CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
AP018543	Enterococcus faecalis KUB3007 DNA, complete genome	2 crisprs	csa3,cas3,cas14j,DinG,csn2,cas2,cas1,cas9,DEDDh	1	18	8	2
AP018547	Enterococcus faecalis plasmid pKUB3007-4 KUB3007 DNA, complete genome	0 crisprs	RT	0	0	0	0
AP018546	Enterococcus faecalis plasmid pKUB3007-3 KUB3007 DNA, complete genome	0 crisprs	NA	0	0	1	0
AP018544	Enterococcus faecalis plasmid pKUB3007-1 KUB3007 DNA, complete genome	0 crisprs	NA	0	0	2	0
AP018545	Enterococcus faecalis plasmid pKUB3007-2 KUB3007 DNA, complete genome	0 crisprs	RT,DinG	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018543_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018543_1

1559137-1560227

TypeII

Consensus_repeat	Method
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CRISPRCasFinder
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CRT
TGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	PILER-CR
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	PILER-CR

16 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of AP018543_1

>merge|AP018543|1|1559137-1560227|CRISPRCasFinder,CRT,PILER-CR,PILER-CR
GTTTTACTGGTAAGAAATTATTGAGAGTACAAAAACCATGGACTGCAACAACTTACGACGACACGTGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACAAATGTTGCGATGAATAATTTTAATTGGAAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACCAATGCCTATTTTGATTCTATGACTACGATGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTAAGTAAGTAGAAAAGTTATGGCGGTGGCGGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACAACTGATTACCCACGTCTTTTACTTGTTTTGTTTTACTTATAAGAAATTATTGAGAGTACAAAAACATGGTACAGAAAAAGCCTATAAAAAAGCTTGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTCATACCTATATCGGTTAGCTCTTTGGTAAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACCATAGAGAGTGGAGGTGTGACATTGAATTAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACGCACAGCCACGATGGCATTTGAAGCGAATTGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACCTTCCGATACTAGTTTAAAGCAATGGAACGGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACACTTGCCCGACAAGATAGTCTTGCTCTGCTGGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTGGTTAAAAAGGAAGCCATCAAAGAGACAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTGGTTGCCGTCAGCACCATCAAGAGGAACAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTTCAGCGTATGCTGTTATTAAAGAAAATTCGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTAGAAAGGACTGATTGCTTTCATTGAATAGGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACAGGTTGACCTGTTAATAAAGAAAGCTCTGGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC

>AP018543|1|1|1559137-1560227|CRISPRCasFinder
GTTTTACTGGTAAGAAATTATTGAGAGTACAAAAAC	CATGGACTGCAACAACTTACGACGACACGT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AAATGTTGCGATGAATAATTTTAATTGGAA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CAATGCCTATTTTGATTCTATGACTACGAT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAAGTAAGTAGAAAAGTTATGGCGGTGGCG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AACTGATTACCCACGTCTTTTACTTGTTTT
GTTTTACTTATAAGAAATTATTGAGAGTACAAAAAC	ATGGTACAGAAAAAGCCTATAAAAAAGCTT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TCATACCTATATCGGTTAGCTCTTTGGTAA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CATAGAGAGTGGAGGTGTGACATTGAATTA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	GCACAGCCACGATGGCATTTGAAGCGAATT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CTTCCGATACTAGTTTAAAGCAATGGAACG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	ACTTGCCCGACAAGATAGTCTTGCTCTGCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTAAAAAGGAAGCCATCAAAGAGACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTGCCGTCAGCACCATCAAGAGGAACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TTCAGCGTATGCTGTTATTAAAGAAAATTC
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAGAAAGGACTGATTGCTTTCATTGAATAG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AGGTTGACCTGTTAATAAAGAAAGCTCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC

>AP018543|1|1|1559137-1560227|CRT
GTTTTACTGGTAAGAAATTATTGAGAGTACAAAAAC	CATGGACTGCAACAACTTACGACGACACGT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AAATGTTGCGATGAATAATTTTAATTGGAA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CAATGCCTATTTTGATTCTATGACTACGAT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAAGTAAGTAGAAAAGTTATGGCGGTGGCG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AACTGATTACCCACGTCTTTTACTTGTTTT
GTTTTACTTATAAGAAATTATTGAGAGTACAAAAAC	ATGGTACAGAAAAAGCCTATAAAAAAGCTT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TCATACCTATATCGGTTAGCTCTTTGGTAA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CATAGAGAGTGGAGGTGTGACATTGAATTA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	GCACAGCCACGATGGCATTTGAAGCGAATT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CTTCCGATACTAGTTTAAAGCAATGGAACG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	ACTTGCCCGACAAGATAGTCTTGCTCTGCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTAAAAAGGAAGCCATCAAAGAGACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTGCCGTCAGCACCATCAAGAGGAACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TTCAGCGTATGCTGTTATTAAAGAAAATTC
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAGAAAGGACTGATTGCTTTCATTGAATAG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AGGTTGACCTGTTAATAAAGAAAGCTCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC

>AP018543|1|1|1559334-1559568|PILER-CR
TGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAAGTAAGTAGAAAAGTTATGGCGGTGGC
GGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AACTGATTACCCACGTCTTTTACTTGTTT
TGTTTTACTTATAAGAAATTATTGAGAGTACAAAAAC	ATGGTACAGAAAAAGCCTATAAAAAAGCT
TGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTCATACCTATATCGGTTAGCTCTTTGGTAAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACCATAGAGAGTGGAGGTGTGACATTGAATTAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	GCACAGCCACGATGGCATTTGAAGCGAATT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CTTCCGATACTAGTTTAAAGCAATGGAACG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	ACTTGCCCGACAAGATAGTCTTGCTCTGCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTAAAAAGGAAGCCATCAAAGAGACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTGCCGTCAGCACCATCAAGAGGAACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TTCAGCGTATGCTGTTATTAAAGAAAATTC
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAGAAAGGACTGATTGCTTTCATTGAATAG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AGGTTGACCTGTTAATAAAGAAAGCTCTG


>AP018543|1|2|1559665-1560227|PILER-CR
	TAAGTAAGTAGAAAAGTTATGGCGGTGGC
GGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AACTGATTACCCACGTCTTTTACTTGTTT
TGTTTTACTTATAAGAAATTATTGAGAGTACAAAAAC	ATGGTACAGAAAAAGCCTATAAAAAAGCT
TGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACTCATACCTATATCGGTTAGCTCTTTGGTAAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAACCATAGAGAGTGGAGGTGTGACATTGAATTAGTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	GCACAGCCACGATGGCATTTGAAGCGAATT
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	CTTCCGATACTAGTTTAAAGCAATGGAACG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	ACTTGCCCGACAAGATAGTCTTGCTCTGCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTAAAAAGGAAGCCATCAAAGAGACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TGGTTGCCGTCAGCACCATCAAGAGGAACA
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TTCAGCGTATGCTGTTATTAAAGAAAATTC
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	TAGAAAGGACTGATTGCTTTCATTGAATAG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC	AGGTTGACCTGTTAATAAAGAAAGCTCTG
GTTTTACTGATAAGAAATTATTGAGAGTACAAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
AP018543.1\|BBD28110.1\|1560304_1561363_-\|hypothetical-protein	csn2	cd12217_csn2_CAS-II-A	gnl\|CDD\|213410
AP018543.1\|BBD28115.1\|1566713_1567598_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|225088
AP018543.1\|BBD28104.1\|1553794_1554472_-\|phosphate-transport-system-regulatory-protein-PhoU	unknown	unknown	gnl\|CDD\|273990
AP018543.1\|BBD28106.1\|1555255_1556065_-\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|237646
AP018543.1\|BBD28101.1\|1551229_1551586_-\|phage-holin-family-protein	unknown	unknown	gnl\|CDD\|377198
AP018543.1\|BBD28111.1\|1561362_1561662_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
AP018543.1\|BBD28103.1\|1551983_1553669_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226123
AP018543.1\|BBD28107.1\|1556081_1556966_-\|phosphate-ABC-transporter,-permease-protein-PstA	unknown	unknown	gnl\|CDD\|223654
AP018543.1\|BBD28100.1\|1550874_1551195_+\|endo/excinuclease	unknown	unknown	unknown
AP018543.1\|BBD28105.1\|1554486_1555245_-\|phosphate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|172743
AP018543.1\|BBD28114.1\|1564433_1566266_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187774
AP018543.1\|BBD28109.1\|1558008_1558863_-\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|273991
AP018543.1\|BBD28118.1\|1569560_1572098_-\|protein-translocase-subunit-SecA	unknown	unknown	gnl\|CDD\|237259
AP018543.1\|BBD28113.1\|1562808_1564353_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	cd09643_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|375527
AP018543.1\|BBD28112.1\|1561682_1562603_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
AP018543.1\|BBD28116.1\|1567590_1568277_-\|cell-division-ATP-binding-protein-FtsE	unknown	unknown	gnl\|CDD\|225438
AP018543.1\|BBD28102.1\|1551585_1551909_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
AP018543.1\|BBD28119.1\|1572353_1572923_-\|ribosome-associated-translation-inhibitor-RaiA	unknown	unknown	gnl\|CDD\|224461
AP018543.1\|BBD28117.1\|1568382_1569366_-\|peptide-chain-release-factor-2	unknown	unknown	gnl\|CDD\|234799
AP018543.1\|BBD28108.1\|1556965_1557886_-\|phosphate-ABC-transporter-permease-subunit-PstC	unknown	unknown	gnl\|CDD\|223646

Protein	Function_ID	Function_description	E-value
AP018543.1\|BBD28110.1\|1560304_1561363_-\|hypothetical-protein	gnl\|CDD\|213410	cd12217, Stu0660_Csn2, Stu0660-like CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. This family of Csn2 proteins includes Stu0660, the proteins are larger than other (canonical) Csn2 proteins as they have an additional alpha-helical C-terminal domain. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	6.00722e-114
AP018543.1\|BBD28115.1\|1566713_1567598_-\|ABC-transporter-permease	gnl\|CDD\|225088	COG2177, FtsX, Cell division protein [Cell division and chromosome partitioning].	2.07346e-97
AP018543.1\|BBD28104.1\|1553794_1554472_-\|phosphate-transport-system-regulatory-protein-PhoU	gnl\|CDD\|273990	TIGR02135, Uncharacterized_protein, phosphate transport system regulatory protein PhoU. This model describes PhoU, a regulatory protein of unknown mechanism for high-affinity phosphate ABC transporter systems. The protein consists of two copies of the domain described by pfam01895. Deletion of PhoU activates constitutive expression of the phosphate ABC transporter and allows phosphate transport, but causes a growth defect and so likely has some second function. [Regulatory functions, Other, Transport and binding proteins, Anions].	6.09767e-88
AP018543.1\|BBD28118.1\|1569560_1572098_-\|protein-translocase-subunit-SecA	gnl\|CDD\|237259	PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed.	0
AP018543.1\|BBD28101.1\|1551229_1551586_-\|phage-holin-family-protein	gnl\|CDD\|377198	pfam04020, Phage_holin_4_2, Mycobacterial 4 TMS phage holin, superfamily IV. These proteins are predicted transmembrane proteins with probably four transmembrane spans. The 1.E.40 is represented by the mycobacterial 4 phage holin, but it also contains many cyanobacterial. proteobacterial and firmicute proteins. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as in those of the bacteriophage of these organisms. The primary function of holins appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis. When chromosomally encoded the enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases.	7.53845e-22
AP018543.1\|BBD28111.1\|1561362_1561662_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	8.28523e-23
AP018543.1\|BBD28103.1\|1551983_1553669_-\|hypothetical-protein	gnl\|CDD\|226123	COG3595, COG3595, Uncharacterized conserved protein [Function unknown].	5.58814e-14
AP018543.1\|BBD28107.1\|1556081_1556966_-\|phosphate-ABC-transporter,-permease-protein-PstA	gnl\|CDD\|223654	COG0581, PstA, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism].	1.01734e-103
AP018543.1\|BBD28106.1\|1555255_1556065_-\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|237646	PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional.	0
AP018543.1\|BBD28105.1\|1554486_1555245_-\|phosphate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|172743	PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional.	0
AP018543.1\|BBD28114.1\|1564433_1566266_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|187774	cd09643, Csn1, CRISPR/Cas system-associated protein Cas9. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Very large protein containing McrA/HNH-nuclease related domain and a RuvC-like nuclease domain; signature gene for type II.	4.20729e-79
AP018543.1\|BBD28109.1\|1558008_1558863_-\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|273991	TIGR02136, ptsS_2, phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975. [Transport and binding proteins, Anions].	3.17732e-122
AP018543.1\|BBD28113.1\|1562808_1564353_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|375527	pfam18061, CRISPR_Cas9_WED, CRISPR-Cas9 WED domain. This domain, known as the wedge (WED) domain, is found in Cas9 proteins which are present in Staphylococcus aureus. Cas9 cleaves double-stranded DNA targets with a protospacer adjacent motif (PAM) and complementarity to the guide RNA. The Cas9 WED domain has a fold comprising a twisted five-stranded beta sheet flanked by four alpha helices, and is responsible for the recognition of the distorted repeat: anti-repeat duplex. WED domains are responsible for the recognition of single-guide RNA scaffolds.	2.78887e-25
AP018543.1\|BBD28112.1\|1561682_1562603_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	5.96493e-97
AP018543.1\|BBD28116.1\|1567590_1568277_-\|cell-division-ATP-binding-protein-FtsE	gnl\|CDD\|225438	COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning].	1.10484e-139
AP018543.1\|BBD28102.1\|1551585_1551909_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	1.24173e-20
AP018543.1\|BBD28119.1\|1572353_1572923_-\|ribosome-associated-translation-inhibitor-RaiA	gnl\|CDD\|224461	COG1544, COG1544, Ribosome-associated protein Y (PSrp-1) [Translation, ribosomal structure and biogenesis].	1.09514e-37
AP018543.1\|BBD28117.1\|1568382_1569366_-\|peptide-chain-release-factor-2	gnl\|CDD\|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0
AP018543.1\|BBD28108.1\|1556965_1557886_-\|phosphate-ABC-transporter-permease-subunit-PstC	gnl\|CDD\|223646	COG0573, PstC, ABC-type phosphate transport system, permease component [Inorganic ion transport and metabolism].	1.29322e-99

