* * .

822. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP022999 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-A, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
cggctgcgcactttccttggaattgctccag	Protospacer
. ************.*.******** * .

823. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
aagctgcgctcttttcccggaattgccctcg	Protospacer
  ******* *******.******* . *.

824. spacer 9.1|6177669|31|CP034447|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 9, identity: 0.71

tcgctgcgcacttttcctggaattggtattc	CRISPR spacer
ccgcttcacacttttcctggaattgccccag	Protospacer
.**** *.***************** . .

825. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_003078 (Sinorhizobium meliloti 1021 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cgcagactacgcactcccggacggaaaaccgt	Protospacer
. ..    ***** *.****************

826. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021799 (Sinorhizobium meliloti strain USDA1106 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cgcagactacgcactcccggacggaaaaccgt	Protospacer
. ..    ***** *.****************

827. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cgcagactacgcactcccggacggaaaaccgt	Protospacer
. ..    ***** *.****************

828. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP021820 (Sinorhizobium meliloti strain M162 plasmid psymB, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cgcagactacgcactcccggacggaaaaccgt	Protospacer
. ..    ***** *.****************

829. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NC_020560 (Sinorhizobium meliloti 2011 plasmid pSymB, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cgcagactacgcactcccggacggaaaaccgt	Protospacer
. ..    ***** *.****************

830. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP018573 (Marivivens sp. JLT3646 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
cctcagagccgcaattgcggacggaaaacgca	Protospacer
..*   ** ******* ************

831. spacer 6.1|3131544|32|CP034447|CRISPRCasFinder matches to NZ_CP047143 (Lactobacillus sp. C25 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

tttgtcagacgcaattccggacggaaaaccgt	CRISPR spacer
aagtgcagacgcaaatacggacggaaaagcag	Protospacer
     ********* * *********** *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4794854 : 4803114

uncultured_Mediterranean_phage(85.71%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZO25846.1\|4794854_4795655_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	1.3e-32	34.3
AZO23259.1\|4795651_4796407_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	7.1e-41	47.1
AZO23260.1\|4796588_4796807_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	5.1e-08	65.9
AZO23261.1\|4796890_4797595_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
AZO23262.1\|4797591_4798467_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	3.3e-50	44.9
AZO23263.1\|4798565_4799870_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	3.3e-102	57.8
AZO23264.1\|4799874_4800633_+	5'/3'-nucleotidase SurE	NA	NA	NA	NA
AZO23265.1\|4800646_4801300_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.8e-17	39.8
AZO23266.1\|4801581_4803114_+	LysM peptidoglycan-binding domain-containing protein	S6B1Q4	Bacillus_phage	5.4e-11	37.5

DBSCAN-SWA_2

5056241 : 5097846

Gordonia_phage(20.0%)