>AP018543.1|BBD28109.1|1558008_1558863_-|phosphate-ABC-transporter-substrate-binding-protein
MKKRLLLFIGLASILTLTGCAKWIDRGESITAVGSSALQPLVETASEEYQSQNPGRFINVQGGGSGTGLSQVQSGAVDIGNSDLFAEEKKGIKAEDLIDHKVAVVGITPIVNKNVGVKDISMENLKKIFLGEVTNWKELGGKDQKIVILNRAAGSGTRATFEKWVLGDKTAIRAQEQDSSGMVRSIVSDTPGAISYTAFSYVTDEVATLSIDGVQPTDENVMNNKWIIWSYEHMYTRKNPSDLTKEFLDFMLSDDIQERVIGQLGYIPVSKMEIERDWQGNVIK
>AP018543.1|BBD28108.1|1556965_1557886_-|phosphate-ABC-transporter-permease-subunit-PstC
MEDVQKKLLTKSKRAKMEQRGKFISFLCIALIVAVVVSIFYFVASKGLATFFKDKINVFDFLFGTNWNPSDIGADGKPMVGALPMIAGSFIVTFLSAIVATPFAIGAAVFMTEISPKKGAKFLQPVIELLVGIPSVVYGFIGLSVIVPFVRSIFGGTGFGILAGTFVLFVMILPTVTTMTVDALKAVPRHYREASLALGATRWQTIYKVVLRAAVPGILTAVVFGMARAFGEALAIQMVIGNAAVMPTSLTTPASTLTSILTMGIGNTIMGTVENNVLWSLALILLLMSLLFNIVIRIIGKRGALK
>AP018543.1|BBD28107.1|1556081_1556966_-|phosphate-ABC-transporter,-permease-protein-PstA
MNAKKADKIATGILYAVSGVIVLILAALLIYILARGIPHISWEFLTQPSRAYQVGGGIGIQLFNSLYLLLITMIISIPISLGAGIYLSEYAKKNWLTDLIRTSIEILSSLPSVVVGLFGFLIFVVQIGYGFSILSGALALTFFNLPLLTRNVEESLKAIHYTQREAGLALGLSRWETVKKVILPEALPGILTGVILSSGRIFGEAAALIYTAGQSAPALDFSNWNPLSVSSPISIFRQAETLAVHIWKINTEGTMPDGAAVSAGASAVLILVVLLFNFGARFIGNRLYKRMTSA
>AP018543.1|BBD28106.1|1555255_1556065_-|phosphate-ABC-transporter-ATP-binding-protein
MKEYNLNDTHLLQLDSQKDPIALHTEDLHVFYGDNEAIKGVDLQFEKNKITALIGPSGCGKSTYLRSLNRMNDGIANSRVTGKIMYKDVDVNTKEVDVYEMRKRIGMVFQRPNPFSKSIYENITFALKQHGEKDKKKLDEIVETSLKQAALWDQVKDNLNKSALALSGGQQQRLCIARAIAMKPDILLLDEPASALDPISTGTVEETLVNLKDDYTIIIVTHNMQQAARISDYTAFFYMGKVIEYDHTRKIFTRPKIQATEDYVSGHFG
>AP018543.1|BBD28105.1|1554486_1555245_-|phosphate-ABC-transporter-ATP-binding-protein
MGKEIISSKDLHLYYGKKEALKGIDLTFNQGELTAMIGPSGCGKSTYLRCLNRMNDLIPDVTITGSVVYKGKDIYGPKTDNVELRKEIGMVFQQPNPFPFSVYENVIYGLRLKGVKDKQVLDEAVETSLKAAAVWEDVKDKLHKSALSLSGGQQQRVCIARVLAVEPDIILLDEPTSALDPVSSGKIENMLLTLKEKYTMIMVTHNMSQASRISDKTAFFLQGDLIEFNDTKKVFLNPKEKQTEDYISGKFG
>AP018543.1|BBD28104.1|1553794_1554472_-|phosphate-transport-system-regulatory-protein-PhoU
MLRTQFEEELLNLHNQFYEMGMMVSSAVHKSVKAYINHDKKLAQEVIDRDIEINDMEVKLEKKSFEMIALQQPVTTDLRMIITVMKASSDLERMADHAVSIAKSTIRLKGETRIPEIEKEISDMSDYVKKMVDNVLIAYVKTDQKDARMIAQMDDRTNEYFDSIYKHAVEAMKANPETVISGTDYLHVAQYLERIGDYVTNICEWIVYLATGKITELNSNRDEQF
>AP018543.1|BBD28103.1|1551983_1553669_-|hypothetical-protein
MTNDQKQGIIMHVRKTLLSEKFAKEAISMKERERVLELVKKGILTSEEALILLENMATEKDEKQIEKAAEKVDTQNIGTTNKEDQVADLMDALEKGESEGPTVDSFEENTQDSAEKDRENLERILDELATKANRASAELDEVNAEIAGIKEEIKEVAEEIGTLDTKEELDALTEDEQVQRKDLHVLLAQLEEKLATQSTEKTALEEELKNIRKEQWKGQWNDTKEKVSSQFSEEWKDQATDTFNQVGGKVAEVGGQVGEFLKKTFNSFSDTMNDNVEWKDIKMKVPGVATTKFEHEFNYPNPQASLIDVKVANGTVVFKTWDQEDVKVEAKIKLYGKMAGDSPMEAFLERSDIDVDDETISFQVPNKRVKADLTFYLPKRTYDHVSVKLLNGNVLVEELTAKDVYTKSTNGTITFKKIDATMLEIEGVNGEIKVLEGTILDNIIETVNGDVSISAAPESLSVSLINGDIRITAKEKTLRRVEASSANGNIKLALPNDLGVEGQVKTNLGSINSRLTDIEVVREKKDRGNQQLHFRRVLEESMAQINASTTTGSIFLKDTDK
>AP018543.1|BBD28102.1|1551585_1551909_-|PspC-domain-containing-protein
MKRKLTKSPNNVVLTGSLAGIADWLGIDPTIIRVVYVLLSFFSAGFPGILLYIALAVLIPSGRTGSDRGYGHQNPYNRNVRNENPYAANKKQRKEAEKIDDDEWSDF
>AP018543.1|BBD28101.1|1551229_1551586_-|phage-holin-family-protein
MTYFQRLVVNTLTFISLSVVFPGMIHVRGIMPAIIAAFVLSILNMLVKPVLTILSLPFTLLTFGLFSFVVNAAILQMTSFFVGEMNFGFSSFWAAVLMAVIMSIVNTIVTDHNLSKYE
>AP018543.1|BBD28100.1|1550874_1551195_+|endo/excinuclease
MTRFANQNQRISQANQRDWQLMWLPCQKKIKYYLIYQGLVVATRVVTKQTFQKYSPLELAKKIMPKKPPKTIEHYSKQQVDFLNILYGYISRHPECHLENLTIEKA
>AP018543.1|BBD28110.1|1560304_1561363_-|hypothetical-protein
MKQIRLEYQYQQFIEFSLEDYVFFYGGENQWRRKILRTLKRFAKQKALSDLEESVYGDNGIEIFLEEKKLKAKSIDFYFLEDNTSIFQQMNFIKGTLLHQELLYLQDDFDITNQMSNLNDQLLKLENLMNDKLNNYLTNIEPHFLEMNFQDILKYSLSLNYLENGQSLPLEMMDTRELLAEFIYLLQRSISRREQPVWLVITNPESFLETESIYYLFQQLKKLAQETKQLKFFIFSNRSLPLPYTEEDVEKTILLYDKYQQLPVFDVFRQSIERHYPDQLSWTNQQLIDAFYRVCHFVGDQYTKNYLLPKDMILLKLLKELLDDNSECVETSMEKLTVLEEQYFRERLLRKE
>AP018543.1|BBD28111.1|1561362_1561662_-|CRISPR-associated-endonuclease-Cas2
MCLFDLPFETKQEQKEYRIFRKHLLENGFIMLQYSIYYRSLPNRSALKKYETILKRKVPRSGNVRLLYVSEIQFQDMLLLAGSRSHQEEVVGVHRLVVI
>AP018543.1|BBD28112.1|1561682_1562603_-|type-II-CRISPR-associated-endonuclease-Cas1
MLLGFRTVFVKNGEKLKVKLDNLEVIKEGNTYVIPLTDIESVILEGDQTVITTRLLAKFAQHHIDTVICDNTFMPVGVFLGIGQYHRSAKRAIWQSNWTEEHKQVAWCEIVTQKIQNQIAVAKYLGTDSERVEVLEKLSEGILPGDTTNREGHVAKVYFHSLYGVGFTREEECLPNACMNYGYAVIRAQMARCVVALGLLPMLGIFHKNEYNSFNLIDDLMEPFRPLMDWYIHQTILKKNEKYLTYHSRLTLVEFLHQKIKVKNKKIYMNQAMSEYVAAFVKAMETGDFENVQKIHLVNMLECEGK
>AP018543.1|BBD28113.1|1562808_1564353_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MDGSFKKTNGKFSNWDDYQKWVESRHFSHKKENNLLETRNIFDSEQVEKFLARNLNDTRYASRLVLNTLQSFFANQETKVRVVNGSFTHTLRKKWGADLDKTRETHHHHAVDATLCAVTPFVKVSRYHYAVKEETGEKVMREIDFETGEIVDEMSYQEFKKSKKYERKTYQVKWPNFREQLKPVNLHPRIKFSHQVDRKANRKLSDATIYSVREKTEVKTLKSGKQKITTDEYTIGKIKDIYTVDGWEAFKKKQDKLLMKDLDEKTYERLLSIAETTPDFQEVEEKNGKVKRVKRSPFAVYCEENDIPAIRKYAKKNNGPLIRSLKYYDGKLNKHINITKDSQGRPVEKTKNGRKVTLQSLKPYRYDIYQDLETKAYYTVQLYYSDLRFVEGKYGITEKEYMKKVAEQTKGQVVRFCFSLQKNDGLEIEWKDSQRYDVRFYNFQSANSINFKGLEQEMMPAENQFKQKPYNNGAINLNIAKYGKEGKKLRKLNTDILGKKHYLYYEKEPKNIIK
>AP018543.1|BBD28114.1|1564433_1566266_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MYSIGLDLGISSVGWSVIDERTGNVIDLGVRLFSAKNSEKNLERRTNRGGRRLIRRKTNRLKDAKKILAAVGFYEDKSLKNSCPYQLRVKGLTEPLSKGEIYKVTLHILKKRGISYLDEDDTEAAKESQDYKEQVRENAQLLTKYTPGQIQLQRLKENNRVKTGINAQGNYELNVFKVSAYANELATILKTQQAFYPNELTDDWIALFVQPGIAEEAGLIYRKRPYYHGPGNEANNSPYGRWSDFKKTGQPATNIFDKLIGKDFQGELRASGLSLSAQQYNLLNDLTNLKIDGEIPLSPEQKEYILAELMTKEFTRFGVNDVVKLLGVKKERLSGWRLDKKGKPEIHTLKGYRNWRKIFAESGIDLATLPTETIDCLAKVLTLNTEREGIENTLAFELPELAESVKLLVLDRYKELSQSVSTQAWHRFSLKTLHLLIPELMNATSEQNTLLEQFQLKSDVRKRYSEYKKLPTKDVLTEIYNPTVNKTVSQAFKVIDALLVKYGKEQIRYITIEMPRDDNEEDEKKRIKELHAKNSQRKNDSQSYFMQKSGWSQEKFQTTIQKNRRFLAKLLYYYEQDGICAYTGLSISPELLVSDSTEIDQIILFQFRLA
>AP018543.1|BBD28115.1|1566713_1567598_-|ABC-transporter-permease
MIRTFFSHLFESIKSLKRNGWMTVASASAVTITLVLVGIFMGVIFNATKLADDVEKNVTVSVFVDIGTKQNEMKTLEKQLKGLDNVEDISYSNKDQQLKKIQEQMGDAWNLFEGDSNPLYDVYYVRAKTPEDTKDIAKQAAKFPSVFKADYGGVNSDKIFKIAQTVRTWGLAAAALLLFVAVFLISNTIRITILSRQKEIQIMRLVGAKNSFIRWPFFLEGAWIGLIGAIVPVIIMTLGYHQVYNMFNPQLLRSNYSLIRPEDFIWKVNLLMVATGMIIGSLGSVISMRRFLKI
>AP018543.1|BBD28116.1|1567590_1568277_-|cell-division-ATP-binding-protein-FtsE
MIEMKDVMKKYSNGTTAIRNISVEIDQGEFVYVVGPSGAGKSTFIRLMYREEKATKGNLTVAGHDLMKIKNKEVPYLRREIGIVFQDYKLLPKKTVYENVAYAMQVIGRRPREIKKRVMEVLDLVGLKHKVRVFPSELSGGEQQRVSIARAIVNTPKVLIADEPTGNLDPENSWEIMKLLDRINAQGTTVVMATHNSTIVNTIRHRVIAIENGRIIRDQVEGEYGYDD
>AP018543.1|BBD28117.1|1568382_1569366_-|peptide-chain-release-factor-2
MGEPGFWDNTETAQKLINETNSLKEKYQQFHQLSEELDELTVMFELQQEEYDAEIQEELEERIHLLQERLTTYELSLLLNEPYDHNNALIELHPGAGGTESQDWGSMLLRMYTRWAESHGFQVETLDYQAGDEAGIKSVTLLIKGYNAYGYLKSEKGVHRLVRISPFDSAKRRHTSFCSVDVMPELDDTIEIAINPDDLKIDTYRASGAGGQHINKTESAVRITHIPTGTVVASQAQRSQLKNREQAMSMLKAKLYQLEMEKKAQEAASLRGEQMEIGWGSQIRSYVFHPYSMVKDHRTNYETGNVQAVMDGDLDGFIDAYLKQRLS
>AP018543.1|BBD28118.1|1569560_1572098_-|protein-translocase-subunit-SecA
MANFLKKMIENDKKELRRLEKIADKIDAHASAMEQLSDEQLREKTDEFKARYQKGETLDELLPEAFAVVREAAKRVLGLFPYRVQLMGGIVLHDGNIPEMRTGEGKTLTATMPVYLNALSGEGVHVVTVNEYLATRDSNEMGELYNFLGLSVGLNINSKSSDEKREAYNCDITYSTNNELGFDYLRDNMVVYRSQMVQRPLNYAIVDEVDSILIDEARTPLIISGQAEKSTALYTRADNFVKRLKEDEDYKIDIQSKTIGLTEAGIEKAEQTFGLDNLYDIENTALTHHLDQALRANYIMLLDIDYVVQDNKVLIVDQFTGRIMDGRRYSDGLHQAIEAKEGVEIEDETKTMATITFQNYFRMYKKLAGMTGTAKTEEEEFREIYNIQVIQIPTNRPIIRDDRPDLLYPTLESKFNAVVEDIKERYHKGQPVLVGTVAVETSELLSDKLNAAKIPHEVLNAKNHFKEAEIIMNAGQKGAVTIATNMAGRGTDIKLGLGVLELGGLAVIGTERHESRRIDNQLRGRAGRQGDPGVSQFYLSLEDDLMKRFGSERIKTFLERMNVQEEDAVIQSKMFTRQVESAQKRVEGNNYDTRKNVLQYDDVMREQREVIYAQRQEVIMEENDLSNVLMGMVKRTIGRVVDSHTQLEKEEWNLDGIVDFAASTLVHEDTISKKDLENKSAEEIKDYLVARAQEVFEEKSQQLNGQEQLLEFEKVVILRVVDTKWTDHIDAMDQLRQSVGLRAYGQNNPLVEYQTEGYSMYNNMVGSIEYEVTRLFMKSEIRQNVQREQVAQGQAEHPETEQDAAAQSNTSAKRQPVRVDKKVGRNDLCPCGSGKKFKNCHGRNA
>AP018543.1|BBD28119.1|1572353_1572923_-|ribosome-associated-translation-inhibitor-RaiA
MKGVIVMFRYNVRGENIEVTEAIRDYVEKKVGKLERYFSDSPEATVHVNLKVYTEKTAKVEVTIPLPYLVLRAEETSPDLYASIDLVVDKLERQIRKFKTKINRKSRETGRNNTKAAVFLVGEETEETPSELDIVRTKRLSLKPMDSEEAVLQMNMLGHNFFIFEDAETNGTSIVYRRKDGKYGLIETD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: AP018543_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018543_2

1806517-1806816

Orphan

II-A,II-B

Consensus_repeat	Method
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CRISPRCasFinder
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CRT

4 spacers

The CRISPR arrays of AP018543_2

>merge|AP018543|2|1806517-1806816|CRISPRCasFinder,CRT
GTGATAGTTTGTTTTTTAACAACATGGCTCTAAAACAAATTTTTATCACTTAATGCAATTTCTTGAGTTTTGGTACCATTCTAAACAACATGACTCTAAAACTCGACTTGCCTTCCTAAGATATAAACTTCTGTTTTGGTACCATTCTAAACAACATGACTCTAAAACATCGAAAACATTATACGAACATAAATTTGTGTTTTGGTACCATTCTAAACAACATGACTCTAAAACTCTTGTTTCGTGTACTTATTGATAACTAAAGTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>AP018543|2|2|1806517-1806816|CRISPRCasFinder
GTGATAGTTTGTTTTTTAACAACATGGCTCTAAAAC	AAATTTTTATCACTTAATGCAATTTCTTGA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCGACTTGCCTTCCTAAGATATAAACTTCT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	ATCGAAAACATTATACGAACATAAATTTGT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCTTGTTTCGTGTACTTATTGATAACTAAA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>AP018543|2|2|1806517-1806816|CRT
GTGATAGTTTGTTTTTTAACAACATGGCTCTAAAAC	AAATTTTTATCACTTAATGCAATTTCTTGA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCGACTTGCCTTCCTAAGATATAAACTTCT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	ATCGAAAACATTATACGAACATAAATTTGT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCTTGTTTCGTGTACTTATTGATAACTAAA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
AP018543.1\|BBD28352.1\|1801943_1803677_-\|thiol-reductant-ABC-exporter-subunit-CydD	unknown	unknown	gnl\|CDD\|274323
AP018543.1\|BBD28359.1\|1811298_1811814_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|176643
AP018543.1\|BBD28354.1\|1804691_1806110_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
AP018543.1\|BBD28349.1\|1798093_1798999_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|235695
AP018543.1\|BBD28363.1\|1814598_1814943_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|370163
AP018543.1\|BBD28351.1\|1800180_1801947_-\|thiol-reductant-ABC-exporter-subunit-CydC	unknown	unknown	gnl\|CDD\|227320
AP018543.1\|BBD28346.1\|1793284_1793986_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225099
AP018543.1\|BBD28361.1\|1813042_1813192_-\|hypothetical-protein	unknown	unknown	unknown
AP018543.1\|BBD28362.1\|1813248_1814373_-\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
AP018543.1\|BBD28360.1\|1811830_1813069_+\|multidrug-resistance-protein	unknown	unknown	gnl\|CDD\|340949
AP018543.1\|BBD28357.1\|1810133_1810499_-\|DUF1033-domain-containing-protein	unknown	unknown	gnl\|CDD\|336361
AP018543.1\|BBD28358.1\|1810596_1811166_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
AP018543.1\|BBD28356.1\|1807921_1810171_-\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
AP018543.1\|BBD28364.1\|1815010_1816156_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029
AP018543.1\|BBD28347.1\|1794116_1796540_-\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
AP018543.1\|BBD28355.1\|1806973_1807837_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
AP018543.1\|BBD28348.1\|1796853_1798065_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
AP018543.1\|BBD28345.1\|1792417_1793167_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
AP018543.1\|BBD28350.1\|1799120_1800101_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
AP018543.1\|BBD28353.1\|1803681_1804695_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764

Protein	Function_ID	Function_description	E-value
AP018543.1\|BBD28352.1\|1801943_1803677_-\|thiol-reductant-ABC-exporter-subunit-CydD	gnl\|CDD\|274323	TIGR02857, transport_ATP-binding_protein, thiol reductant ABC exporter, CydD subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD.	0
AP018543.1\|BBD28359.1\|1811298_1811814_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|176643	cd00865, PEBP_bact_arch, PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea. PhosphatidylEthanolamine-Binding Proteins (PEBPs) are represented in all three major phylogenetic divisions (eukaryotes, bacteria, archaea). The members in this subgroup are present in bacterial and archaea. Members here include Escherichia coli YBHB and YBCL which are thought to regulate protein phosphorylation as well as Sulfolobus solfataricus SsCEI which inhibits serine proteases alpha-chymotrypsin and elastase. Although their overall structures are similar, the members of the PEBP family have very different substrates and oligomerization states (monomer/dimer/tetramer). In a few of the bacterial members present here the dimerization interface is proposed to form the ligand binding site, unlike in other PEBP members.	1.1162e-31
AP018543.1\|BBD28354.1\|1804691_1806110_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
AP018543.1\|BBD28349.1\|1798093_1798999_-\|prenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	8.82053e-105
AP018543.1\|BBD28363.1\|1814598_1814943_-\|cysteine-desulfurase	gnl\|CDD\|370163	pfam08866, DUF1831, Putative amino acid metabolism. Solution of the structure of the Lactobacillus plantarum protein from this family has indicated a potential new fold with remote similarities to TBP-like (TATA-binding protein) structures. This similarity, in combination with genomic context analysis, leads us to propose an involvement in amino-acid metabolism. The potentially novel fold is an alpha + beta fold comprising two beta sheets packed against a single helix. The enzyme is present in the cytosol.	1.33245e-53
AP018543.1\|BBD28351.1\|1800180_1801947_-\|thiol-reductant-ABC-exporter-subunit-CydC	gnl\|CDD\|227320	COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].	0
AP018543.1\|BBD28346.1\|1793284_1793986_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.52313e-37
AP018543.1\|BBD28362.1\|1813248_1814373_-\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
AP018543.1\|BBD28360.1\|1811830_1813069_+\|multidrug-resistance-protein	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	9.51661e-174
AP018543.1\|BBD28357.1\|1810133_1810499_-\|DUF1033-domain-containing-protein	gnl\|CDD\|336361	pfam06279, DUF1033, Protein of unknown function (DUF1033). This family consists of several hypothetical bacterial proteins. Many of the sequences in this family are annotated as putative DNA binding proteins but the function of this family is unknown.	4.62165e-64
AP018543.1\|BBD28358.1\|1810596_1811166_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	2.91104e-15
AP018543.1\|BBD28356.1\|1807921_1810171_-\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
AP018543.1\|BBD28364.1\|1815010_1816156_-\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	1.80914e-178
AP018543.1\|BBD28347.1\|1794116_1796540_-\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.87198e-174
AP018543.1\|BBD28355.1\|1806973_1807837_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.45131e-27
AP018543.1\|BBD28348.1\|1796853_1798065_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	1.24993e-121
AP018543.1\|BBD28345.1\|1792417_1793167_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	2.63593e-110
AP018543.1\|BBD28350.1\|1799120_1800101_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	4.36842e-80
AP018543.1\|BBD28353.1\|1803681_1804695_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	9.60464e-103