transposase,integrase

attL 5061491:5061508|attR 5102984:5103001

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZO23496.1\|5056241_5057372_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZO23497.1\|5057557_5058862_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AZO23498.1\|5059131_5060439_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	1.0e-18	32.9
AZO23499.1\|5060499_5060958_-	hypothetical protein	NA	NA	NA	NA
AZO23500.1\|5061009_5061735_-	DUF2259 domain-containing protein	NA	NA	NA	NA
5061491:5061508	attL	NA	NA	NA	NA
AZO23501.1\|5061887_5062145_+	DUF2171 domain-containing protein	NA	NA	NA	NA
AZO23502.1\|5062215_5063232_-	S58 family peptidase	NA	NA	NA	NA
AZO23503.1\|5063231_5064296_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZO23504.1\|5064490_5064985_+	flavin reductase	NA	NA	NA	NA
AZO23505.1\|5065014_5065938_+	MoxR family ATPase	NA	NA	NA	NA
AZO23506.1\|5065943_5067194_+	VWA domain-containing protein	NA	NA	NA	NA
AZO23507.1\|5067267_5067606_+	XdhC family protein	NA	NA	NA	NA
AZO23508.1\|5067612_5068317_+	XdhC family protein	NA	NA	NA	NA
AZO23509.1\|5068313_5069936_+	4-diphosphocytidyl-2C-methyl-D-erythritol kinase	NA	NA	NA	NA
AZO23510.1\|5069968_5070859_+	alpha/beta hydrolase	NA	NA	NA	NA
AZO23511.1\|5070876_5071926_-	DUF1176 domain-containing protein	NA	NA	NA	NA
AZO23512.1\|5072070_5072574_+	DUF1993 family protein	NA	NA	NA	NA
AZO25864.1\|5072682_5072847_-	DUF1127 domain-containing protein	NA	NA	NA	NA
AZO25865.1\|5073251_5073710_+	hypothetical protein	NA	NA	NA	NA
AZO23513.1\|5073820_5074888_+	aldo/keto reductase	NA	NA	NA	NA
AZO23514.1\|5074925_5076194_+	cysteine desulfurase-like protein	NA	NA	NA	NA
AZO23515.1\|5076195_5077224_-	histone deacetylase family protein	A0A2K9L0J7	Tupanvirus	3.1e-31	33.8
AZO23516.1\|5077220_5077811_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZO23517.1\|5077932_5078862_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
AZO23518.1\|5078871_5080254_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.2e-23	25.8
AZO23519.1\|5080255_5081893_-	hypothetical protein	NA	NA	NA	NA
AZO23520.1\|5082043_5082292_+	chromosome partitioning protein ParB	NA	NA	NA	NA
AZO23521.1\|5082429_5082825_+	GFA family protein	NA	NA	NA	NA
AZO23522.1\|5083115_5083328_+	hypothetical protein	NA	NA	NA	NA
AZO23523.1\|5083354_5084266_-	hypothetical protein	NA	NA	NA	NA
AZO23524.1\|5084453_5085326_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
AZO23525.1\|5085401_5086508_+\|transposase	IS5 family transposase	NA	NA	NA	NA
AZO23526.1\|5086504_5086831_+	hypothetical protein	NA	NA	NA	NA
AZO23527.1\|5086886_5087672_+	phosphodiester glycosidase family protein	NA	NA	NA	NA
AZO23528.1\|5087824_5088964_+	muramidase	A0A1U9WQS3	Geobacillus_phage	1.6e-28	35.5
AZO23529.1\|5089296_5089833_+	DUF2314 domain-containing protein	NA	NA	NA	NA
AZO23530.1\|5089854_5090307_-	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
AZO23531.1\|5090650_5091121_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
AZO23532.1\|5091462_5092371_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZO25866.1\|5092679_5092910_-	hypothetical protein	NA	NA	NA	NA
AZO23533.1\|5093078_5094383_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AZO23534.1\|5094809_5095181_-	VOC family protein	NA	NA	NA	NA
AZO23535.1\|5095742_5096648_+\|integrase	integrase	S5W9T9	Leptospira_phage	6.1e-23	29.4
AZO23536.1\|5096652_5097846_+\|transposase	IS91 family transposase	NA	NA	NA	NA
5102984:5103001	attR	NA	NA	NA	NA

DBSCAN-SWA_3

5290192 : 5298602

uncultured_Mediterranean_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZO23692.1\|5290192_5292988_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.4e-97	31.3
AZO23693.1\|5293041_5293194_-	hypothetical protein	NA	NA	NA	NA
AZO23694.1\|5293385_5293886_+	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	4.7e-25	37.0
AZO23695.1\|5293960_5294551_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	4.1e-44	58.9
AZO23696.1\|5294580_5295093_+	peptidylprolyl isomerase	A0A1B1IVS0	uncultured_Mediterranean_phage	8.2e-49	62.1
AZO23697.1\|5295103_5295553_+	DMT family transporter	NA	NA	NA	NA
AZO23698.1\|5295552_5296638_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AZO25880.1\|5296681_5297812_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.6e-100	53.8
AZO23699.1\|5297876_5298602_+	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	1.4e-06	27.5

DBSCAN-SWA_4

6570820 : 6635720

Mesorhizobium_phage(11.11%)