>AP018543.1|BBD28354.1|1804691_1806110_-|cytochrome-ubiquinol-oxidase-subunit-I
MFDIVTLARIQFAMTTVFHFFFVPFSIGLALVVAIMETMYVVKKEERYRKMAKFWGNIFLLSFAVGVVTGIIQEFQFGMNWSDYSRFVGDIFGAPLAVEALLAFFLESTFLGLWIFTWDKMNPKVHVTFIWLVVFGSMMSAFWILVANSFMQHPVGYVINNGRAEMVDFVAVISNPKVWYEFSHVIMGAFTLGGMAVAGMAAFQLLKKRDISFHKASMRIGLWVTLFGSIGVLLAGDLQMKALIEGQPMKFAAMEGAYEDSDDPAAWTLIAWADEREHKQVFGIDIPYMLSILSYNKLSGSVDGMDTVNKRLVEKYGDDKNYYPPVNTLFWSFRIMAGFGALMLLVAALGLFFTRKKKPSLYEKKWMLWIVALCTFAPFLANTTGWLVTELGRYPWTVYGLFTIEQSVSPNVSVASLITSNVIYFLLFAGLGSVMVYLVILELRKGPDYEAKKLAKENEPALDPFDKGVFGE
>AP018543.1|BBD28353.1|1803681_1804695_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MSTLQLLWFVLIGVLFSGFFFLEGFDFGVGMAVQTLAHNDDEKDQVVATIGPVWDGNEVWLLTAGGAMFASFPYWYASLFSGYYLILFTILFGLIIRGVSFEFRHNMPEGKRRRMWNWTLSIGSFLVPFFFGILFISLVQGMPLDANGNMHAQFTDYFNLFSIVGGVALTLLCYLHGMNYIALKTEGPIRERARNYAEILYGVLYVGLVVFAVLMYFKTDFYEKNFAVTLILTLAIVVLTVIANVGVFKRKEMLAFLASGLTLVVLVALLFSGLFPRVMIGSEGFDLLIKDATSTPYTLKIMTWISLSILPFVLAYTAWSYYIFRKRISQTAVPEGY
>AP018543.1|BBD28352.1|1801943_1803677_-|thiol-reductant-ABC-exporter-subunit-CydD
MIDKDILQMPKIKKILVLLAGFSFLQAVFIIGQAFFLSKAIVGLWSGGHLNQQLQSILLFFIFYLGRHVITYFRERMLDTFSYERSKELREQLLTKIFRLGPNVVQKNGTGNMVTMALEGISQTENYLQLILTKMMNMMIIPWIILAFVFTQDIRSGITLLIVFPIIIIFMIVLGYAAQSKADKQYAAFQMLSNHFIDSLRGIDTLKLFGLSKKYAGSIYHTSERFRKATMSTLKIAILSTFALDFFTTLSVAVVAVFLGLSLLNGTILLFPALVTLILAPEFFLPIRDFSSDYHATLDGKNSFQAIQAVLALPEAEQTDVLTLDDWHQESQLSVTALNFSYEDATQEAIQSLQFSVDGRKKIGIIGASGSGKSTLINLLSGFLLPTEETSQLAINGQTIPHFLQKDWQKQILYIPQAPYIFQDTLANNIRFYTPEATDEAIQQAIQLVGLDELVKDLPEGIHTLIGESGRMLSGGQAQRVALARAFVDQKRHVLLFDEPTAHLDIETEVEMKERMLPLMNNHLVFFATHRLHWMEEMDYILVMEKGQLVEQGTLAELIEKDGYYVQLMKQMRGGRQ
>AP018543.1|BBD28351.1|1800180_1801947_-|thiol-reductant-ABC-exporter-subunit-CydC
MMEKQPTTKDVWKNDQWVRPFLKRYKKTLYFALLLGFLTFFSAGALMFTSGYLISRAASLPENILLIYIPIVLTRAFGIGRPVFRYVERLTSHNWVLKMTSDLRLKLYNVLEKDAIFFKTKYRTGDILGLLSEDINHIQNLYLRTIFPTVIAWILYIFLVIALGFFSWWFALCMLLMLGVVVFLLPLVSVLVNGARQEKHKYAKNELYQTLTDNILGVSDWVFSQRGSEFVARYETDEANVRALDEKMKQFNRGRDFVLQLLFGVIAIAVLAWTSVRFPGNHGGAANWIGAFVLTVFPLIDAFAPLPAAAQETTIYKDSIRRFNELPEGEDDSTEAPVQPNGTSLSIEHLSFAYENQAKKVLNDLSLTIPEKQKLAILGRSGSGKSTLASLIRGDLRPTSGEILLGNIPTEAFGETMTEYIGVMHQAPYLFRTTILNNIRIGREEASEAEVWAVLEKVGLKEMVAQLPEGLQTMVDEAGLRFSGGERHRLALARILLQDTPIVLLDEPTTGLDPITEQQLLETFFEALKDKTVIWITHHLQGVTLMDQVIFIEDGQLEMSGTPEELLATNAHYQKLYRIDRGISSFEE
>AP018543.1|BBD28350.1|1799120_1800101_+|polyprenyl-synthetase-family-protein
MNTFWKSFPDVERSLTETCELIEQTLHTRNEDIEEALVTLARSGGKLLRPAFFFLFAQLGDEEKQEKQQLLKIAASLEILHMATLIHDDIIDDSPLRRGAVTIQSQYGKDVAVYTGDLLFTEFFTLIADAMNGSEFMKINAQGMKRLLLGELDQMSHRFDRRMSIPAYLRSVNGKTAELFSLSCLEGAYFGHSSKEVQRLAKRIGRHIGIAFQVYDDILDYTADTETLKKPALEDLSQGVYTLPLLFAYQAAPDVFGPYLDKGRAITLEEAAEVAALVNDYHGVTEAQAFAKKVTNKAITDIQQLPDGTAKETLLSLTELLLHRSF
>AP018543.1|BBD28349.1|1798093_1798999_-|prenyltransferase
MNREIFFELVELKAKTASVLPFLLGICFSWYQYGRLHVGYVLIFFIAMFIFNMAVDILDNYNDYHHATEVHDYKEKTNIIGRENLSLPLIRKMIFWMILVSALMGIGLSFIVGWPLLIMGLYCYLIGIFYSSGPKPLSSLPLGEVFSGFTMGFMITLICVYINTFEVFNWSAANLWGIFLVALPNTCYIANLMLANNICDLEEDENNKRYTLVHYLGKASSLKLFVGLNTIAMLAILLAVGLGLTPPTMLLMLLTLPFVRKQTQALLKEQVKSKTFVCAVKILAVGATAQVLFFAIGLWWL
>AP018543.1|BBD28348.1|1796853_1798065_-|NAD(P)/FAD-dependent-oxidoreductase
MNKKHVVILGAGYAGLKTLRELQKGAKDVEITLVDRNNYHYEATDLHEVAAGTQPAEKITYNIMDVVDEKMTTFIQGTVKTIDAATQTVALEDGQTINYDYLVVSLGFESESFGIPGVQEHALQMVDVKTALNVYEHIQEQMRQYKATQNEEFLKIVVCGAGFTGIELLGSLVENKPKFAEIAGVSADQIQIYCVEAVTRLLPMFNEKLANYGVQLLKDSAIHLLLGKPIKEIKPGAVVYQDNEAGDLAELSAKTIIWTTGVSGSHVVGDSGFEARRGRVMVQPDLTDANHSNVYIIGDCSAVMDTETNRPYPTTAQIALKMGAHAAKNIQAQLKGEATKPFSFKSQGSVCSVGNTRALGIVGKTDIKGYPASFMKKIIMNKALFETGGTKEMMAKGRFDLYH
>AP018543.1|BBD28347.1|1794116_1796540_-|DNA-translocase-FtsK
MAQKRATNKKKSTTKKKTKKQQQQQERLNYMFLGLIFILFGVFGLFRLGFLGTLLANCLRLVVGNTFPFAAILLILYGLLVMIYGKDFPLKRGRPIFGAVLIYISVLLFFHAFMFRNVSGSQPDILGNTWEFLQSDLKANQVTQNVGGGMIGALLYQGTYFLVAQFGSYLIATLLLLAGIFLMSMWDFQQIVDHFQSIQDRLSHVSAKSQARQEEKEAKRAAKKEAKAAERQAKIEAAAQQKLQERERMEQAAADRLTKTPVETHQPMVEEPAAPTPVQIDSFQQQNQAMPVPPIAATKPQREQEEEAADEAGVLEFEISEEAEDRDYQLPPTDLLDTIQATDQSGEYEKIEKNIGVLEQTFKSFGVDAKVVKASLGPSVTKFEVQPAVGVKVSKIVNLTDDIALALAAKDVRMEAPIPGKSLIGIEVPNSAISTVSFRDIVEAQPSHPDKLLEVPLGRDISGMVQTADLSKMPHLLIAGSTGSGKSVAINGIITGILMQAKPHEVKLMMIDPKMVELNVYNGIPHLLTPVVTNPRKAAQALQKVVQEMEFRYEKFAATGVRNITGYNQLIQQKNAEDGENRPILPFIVVIVDELADLMMVASNEVEDAIIRLAQMARAAGIHMILATQRPSVDVITGIIKANVPSRMAFAVSSGTDSRTIIDTNGAEKLLGRGDMLFLPMGENKPIRIQGAFISDQEVERVVAFVTDQQEAEYQESMMPTDEPTTSGGGEAPQDELFEEAKNLVVEMQTASISLLQRRFRIGYNRAARLVDELEAHGVIGPSEGSKPRKVFLQAESEEAAPETPEQ
>AP018543.1|BBD28346.1|1793284_1793986_-|GntR-family-transcriptional-regulator
MRRKSVLYLEVADQIKEDILSGKYPVGTFLPTETELEELFNVSKITIRRAIEMLATEEFVEKKSGRGTTVLSNRPYNKLSKAGTFTEFLNESGQKVTKKVLQVENLTLSKEMPAYQFLGEEVVHLSRLYLIDEQPYIYFNYYLPAAMKDVSLTEYKEESLYRLMDRHAIEIYKFEDRFEVATLTEAEQKMLQTTETTGLKRIRRSLSPTGRCVEYSEAIYNTKIHPYVIEYEA
>AP018543.1|BBD28345.1|1792417_1793167_-|ABC-transporter-ATP-binding-protein
MLEVQNLKKVYGNEIKYEALKGINLTVQDGEFIGIMGPSGSGKSTLLNLLATIDSPTDGEILLNGKNPNNLNQEQIAKFRRTELGFVFQSFNLMPTLTVEENIILPLTLDGEKVSVMKRQLAELSERLGINHLLKKRIAEISGGQAQRVAVARAMIHHPQLLLADEPTGNLDTKSSKDVMGLLQQLNEEEAATILMVTHDPLAASYCKRIVFIKDGELIDEIVQNGNQKEFYDLIMVKLAEIEGVDNEF
>AP018543.1|BBD28355.1|1806973_1807837_-|AraC-family-transcriptional-regulator
MLANLNQAMDYIEEHLTEEVSFDELAKKTGISVYHFKRTFSFVAGMSLAEYIKKRRLAEANLALLAGEKVTDVAFKYGYQSIEGFSRAFRDWTGQAPSEVMKTQIQKTFPKFSFYIDIKGGQSMDVKLIEKPAFQIVGVSQKVPLQYQGENQAIIELAQRITPQQRAEMHTFDDVYPHQVVNASFDFQEGRTTEGGEMTHMIGFVTSQENTYEDLEQLSVPAHTWAVFPNKGPFPQTLQETWARIFSEWLPSSGYQVVAAPEISFTQYQGPAEAKYSEIWLAVTATK
>AP018543.1|BBD28356.1|1807921_1810171_-|DNA-topoisomerase-III
MAKQNSANGKLFETHEFKEKPQGIFFKLFFYSRNLEKIELIFGIIRKDSTQKGAKLVVAKQLIIAEKPSVAKDLSRVLGANQKNKNYYEGPNVIVTWALGHLLGLKMPEDLNKEWQTWQMETLPMIPKNLGIKPLPKTGHQLKAIKQLANRKDVSEAVIATDAGREGELVARWILEYVRFNKPVKRLWISSQTDKAIKDGFKKIRPAKDYDNLYYSALARAKADWLVGLNVTRALTVKYQDNLSAGRVQTPTLAMVRQQEKTIEQFKPQTYFTISLTVESEKAKMTQKNPYALKERQEAEQLVKELSKQKGLVTDIQEKVKTENAPLPYDLTEIQREANQRFQFSAKKTLSLVQSLYETHKIVSYPRTDSKYLTTDMKGTMKERLQAIADFSPEVKGYLKNGAVVKQQKVFQNAKVTDHHGLIPTEQRPRYEKLSNDEQKIYQMIVQRFLGLFAEPNQTKQTKVTVAFGKETFVFHQNKVVVAGWKTTAEQPLSTVQWQKGMTVAPNFTINKELTSPPKPLTEGTLLGKMEKHSLGTPATRAEIIEKLIKSELMERTNSGLSVSAKGKQLLDLVNPSLVTPELTEKWEKSLEAIASGQQKSQLFLKDIEEDTKKLVREIKQSEKKYQDFSITQKKCPDCGSNLREKNTKDGKIYVCTNQECSYRRRKDPKVSNHRCPQCHKKMVIIEGKNGRSFKCKFCSITEKIPDKKERKQKMTKHEERRLMKKYSQPDEPEESALAQALKAAMNQE
>AP018543.1|BBD28357.1|1810133_1810499_-|DUF1033-domain-containing-protein
MYQVITMYGDNEPWWFFDDWQEDIVQEKTFDNLTDAETYYVEVWQKLSQNYTYVNTKPNYLTAFWNDGEERWCEECDEDLQQYFGLALLENHHAVTFENKAEFTTISNHFGKTKFCKRKVI
>AP018543.1|BBD28358.1|1810596_1811166_-|TetR/AcrR-family-transcriptional-regulator
MAKKRNLTKAKILESARNLAEELGVQQLTFQNLAVDLGIKYPSLYNHFKNIAEVKNALVDLLIQELNDALRRALVGKSGAEAIRIYAETYQQFAFENSAVYELLISVPKTQNQQLIEGIHETNQIILQLLAFYPFNNEERLHKSRELRSLIHGYITLRFLGYFQREEATPEESYRRMIEDFIASLEVAG
>AP018543.1|BBD28359.1|1811298_1811814_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MHITNRSHLADRYGKRTSAEFLLHERPILSFPISLAAIPKEARYLSWELIDYDTIPLIGFPFIHWLAANVPVTNEIPEDFSRTALKPTIQGKNSLASPLGKQMIPALATETLPELTERYLGLSPRSGVHTYTLYVYATKNPLNLKEGFFANELHQALNDQRLAKAKFEFLY
>AP018543.1|BBD28360.1|1811830_1813069_+|multidrug-resistance-protein
MYELIKSKIFRPRQPWEKNLLVLWFGTFMAGIGFSLVMPFMPLYINTLGTFTHQQLNFWSGITFSSTFLVTTIVSPWWGRLADRKGRKLMLLRASLGMAIVISLMGAVTSVYQLIGLRLLQGVFSGYISNATALVATGTPKEKSGQVLGTLATGSVTGTLLGPLLGGVTASIFGYRPTFFITGTILLLVFVLSLVFVHEEFVPIEKNQAASGKQILKKLEHPHVILGMFITTLIIQASNNSISPIISLYIQQLLGGHGNVTLISGVIASIPGIATLIAAPRFGRLGDRIGSERILTIGLILAIFVYLPMAFVQNVWQLAMLRFLVGISDACLLPAVQTLITRYSPSDAAGRIFSYNQSFQATGNVIGPMIGSSVSAAFGYRGVFISTSCLVLLNLLWVRRSTAELKKEKNDD
>AP018543.1|BBD28361.1|1813042_1813192_-|hypothetical-protein
MLVIKPVNIRFSFLFYMPIFFKIRKREKLKIQIVDNFSVYNLVIIFLFF
>AP018543.1|BBD28362.1|1813248_1814373_-|tRNA-2-thiouridine(34)-synthase-MnmA
MADNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVAKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQLGADYVATGHYAQVETDENGVVHMLRGIDNNKDQTYFLSQLSQAQLAKTMFPLGGMEKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLPAKKGNMVTEDGEIKGQHDGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVHFTVDTPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVFYDGMECLGGGLIDRAYQDEKELQYV
>AP018543.1|BBD28363.1|1814598_1814943_-|cysteine-desulfurase
MAFTTTAAVEGSTVFYKVHPSAKRYTLKDNGFTETKSGNFQLIRSLDPTPQRNEGFKLKITITADLKELKMSITTANGLKPMNIFKNEQHEMSKEKYFFLMDGLISRGVLEKVE
>AP018543.1|BBD28364.1|1815010_1816156_-|cysteine-desulfurase
MEPIYLDHAATTPLHPTVIQAMTENMQTTFGNPSSIHQFGRKAHGLLEEVRQTIAESLQAKPHEIIFNSGGTEGDNTAILAVAFSRQKEGKHIITTAIEHPAVLRTMEYLETLGFEVTYLPVNENGQISMDQFKKSLREETILVSMMYGNNEIGNRLPIAEVGAILKNHSAIFHTDAVQAYGSEVILPHESGIDLLSISAHKINGPKGVGFLFKSDAIQLPPLLHGGEQEEKRRAGTENLAGIIGMGTAVSLLTSAEKQARKTAYQSFQTIILKALEEANIDFSINGEPTNRLAHVLNLHLKGIPSDLLLMHLDLRGIAISTGSACTAGTVDPSHVLTAMYGENSSAIKESIRISFGYGNTPEEIATFSEVLVAVIQQLKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
AP018543_1	1.8\|1559635\|30\|AP018543\|CRISPRCasFinder,CRT	1559635-1559664	30	AP018543.1	1255940-1255969	0	1.0

1. spacer 1.8|1559635|30|AP018543|CRISPRCasFinder,CRT matches to position: 1255940-1255969, mismatch: 0, identity: 1.0

catagagagtggaggtgtgacattgaatta	CRISPR spacer
catagagagtggaggtgtgacattgaatta	Protospacer
******************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	MT757399	Enterococcus phage AE4_17, complete genome	16421-16450	0	1.0
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	MK721197	Enterococcus phage vB_EfaP_Efmus2, complete genome	16493-16522	0	1.0
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	MT747434	Enterococcus phage ZEF1, complete genome	16416-16445	0	1.0
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	LT630001	Enterococcus phage Idefix genome assembly, chromosome: IDF	16073-16102	0	1.0
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	MK721195	Enterococcus phage vB_EfaP_Efmus1, complete genome	16061-16090	0	1.0
AP018543_2	2.2\|1806619\|30\|AP018543\|CRISPRCasFinder,CRT	1806619-1806648	30	GQ478087	Enterococcus phage phiFL3B, complete genome	14689-14718	0	1.0
AP018543_2	2.2\|1806619\|30\|AP018543\|CRISPRCasFinder,CRT	1806619-1806648	30	NC_013648	Enterococcus phage phiFL3A, complete genome	14383-14412	0	1.0
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	JQ309827	Enterococcus phage vB_Efae230P-4, complete genome	2061-2090	1	0.967
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	NC_049939	Enterococcus phage vB_EfaP_Ef7.3, complete genome	16846-16875	1	0.967
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	NC_049933	Enterococcus phage vB_EfaP_Ef6.3, complete genome	16088-16117	1	0.967
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	NC_049936	Enterococcus phage vB_EfaP_Efmus3, complete genome	16413-16442	1	0.967
AP018543_2	2.2\|1806619\|30\|AP018543\|CRISPRCasFinder,CRT	1806619-1806648	30	GQ452243	Enterococcus phage phiEf11, complete genome	38671-38700	1	0.967
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	NC_049932	Enterococcus phage vB_EfaP_Ef6.2, complete genome	15933-15962	2	0.933
AP018543_1	1.15\|1560097\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560097-1560126	30	MK721183	Enterococcus phage vB_EfaP_Ef7.2, complete genome	16693-16722	2	0.933
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021878	Enterococcus wangshanyuanii strain MN05 plasmid unnamed5	29373-29402	4	0.867
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	110647-110675	4	0.862
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	199791-199819	4	0.862
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021878	Enterococcus wangshanyuanii strain MN05 plasmid unnamed5	29374-29402	4	0.862
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP044414	Lactobacillus sp. JM1 plasmid unnamed2, complete sequence	4775-4804	5	0.833
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP044414	Lactobacillus sp. JM1 plasmid unnamed2, complete sequence	40965-40994	5	0.833
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP040502	Lactobacillus paragasseri JV-V03 plasmid unnamed2, complete sequence	11394-11423	5	0.833
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	6231-6260	5	0.833
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	14335-14364	5	0.833
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	110646-110675	5	0.833
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	199790-199819	5	0.833
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP010108	Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-2, complete sequence	12768-12796	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	61649-61677	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP044414	Lactobacillus sp. JM1 plasmid unnamed2, complete sequence	4776-4804	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP044414	Lactobacillus sp. JM1 plasmid unnamed2, complete sequence	40966-40994	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP040502	Lactobacillus paragasseri JV-V03 plasmid unnamed2, complete sequence	11395-11423	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	6232-6260	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP008839	Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence	14336-14364	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	1478-1506	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	62498-62526	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP020098	Lactobacillus plantarum strain K25 plasmid unnamed5, complete sequence	31065-31093	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028230	Lactobacillus plantarum strain SRCM101222 plasmid unnamed1, complete sequence	39187-39215	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_021233	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp1, complete sequence	3684-3712	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP025692	Lactobacillus plantarum strain IRG1 plasmid pIRG102, complete sequence	23282-23310	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	53154-53182	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028248	Pediococcus acidilactici strain SRCM102731 plasmid unnamed1, complete sequence	35477-35505	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP016272	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp2, complete sequence	32908-32936	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP032361	Lactobacillus plantarum strain ZFM55 plasmid unnamed2, complete sequence	17157-17185	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP017382	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-3, complete sequence	6213-6241	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_018611	Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-3, complete sequence	14021-14049	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP017410	Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence	20232-20260	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	51586-51614	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP050807	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence	26261-26289	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP022292	Lactobacillus plantarum strain DSR_M2 plasmid pDSRM201, complete sequence	6902-6930	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP024059	Lactobacillus plantarum strain KACC 92189 plasmid unnamed1	30172-30200	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035028	Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pC, complete sequence	32250-32278	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP014624	Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence	10499-10527	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035023	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pC	32251-32279	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP046264	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_02, complete sequence	27304-27332	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP020095	Lactobacillus plantarum strain K25 plasmid unnamed2, complete sequence	13143-13171	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP018765	Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence	2577-2605	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP032644	Lactobacillus plantarum strain ZFM9 plasmid unnamed2, complete sequence	5702-5730	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP012123	Lactobacillus plantarum strain LZ95 plasmid LZ95p1, complete sequence	34468-34496	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_021518	Lactobacillus plantarum 16 plasmid Lp16F, complete sequence	16012-16040	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035147	Lactobacillus plantarum strain SRCM103357 plasmid unnamed4	38307-38335	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028224	Lactobacillus plantarum strain SRCM101105 plasmid unnamed2, complete sequence	20140-20168	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035135	Lactobacillus plantarum strain SRCM103311 plasmid unnamed4	5261-5289	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035135	Lactobacillus plantarum strain SRCM103311 plasmid unnamed4	92757-92785	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP017955	Lactobacillus plantarum strain C410L1 plasmid unnamed1, complete sequence	667-695	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP023176	Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2B, complete sequence	53916-53944	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP025417	Lactobacillus plantarum strain X7021 plasmid unnamed5, complete sequence	44452-44480	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP046662	Lactobacillus plantarum strain 83-18 plasmid p83-18.2, complete sequence	27704-27732	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028335	Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence	41605-41633	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028335	Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence	42150-42178	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028978	Lactobacillus plantarum strain LQ80 plasmid pLQ801, complete sequence	51834-51862	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP015858	Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence	38040-38068	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP015858	Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence	38585-38613	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP013754	Lactobacillus plantarum strain DF plasmid unnamed1, complete sequence	41853-41881	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP032745	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence	18533-18561	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP023491	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence	20357-20385	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP023491	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence	20902-20930	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	38959-38987	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	39504-39532	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035114	Lactobacillus plantarum strain SRCM103295 plasmid unnamed1	12820-12848	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP046263	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence	59318-59346	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP046263	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence	61340-61368	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP013750	Lactobacillus plantarum strain KP plasmid unnamed1, complete sequence	60030-60058	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP012657	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence	36695-36723	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP017956	Lactobacillus plantarum strain C410L1 plasmid unnamed2, complete sequence	15446-15474	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP026506	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence	19763-19791	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP026506	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence	20308-20336	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_021519	Lactobacillus plantarum 16 plasmid Lp16H, complete sequence	57600-57628	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_021527	Lactobacillus plantarum 16 plasmid Lp16G, complete sequence	26634-26662	5	0.828
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP040376	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed2, complete sequence	12393-12421	5	0.828
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	9609-9638	5	0.833
AP018543_1	1.1\|1559173\|30\|AP018543\|CRISPRCasFinder,CRT	1559173-1559202	30	NZ_CP015586	Roseomonas gilardii strain U14-5 plasmid 2, complete sequence	46085-46114	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	61648-61677	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	1477-1506	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	62497-62526	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP020098	Lactobacillus plantarum strain K25 plasmid unnamed5, complete sequence	31065-31094	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028230	Lactobacillus plantarum strain SRCM101222 plasmid unnamed1, complete sequence	39187-39216	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_021233	Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp1, complete sequence	3683-3712	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP025692	Lactobacillus plantarum strain IRG1 plasmid pIRG102, complete sequence	23281-23310	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	53154-53183	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028248	Pediococcus acidilactici strain SRCM102731 plasmid unnamed1, complete sequence	35476-35505	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP016272	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp2, complete sequence	32907-32936	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP032361	Lactobacillus plantarum strain ZFM55 plasmid unnamed2, complete sequence	17156-17185	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP017382	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-3, complete sequence	6212-6241	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_018611	Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-3, complete sequence	14020-14049	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP017410	Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence	20231-20260	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028236	Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence	51585-51614	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP050807	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence	26260-26289	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP022292	Lactobacillus plantarum strain DSR_M2 plasmid pDSRM201, complete sequence	6901-6930	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP024059	Lactobacillus plantarum strain KACC 92189 plasmid unnamed1	30172-30201	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035028	Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pC, complete sequence	32250-32279	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP014624	Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence	10499-10528	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035023	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pC	32251-32280	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP046264	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_02, complete sequence	27304-27333	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP020095	Lactobacillus plantarum strain K25 plasmid unnamed2, complete sequence	13143-13172	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP018765	Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence	2577-2606	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP032644	Lactobacillus plantarum strain ZFM9 plasmid unnamed2, complete sequence	5702-5731	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP012123	Lactobacillus plantarum strain LZ95 plasmid LZ95p1, complete sequence	34468-34497	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_021518	Lactobacillus plantarum 16 plasmid Lp16F, complete sequence	16012-16041	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035147	Lactobacillus plantarum strain SRCM103357 plasmid unnamed4	38307-38336	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028224	Lactobacillus plantarum strain SRCM101105 plasmid unnamed2, complete sequence	20140-20169	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035135	Lactobacillus plantarum strain SRCM103311 plasmid unnamed4	5260-5289	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035135	Lactobacillus plantarum strain SRCM103311 plasmid unnamed4	92756-92785	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP017955	Lactobacillus plantarum strain C410L1 plasmid unnamed1, complete sequence	666-695	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP023176	Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2B, complete sequence	53915-53944	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP025417	Lactobacillus plantarum strain X7021 plasmid unnamed5, complete sequence	44451-44480	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP046662	Lactobacillus plantarum strain 83-18 plasmid p83-18.2, complete sequence	27703-27732	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028335	Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence	41604-41633	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028335	Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence	42149-42178	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028978	Lactobacillus plantarum strain LQ80 plasmid pLQ801, complete sequence	51834-51863	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP015858	Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence	38040-38069	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP015858	Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence	38585-38614	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP013754	Lactobacillus plantarum strain DF plasmid unnamed1, complete sequence	41853-41882	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP032745	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence	18533-18562	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP023491	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence	20357-20386	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP023491	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence	20902-20931	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	38959-38988	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035021	Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA	39504-39533	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035114	Lactobacillus plantarum strain SRCM103295 plasmid unnamed1	12820-12849	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP046263	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence	59318-59347	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP046263	Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence	61340-61369	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP013750	Lactobacillus plantarum strain KP plasmid unnamed1, complete sequence	60030-60059	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP012657	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence	36695-36724	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP017956	Lactobacillus plantarum strain C410L1 plasmid unnamed2, complete sequence	15446-15475	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP026506	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence	19763-19792	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP026506	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence	20308-20337	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_021519	Lactobacillus plantarum 16 plasmid Lp16H, complete sequence	57600-57629	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_021527	Lactobacillus plantarum 16 plasmid Lp16G, complete sequence	26634-26663	6	0.8
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP040376	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed2, complete sequence	12393-12422	6	0.8
AP018543_1	1.5\|1559437\|30\|AP018543\|CRISPRCasFinder,CRT	1559437-1559466	30	MK672802	Vibrio phage Va_90-11-286_p16, complete genome	14350-14379	6	0.8
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	NZ_LR134428	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 19	56225-56254	6	0.8
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP019031	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence	1869-1897	6	0.793
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_KM063576	Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence	7850-7878	6	0.793
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	63260-63289	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	57841-57870	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	81154-81183	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	59111-59140	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	136470-136499	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	115946-115975	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	54239-54268	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	100246-100275	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	63168-63197	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	32691-32720	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	57320-57349	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	146678-146707	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	80274-80303	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	142762-142791	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_014331	Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence	142990-143019	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	79644-79673	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	142735-142764	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	143058-143087	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	142735-142764	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	142390-142419	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	142670-142699	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	142999-143028	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	9992-10021	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	142735-142764	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	142717-142746	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP008847	Bacillus anthracis strain HYU01 plasmid pX01, complete sequence	142943-142972	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	142856-142885	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	142819-142848	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP029806	Bacillus anthracis strain London_499 plasmid pX01, complete sequence	141722-141751	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NC_017726	Bacillus anthracis str. H9401 plasmid BAP1, complete sequence	142759-142788	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	142735-142764	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	116391-116420	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	113900-113929	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	82223-82252	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	47603-47632	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	29164-29193	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	180573-180602	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	4781-4810	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	142789-142818	6	0.8
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	142821-142850	6	0.8
AP018543_1	1.16\|1560163\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560163-1560191	29	MK448893	Streptococcus phage Javan270, complete genome	32253-32281	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	16994-17022	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	18432-18460	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	2466-2494	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	75712-75740	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP033889	Lactobacillus plantarum strain LMT1-48 plasmid p_1, complete sequence	20392-20420	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	43560-43588	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	19298-19326	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	25779-25807	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035177	Lactobacillus plantarum strain SRCM103426 plasmid unnamed3	1114-1142	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	17923-17951	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_020826	Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence	6056-6084	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	161988-162016	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	161987-162015	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	46512-46540	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	28194-28222	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP025993	Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	49542-49570	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	161809-161837	6	0.793
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	6616-6644	6	0.793
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	NZ_AF135182	Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence	96470-96498	6	0.793
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	NC_002523	Serratia entomophila plasmid pADAP, complete sequence	96032-96060	6	0.793
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	MT774376	CrAssphage cr55_1, complete genome	57895-57923	6	0.793
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	MT774380	CrAssphage cr1_1, complete genome	61482-61510	6	0.793
AP018543_2	2.2\|1806619\|30\|AP018543\|CRISPRCasFinder,CRT	1806619-1806648	30	NZ_CP045411	Roseovarius sp. THAF8 plasmid pTHAF8_a, complete sequence	55890-55919	6	0.8
AP018543_2	2.2\|1806619\|30\|AP018543\|CRISPRCasFinder,CRT	1806619-1806648	30	NZ_CP045394	Roseovarius sp. THAF27 plasmid pTHAF27_a, complete sequence	57177-57206	6	0.8
AP018543_1	1.3\|1559305\|30\|AP018543\|CRISPRCasFinder,CRT	1559305-1559334	30	MN692986	Marine virus AFVG_117M62, complete genome	77228-77257	7	0.767
AP018543_1	1.3\|1559305\|30\|AP018543\|CRISPRCasFinder,CRT	1559305-1559334	30	NC_003276	Nostoc sp. PCC 7120 = FACHB-418 plasmid pCC7120alpha, complete sequence	338356-338385	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	16994-17023	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	18432-18461	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021876	Enterococcus wangshanyuanii strain MN05 plasmid unnamed3	2466-2495	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035175	Lactobacillus plantarum strain SRCM103426 plasmid unnamed1	75711-75740	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP033889	Lactobacillus plantarum strain LMT1-48 plasmid p_1, complete sequence	20391-20420	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	43560-43589	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	19298-19327	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_018265	Melissococcus plutonius DAT561 plasmid 1, complete sequence	25779-25808	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035177	Lactobacillus plantarum strain SRCM103426 plasmid unnamed3	1114-1143	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP040375	Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence	17923-17952	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_020826	Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence	6056-6085	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP006684	Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence	161987-162016	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_AP021886	Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence	161986-162015	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021471	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence	46511-46540	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP014878	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence	28193-28222	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP025993	Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	49541-49570	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_AP018525	Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence	161808-161837	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_013543	Lactobacillus paracasei subsp. paracasei plasmid pCD01, complete sequence	18326-18355	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP014904	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence	6616-6645	7	0.767
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	NZ_AF135182	Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence	96470-96499	7	0.767
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	NC_002523	Serratia entomophila plasmid pADAP, complete sequence	96032-96061	7	0.767
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	MT774376	CrAssphage cr55_1, complete genome	57894-57923	7	0.767
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	MT774380	CrAssphage cr1_1, complete genome	61481-61510	7	0.767
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	MF327009	Shigella phage Sf25, complete genome	141743-141772	7	0.767
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	MK448921	Streptococcus phage Javan374, complete genome	13422-13451	7	0.767
AP018543_1	1.10\|1559767\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559767-1559796	30	NZ_CP014286	Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence	9917-9946	7	0.767
AP018543_1	1.10\|1559767\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559767-1559796	30	NZ_CP032610	Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence	3937-3966	7	0.767
AP018543_1	1.10\|1559767\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559767-1559796	30	NZ_CP032610	Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence	58141-58170	7	0.767
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP042406	Leuconostoc mesenteroides strain CBA3628 plasmid unnamed2, complete sequence	18465-18493	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028252	Leuconostoc mesenteroides strain SRCM102733 plasmid unnamed1, complete sequence	23066-23094	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP046064	Leuconostoc mesenteroides subsp. mesenteroides strain CBA3607 plasmid unnamed2, complete sequence	11759-11787	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021967	Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713101, complete sequence	1517-1545	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035747	Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed1, complete sequence	1123-1151	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_LT996085	Lactobacillus acidipiscis strain ACA-DC 1533 plasmid pLAC2, complete sequence	11110-11138	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP018181	Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-1, complete sequence	53421-53449	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035141	Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed2, complete sequence	15219-15247	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028256	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed1, complete sequence	23587-23615	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_018699	Leuconostoc carnosum JB16 plasmid pKLC4, complete sequence	26137-26165	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021492	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed1, complete sequence	33231-33259	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035272	Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence	18120-18148	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035272	Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence	24454-24482	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_008496	Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 plasmid pLEUM1, complete sequence	13556-13584	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP045036	Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence	26106-26134	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP045036	Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence	34368-34396	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP045036	Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence	3379-3407	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP018177	Lactobacillus hordei strain TMW 1.1822 plasmid pL11822-1, complete sequence	21518-21546	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_010467	Leuconostoc citreum KM20 plasmid pLCK3, complete sequence	8317-8345	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035140	Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed1, complete sequence	27693-27721	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	6339-6367	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP013756	Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence	24281-24309	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP042422	Leuconostoc lactis strain CBA3622 plasmid unnamed2, complete sequence	2211-2239	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021494	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed3, complete sequence	18708-18736	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP013150	Lactobacillus plantarum strain MF1298 plasmid pMF1298-1, complete sequence	61955-61983	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP035749	Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence	21538-21566	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP050806	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence	1883-1911	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_014131	Leuconostoc kimchii IMSNU 11154 plasmid LkipL4701, complete sequence	17905-17933	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NC_015756	Weissella koreensis KACC 15510 plasmid WKp2903, complete sequence	15468-15496	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP017997	Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence	4784-4812	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP017376	Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence	6190-6218	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP042384	Leuconostoc pseudomesenteroides strain CBA3630 plasmid unnamed1, complete sequence	16623-16651	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021931	Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence	44608-44636	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028257	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence	6079-6107	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP028258	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence	13755-13783	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP018797	Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence	23757-23785	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP013752	Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence	21246-21274	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP021493	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed2, complete sequence	2346-2374	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP016599	Leuconostoc lactis strain WiKim40 plasmid pWK40-1, complete sequence	12793-12821	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP023177	Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence	31679-31707	7	0.759
AP018543_1	1.17\|1559371\|29\|AP018543\|PILER-CR	1559371-1559399	29	NZ_CP042415	Leuconostoc citreum strain CBA3624 plasmid unnamed2, complete sequence	31303-31331	7	0.759
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	NC_009035	Shewanella baltica OS155 plasmid pSbal01, complete sequence	106647-106675	7	0.759
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	MK448924	Streptococcus phage Javan384, complete genome	26576-26604	7	0.759
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	MK448723	Streptococcus phage Javan271, complete genome	25415-25443	7	0.759
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	MK448921	Streptococcus phage Javan374, complete genome	13422-13450	7	0.759
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP024317	Borrelia miyamotoi strain Yekat-6 plasmid pYkt6-lp72, complete sequence	28302-28331	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP024391	Borrelia miyamotoi strain Izh-4 plasmid pIzh4-lp72, complete sequence	45218-45247	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP024206	Borrelia miyamotoi strain Izh-5 plasmid pIzh5-lp72, complete sequence	28307-28336	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP024334	Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp72, complete sequence	44078-44107	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP024352	Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp72, complete sequence	28318-28347	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP024372	Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp72, complete sequence	28296-28325	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_LR215002	Mycoplasma conjunctivae strain NCTC10147 plasmid 6	8283-8312	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP013139	Pseudoalteromonas sp. Bsw20308 plasmid pPBSW1, complete sequence	293850-293879	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	LR214958	Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 4	5345-5374	7	0.767
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	LR214961	Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 7	6710-6739	7	0.767
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP042406	Leuconostoc mesenteroides strain CBA3628 plasmid unnamed2, complete sequence	18464-18493	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028252	Leuconostoc mesenteroides strain SRCM102733 plasmid unnamed1, complete sequence	23065-23094	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP046064	Leuconostoc mesenteroides subsp. mesenteroides strain CBA3607 plasmid unnamed2, complete sequence	11758-11787	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021967	Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713101, complete sequence	1516-1545	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035747	Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed1, complete sequence	1122-1151	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_LT996085	Lactobacillus acidipiscis strain ACA-DC 1533 plasmid pLAC2, complete sequence	11109-11138	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP018181	Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-1, complete sequence	53420-53449	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035141	Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed2, complete sequence	15219-15248	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028256	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed1, complete sequence	23587-23616	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_018699	Leuconostoc carnosum JB16 plasmid pKLC4, complete sequence	26137-26166	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021492	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed1, complete sequence	33231-33260	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035272	Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence	18120-18149	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035272	Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence	24454-24483	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_008496	Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 plasmid pLEUM1, complete sequence	13556-13585	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP045036	Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence	26106-26135	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP045036	Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence	34368-34397	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP045036	Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence	3379-3408	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP018177	Lactobacillus hordei strain TMW 1.1822 plasmid pL11822-1, complete sequence	21518-21547	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_010467	Leuconostoc citreum KM20 plasmid pLCK3, complete sequence	8316-8345	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035140	Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed1, complete sequence	27692-27721	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035572	Lactobacillus plantarum strain SRCM103303 plasmid unnamed1	6338-6367	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP013756	Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence	24280-24309	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP042422	Leuconostoc lactis strain CBA3622 plasmid unnamed2, complete sequence	2210-2239	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021494	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed3, complete sequence	18707-18736	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP013150	Lactobacillus plantarum strain MF1298 plasmid pMF1298-1, complete sequence	61954-61983	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP035749	Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence	21537-21566	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP050806	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence	1882-1911	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_014131	Leuconostoc kimchii IMSNU 11154 plasmid LkipL4701, complete sequence	17904-17933	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NC_015756	Weissella koreensis KACC 15510 plasmid WKp2903, complete sequence	15467-15496	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP017997	Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence	4784-4813	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP017376	Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence	6190-6219	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP042384	Leuconostoc pseudomesenteroides strain CBA3630 plasmid unnamed1, complete sequence	16623-16652	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021931	Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence	44608-44637	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028257	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence	6079-6108	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP028258	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence	13755-13784	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP018797	Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence	23757-23786	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP013752	Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence	21246-21275	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP021493	Leuconostoc mesenteroides strain WiKim33 plasmid unnamed2, complete sequence	2346-2375	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP016599	Leuconostoc lactis strain WiKim40 plasmid pWK40-1, complete sequence	12793-12822	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP023177	Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence	31679-31708	8	0.733
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP042415	Leuconostoc citreum strain CBA3624 plasmid unnamed2, complete sequence	31303-31332	8	0.733
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	NC_009035	Shewanella baltica OS155 plasmid pSbal01, complete sequence	106646-106675	8	0.733
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	MK448924	Streptococcus phage Javan384, complete genome	26576-26605	8	0.733
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	MK448723	Streptococcus phage Javan271, complete genome	25415-25444	8	0.733
AP018543_1	1.7\|1559569\|30\|AP018543\|CRISPRCasFinder,CRT	1559569-1559598	30	MG720309	Vibrio phage Ares1, complete genome	38670-38699	8	0.733
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP028862	Borreliella garinii strain 20047 plasmid lp54, complete sequence	23399-23427	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP017218	Borreliella burgdorferi strain B331 plasmid B331_lp54, complete sequence	22300-22328	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NC_017804	Borreliella garinii BgVir plasmid lp54, complete sequence	23614-23642	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP018745	Borreliella garinii strain CIP 103362 isolate 20047 plasmid p_lp54_linear	34061-34089	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP031397	Borreliella burgdorferi strain MM1 plasmid plsm_lp54, complete sequence	31565-31593	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP019854	Borreliella burgdorferi plasmid lp54, complete sequence	31467-31495	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP019765	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp54, complete sequence	31467-31495	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP015809	Borrelia mayonii strain MN14-1539 plasmid lp54	31895-31923	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NC_011784	Borreliella burgdorferi ZS7 plasmid ZS7_lp54, complete sequence	31412-31440	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NC_013130	Borreliella burgdorferi N40 plasmid N40_lp54, complete sequence	31477-31505	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NZ_CP015795	Borrelia mayonii strain MN14-1420 plasmid lp54, complete sequence	31911-31939	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NC_013128	Borrelia burgdorferi 297 plasmid 297_lp54, complete sequence	29227-29255	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NC_013129	Borreliella burgdorferi JD1 plasmid JD1_lp54, complete sequence	31418-31446	8	0.724
AP018543_1	1.12\|1559900\|29\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559900-1559928	29	NC_001857	Borreliella burgdorferi B31 plasmid lp54, complete sequence	31467-31495	8	0.724
AP018543_1	1.13\|1559965\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559965-1559994	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	538056-538085	8	0.733
AP018543_1	1.13\|1559965\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1559965-1559994	30	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	55272-55301	8	0.733
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP042810	Acetobacter oryzoeni strain B6 plasmid unnamed2, complete sequence	47562-47591	8	0.733
AP018543_1	1.14\|1560031\|30\|AP018543\|CRISPRCasFinder,CRT,PILER-CR	1560031-1560060	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	162384-162413	8	0.733
AP018543_1	1.19\|1559503\|29\|AP018543\|PILER-CR	1559503-1559531	29	NC_018276	Croceibacter phage P2559S, complete genome	35664-35692	8	0.724
AP018543_2	2.1\|1806553\|30\|AP018543\|CRISPRCasFinder,CRT	1806553-1806582	30	NZ_CP011038	Pseudoalteromonas nigrifaciens strain KMM 661 plasmid unnamed, complete sequence	33388-33417	8	0.733
AP018543_1	1.2\|1559239\|30\|AP018543\|CRISPRCasFinder,CRT	1559239-1559268	30	NC_014533	Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence	810232-810261	9	0.7
AP018543_1	1.4\|1559371\|30\|AP018543\|CRISPRCasFinder,CRT	1559371-1559400	30	NZ_CP023393	Lactococcus raffinolactis strain WiKim0068 plasmid pWiKim0068-1, complete sequence	36890-36919	9	0.7
AP018543_1	1.6\|1559503\|30\|AP018543\|CRISPRCasFinder,CRT	1559503-1559532	30	NC_018276	Croceibacter phage P2559S, complete genome	35664-35693	9	0.7
AP018543_2	2.3\|1806685\|30\|AP018543\|CRISPRCasFinder,CRT	1806685-1806714	30	NC_047893	Escherichia phage DTL, complete genome	9977-10006	9	0.7

1. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to MT757399 (Enterococcus phage AE4_17, complete genome) position: , mismatch: 0, identity: 1.0

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcattgaatag	Protospacer
******************************

2. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to MK721197 (Enterococcus phage vB_EfaP_Efmus2, complete genome) position: , mismatch: 0, identity: 1.0

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcattgaatag	Protospacer
******************************

3. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to MT747434 (Enterococcus phage ZEF1, complete genome) position: , mismatch: 0, identity: 1.0

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcattgaatag	Protospacer
******************************

4. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to LT630001 (Enterococcus phage Idefix genome assembly, chromosome: IDF) position: , mismatch: 0, identity: 1.0

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcattgaatag	Protospacer
******************************

5. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to MK721195 (Enterococcus phage vB_EfaP_Efmus1, complete genome) position: , mismatch: 0, identity: 1.0

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcattgaatag	Protospacer
******************************

6. spacer 2.2|1806619|30|AP018543|CRISPRCasFinder,CRT matches to GQ478087 (Enterococcus phage phiFL3B, complete genome) position: , mismatch: 0, identity: 1.0

tcgacttgccttcctaagatataaacttct	CRISPR spacer
tcgacttgccttcctaagatataaacttct	Protospacer
******************************

7. spacer 2.2|1806619|30|AP018543|CRISPRCasFinder,CRT matches to NC_013648 (Enterococcus phage phiFL3A, complete genome) position: , mismatch: 0, identity: 1.0

tcgacttgccttcctaagatataaacttct	CRISPR spacer
tcgacttgccttcctaagatataaacttct	Protospacer
******************************

8. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to JQ309827 (Enterococcus phage vB_Efae230P-4, complete genome) position: , mismatch: 1, identity: 0.967

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaagggctgattgctttcattgaatag	Protospacer
********.*********************

9. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_049939 (Enterococcus phage vB_EfaP_Ef7.3, complete genome) position: , mismatch: 1, identity: 0.967

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactaattgctttcattgaatag	Protospacer
***********.******************

10. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_049933 (Enterococcus phage vB_EfaP_Ef6.3, complete genome) position: , mismatch: 1, identity: 0.967

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgatagctttcattgaatag	Protospacer
************** ***************

11. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_049936 (Enterococcus phage vB_EfaP_Efmus3, complete genome) position: , mismatch: 1, identity: 0.967

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcattgagtag	Protospacer
**************************.***

12. spacer 2.2|1806619|30|AP018543|CRISPRCasFinder,CRT matches to GQ452243 (Enterococcus phage phiEf11, complete genome) position: , mismatch: 1, identity: 0.967

tcgacttgccttcctaagatataaacttct	CRISPR spacer
tcaacttgccttcctaagatataaacttct	Protospacer
**.***************************

13. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_049932 (Enterococcus phage vB_EfaP_Ef6.2, complete genome) position: , mismatch: 2, identity: 0.933

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactgattgctttcatagagtag	Protospacer
*********************** **.***

14. spacer 1.15|1560097|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to MK721183 (Enterococcus phage vB_EfaP_Ef7.2, complete genome) position: , mismatch: 2, identity: 0.933

tagaaaggactgattgctttcattgaatag	CRISPR spacer
tagaaaggactaattgctttcattgagtag	Protospacer
***********.**************.***

15. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021878 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed5) position: , mismatch: 4, identity: 0.867

taagtaa-gtagaaaagttatggcggtggcg	CRISPR spacer
-aatcaatgtagaaaagttatgacggtggcg	Protospacer
 ** .** **************.********

16. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 4, identity: 0.862

taagtaa-gtagaaaagttatggcggtggc	CRISPR spacer
-aatcaatgtagaaaagttatgacggtggc	Protospacer
 ** .** **************.*******

17. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 4, identity: 0.862

taagtaa-gtagaaaagttatggcggtggc	CRISPR spacer
-aatcaatgtagaaaagttatgacggtggc	Protospacer
 ** .** **************.*******

18. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021878 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed5) position: , mismatch: 4, identity: 0.862

taagtaa-gtagaaaagttatggcggtggc	CRISPR spacer
-aatcaatgtagaaaagttatgacggtggc	Protospacer
 ** .** **************.*******

19. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP044414 (Lactobacillus sp. JM1 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggcg	Protospacer
 .* ********.****** **********

20. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP044414 (Lactobacillus sp. JM1 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggcg	Protospacer
 .* ********.****** **********

21. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP040502 (Lactobacillus paragasseri JV-V03 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggcg	Protospacer
 .* ********.****** **********

22. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 5, identity: 0.833

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggcg	Protospacer
 .* ********.****** **********

23. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 5, identity: 0.833

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggcg	Protospacer
 .* ********.****** **********

24. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 5, identity: 0.833

taagtaa-gtagaaaagttatggcggtggcg	CRISPR spacer
-aatcaatgtagaaaagttatgacggtggct	Protospacer
 ** .** **************.*******

25. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 5, identity: 0.833

taagtaa-gtagaaaagttatggcggtggcg	CRISPR spacer
-aatcaatgtagaaaagttatgacggtggct	Protospacer
 ** .** **************.*******

26. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010108 (Bacillus thuringiensis serovar indiana strain HD521 plasmid pBTHD521-2, complete sequence) position: , mismatch: 5, identity: 0.828

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
tggttaaaaagaaagccatcagataaaaa	Protospacer
***********.*********.* *.* *

27. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

28. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP044414 (Lactobacillus sp. JM1 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

29. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP044414 (Lactobacillus sp. JM1 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

30. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP040502 (Lactobacillus paragasseri JV-V03 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

31. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

32. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP008839 (Lactobacillus gasseri DSM 14869 plasmid pEB01-1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

33. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

34. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

35. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP020098 (Lactobacillus plantarum strain K25 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

36. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028230 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggattaagtagagaagttaaggcggtggc	Protospacer
 .* ********.****** *********

37. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_021233 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

38. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP025692 (Lactobacillus plantarum strain IRG1 plasmid pIRG102, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

39. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

40. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028248 (Pediococcus acidilactici strain SRCM102731 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

41. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP016272 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

42. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP032361 (Lactobacillus plantarum strain ZFM55 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

43. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP017382 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-3, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

44. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_018611 (Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-3, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

45. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP017410 (Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

46. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

47. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP050807 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

48. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP022292 (Lactobacillus plantarum strain DSR_M2 plasmid pDSRM201, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

49. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP024059 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed1) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

50. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035028 (Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pC, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

51. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP014624 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

52. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035023 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pC) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

53. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP046264 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_02, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

54. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP020095 (Lactobacillus plantarum strain K25 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

55. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP018765 (Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

56. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP032644 (Lactobacillus plantarum strain ZFM9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

57. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP012123 (Lactobacillus plantarum strain LZ95 plasmid LZ95p1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

58. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_021518 (Lactobacillus plantarum 16 plasmid Lp16F, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

59. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035147 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed4) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

60. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028224 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcaagtagagaagttaaggcggtggc	Protospacer
 ** .*******.****** *********

61. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035135 (Lactobacillus plantarum strain SRCM103311 plasmid unnamed4) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

62. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035135 (Lactobacillus plantarum strain SRCM103311 plasmid unnamed4) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

63. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP017955 (Lactobacillus plantarum strain C410L1 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

64. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP023176 (Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2B, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

65. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP025417 (Lactobacillus plantarum strain X7021 plasmid unnamed5, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

66. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP046662 (Lactobacillus plantarum strain 83-18 plasmid p83-18.2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

67. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028335 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

68. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028335 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

69. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028978 (Lactobacillus plantarum strain LQ80 plasmid pLQ801, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

70. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP015858 (Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

71. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP015858 (Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

72. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP013754 (Lactobacillus plantarum strain DF plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

73. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP032745 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

74. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP023491 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

75. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP023491 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

76. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

77. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

78. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035114 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed1) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

79. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP046263 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

80. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP046263 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

81. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP013750 (Lactobacillus plantarum strain KP plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

82. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP012657 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

83. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP017956 (Lactobacillus plantarum strain C410L1 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

84. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP026506 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

85. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP026506 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

86. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_021519 (Lactobacillus plantarum 16 plasmid Lp16H, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

87. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_021527 (Lactobacillus plantarum 16 plasmid Lp16G, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

88. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP040376 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatgctagtagagaagttaaggcggtggc	Protospacer
** *. ******.****** *********

89. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 5, identity: 0.833

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttttatcatttaatgcaatacctata	Protospacer
************.********** .**  *

90. spacer 1.1|1559173|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP015586 (Roseomonas gilardii strain U14-5 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.8

catggactgcaacaacttacgacgacacgt	CRISPR spacer
catggactgcaacaagtgacgacatgacgg	Protospacer
*************** * *****.  ***

91. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggct	Protospacer
 .* ********.****** *********

92. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggct	Protospacer
 .* ********.****** *********

93. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggct	Protospacer
 .* ********.****** *********

94. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP020098 (Lactobacillus plantarum strain K25 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggct	Protospacer
 .* ********.****** *********

95. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028230 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggattaagtagagaagttaaggcggtggct	Protospacer
 .* ********.****** *********

96. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_021233 (Lactobacillus plantarum subsp. plantarum P-8 plasmid LBPp1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

97. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP025692 (Lactobacillus plantarum strain IRG1 plasmid pIRG102, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

98. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

99. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028248 (Pediococcus acidilactici strain SRCM102731 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

100. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP016272 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

101. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP032361 (Lactobacillus plantarum strain ZFM55 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

102. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP017382 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-3, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

103. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_018611 (Lactobacillus buchneri subsp. silagei CD034 plasmid pCD034-3, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

104. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP017410 (Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

105. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028236 (Lactobacillus plantarum strain SRCM101511 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

106. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP050807 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP511, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

107. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP022292 (Lactobacillus plantarum strain DSR_M2 plasmid pDSRM201, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

108. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024059 (Lactobacillus plantarum strain KACC 92189 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

109. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035028 (Lactobacillus plantarum strain YW11 plasmid plsm_YW11_pC, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

110. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP014624 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

111. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035023 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pC) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

112. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP046264 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_02, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

113. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP020095 (Lactobacillus plantarum strain K25 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

114. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP018765 (Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

115. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP032644 (Lactobacillus plantarum strain ZFM9 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

116. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP012123 (Lactobacillus plantarum strain LZ95 plasmid LZ95p1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

117. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_021518 (Lactobacillus plantarum 16 plasmid Lp16F, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

118. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035147 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed4) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

119. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028224 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcaagtagagaagttaaggcggtggct	Protospacer
 ** .*******.****** *********

120. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035135 (Lactobacillus plantarum strain SRCM103311 plasmid unnamed4) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

121. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035135 (Lactobacillus plantarum strain SRCM103311 plasmid unnamed4) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

122. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP017955 (Lactobacillus plantarum strain C410L1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

123. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP023176 (Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2B, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

124. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP025417 (Lactobacillus plantarum strain X7021 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

125. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP046662 (Lactobacillus plantarum strain 83-18 plasmid p83-18.2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

126. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028335 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

127. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028335 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

128. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028978 (Lactobacillus plantarum strain LQ80 plasmid pLQ801, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

129. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP015858 (Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

130. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP015858 (Lactobacillus plantarum strain LZ227 plasmid LZ227p1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

131. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP013754 (Lactobacillus plantarum strain DF plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

132. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP032745 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

133. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP023491 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

134. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP023491 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

135. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

136. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035021 (Lactobacillus plantarum strain 13_3 plasmid plsm_LP12_3_pA) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

137. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035114 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed1) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

138. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP046263 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

139. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP046263 (Lactobacillus plantarum strain KCCP11226 plasmid pKCCP11226_01, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

140. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP013750 (Lactobacillus plantarum strain KP plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

141. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP012657 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK01, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

142. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP017956 (Lactobacillus plantarum strain C410L1 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

143. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP026506 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

144. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP026506 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed1, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

145. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_021519 (Lactobacillus plantarum 16 plasmid Lp16H, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

146. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_021527 (Lactobacillus plantarum 16 plasmid Lp16G, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

147. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP040376 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatgctagtagagaagttaaggcggtggct	Protospacer
** *. ******.****** *********

148. spacer 1.5|1559437|30|AP018543|CRISPRCasFinder,CRT matches to MK672802 (Vibrio phage Va_90-11-286_p16, complete genome) position: , mismatch: 6, identity: 0.8

--aactgattacccacgtcttttacttgtttt	CRISPR spacer
tcaatt--tctcccaagtcttttacttgtttt	Protospacer
  **.*  *. **** ****************

149. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to NZ_LR134428 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 19) position: , mismatch: 6, identity: 0.8

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
atgaaatcaaaaaaacctataaaaaagctt	Protospacer
***. *. .*****.***************

150. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019031 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence) position: , mismatch: 6, identity: 0.793

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
aactaaaaaaggaagccatcaaggcgaca	Protospacer
 . * *****************.* ****

151. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KM063576 (Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence) position: , mismatch: 6, identity: 0.793

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
aactaaaaaaggaagccatcaaggcgaca	Protospacer
 . * *****************.* ****

152. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

153. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

154. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

155. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

156. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

157. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

158. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

159. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

160. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

161. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

162. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

163. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

164. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

165. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

166. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_014331 (Bacillus cereus biovar anthracis str. CI plasmid pCI-XO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

167. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

168. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

169. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

170. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

171. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

172. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

173. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

174. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

175. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

176. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

177. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP008847 (Bacillus anthracis strain HYU01 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

178. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

179. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

180. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP029806 (Bacillus anthracis strain London_499 plasmid pX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

181. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_017726 (Bacillus anthracis str. H9401 plasmid BAP1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

182. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

183. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

184. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

185. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

186. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

187. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

188. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

189. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

190. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

191. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 6, identity: 0.8

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
ttatgtgtatgctgttactaaagaagattt	Protospacer
**  *.***********.*******.***.

192. spacer 1.16|1560163|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to MK448893 (Streptococcus phage Javan270, complete genome) position: , mismatch: 6, identity: 0.793

aggttgacctgttaataaagaaagctctg	CRISPR spacer
atggatacccgttaataaagaaatctctg	Protospacer
* *   ***.************* *****

193. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttaagtagagaagttaaggcggtggc	Protospacer
 .  ********.****** *********

194. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttaagtagagaagttaaggcggtggc	Protospacer
 .  ********.****** *********

195. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ataaaaagtagaaagtttatggcggtggc	Protospacer
  *. *********. *************

196. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaaacttgtagaaaagttaaggcggtggc	Protospacer
 **..  ************ *********

197. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP033889 (Lactobacillus plantarum strain LMT1-48 plasmid p_1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatcaagtagagaagttaaggcggtggc	Protospacer
 