transposase,integrase

attL 6611910:6611925|attR 6639798:6639813

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZO24868.1\|6570820_6572125_-\|transposase	IS4 family transposase	NA	NA	NA	NA
AZO24869.1\|6572333_6573410_-\|integrase	site-specific integrase	A0A076YL28	Mesorhizobium_phage	6.2e-30	37.9
AZO24870.1\|6573649_6574855_-	porin	NA	NA	NA	NA
AZO25977.1\|6574955_6575198_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
AZO24871.1\|6575846_6577001_+	porin	NA	NA	NA	NA
AZO24872.1\|6577439_6579116_-	sulfotransferase family protein	NA	NA	NA	NA
AZO24873.1\|6579376_6580489_+	pyridoxal phosphate-dependent aminotransferase	A0A1X7BZP2	Faustovirus	9.5e-18	25.3
AZO24874.1\|6580617_6581106_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZO24875.1\|6581258_6581540_+	acylphosphatase	NA	NA	NA	NA
AZO24876.1\|6581776_6582424_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZO24877.1\|6582472_6583636_+	isovaleryl-CoA dehydrogenase	NA	NA	NA	NA
AZO24878.1\|6583632_6584001_-	type II toxin-antitoxin system HicB family antitoxin	NA	NA	NA	NA
AZO24879.1\|6584355_6585963_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	2.8e-18	63.9
AZO24880.1\|6585965_6586496_+	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	2.8e-36	55.5
AZO24881.1\|6586806_6588771_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
AZO24882.1\|6588911_6590033_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZO24883.1\|6590414_6590681_-	sel1 repeat family protein	NA	NA	NA	NA
AZO24884.1\|6591117_6591459_+	DUF2147 domain-containing protein	NA	NA	NA	NA
AZO24885.1\|6591956_6592151_+	hypothetical protein	NA	NA	NA	NA
AZO24886.1\|6592236_6593739_+	AMP nucleosidase	NA	NA	NA	NA
AZO25978.1\|6593889_6594900_+	AP endonuclease	NA	NA	NA	NA
AZO24887.1\|6594928_6595519_-	DUF922 domain-containing protein	NA	NA	NA	NA
AZO24888.1\|6595683_6597363_-	electron transfer flavoprotein-ubiquinone oxidoreductase	NA	NA	NA	NA
AZO24889.1\|6597614_6598253_+	hypothetical protein	NA	NA	NA	NA
AZO24890.1\|6598505_6599420_+	uracil-DNA glycosylase	A0A127AW33	Bacillus_phage	7.8e-18	35.0
AZO25979.1\|6599632_6600442_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZO24891.1\|6600666_6601614_-	DMT family transporter	NA	NA	NA	NA
AZO24892.1\|6601766_6604412_+	aminopeptidase N	NA	NA	NA	NA
AZO24893.1\|6604502_6605633_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZO24894.1\|6605735_6605918_+	hypothetical protein	NA	NA	NA	NA
AZO24895.1\|6605982_6608304_+	PAS domain S-box protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.5e-25	34.1
AZO24896.1\|6608383_6608644_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AZO24897.1\|6609042_6609288_-	hypothetical protein	NA	NA	NA	NA
AZO25980.1\|6609317_6612323_-	bifunctional [glutamine synthetase] adenylyltransferase/[glutamine synthetase]-adenylyl-L-tyrosine phosphorylase	NA	NA	NA	NA
6611910:6611925	attL	NA	NA	NA	NA
AZO24898.1\|6612334_6613804_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
AZO24899.1\|6613812_6614487_-	response regulator transcription factor	NA	NA	NA	NA
AZO24900.1\|6614693_6616244_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	7.3e-24	29.9
AZO24901.1\|6616399_6616582_+	hypothetical protein	NA	NA	NA	NA
AZO24902.1\|6616666_6617131_-	cytochrome c-type biogenesis protein CcmH	NA	NA	NA	NA
AZO24903.1\|6617127_6619116_-	heme lyase CcmF/NrfE family subunit	NA	NA	NA	NA
AZO24904.1\|6619115_6619559_-	cytochrome c maturation protein CcmE	NA	NA	NA	NA
AZO24905.1\|6619562_6620699_-	c-type cytochrome biogenesis protein CcmI	NA	NA	NA	NA
AZO24906.1\|6620918_6621350_-	hypothetical protein	NA	NA	NA	NA
AZO24907.1\|6621496_6622885_-	histidine kinase	NA	NA	NA	NA
AZO24908.1\|6622907_6623573_-	response regulator transcription factor	NA	NA	NA	NA
AZO24909.1\|6623655_6623955_-	hypothetical protein	NA	NA	NA	NA
AZO24910.1\|6624232_6624619_+	ester cyclase	NA	NA	NA	NA
AZO24911.1\|6624733_6625141_-	DUF3168 domain-containing protein	NA	NA	NA	NA
AZO24912.1\|6625283_6626837_-	trimethylamine methyltransferase	NA	NA	NA	NA
AZO24913.1\|6626847_6629259_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZO24914.1\|6629371_6630010_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZO24915.1\|6630175_6632332_+	penicillin-binding protein 1A	NA	NA	NA	NA
AZO25981.1\|6632516_6633377_+\|integrase	integrase	S5W9T9	Leptospira_phage	4.0e-32	33.9
AZO24916.1\|6633390_6634578_+\|transposase	IS91 family transposase	NA	NA	NA	NA
AZO24917.1\|6634969_6635720_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.0e-23	42.1
6639798:6639813	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP034447

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection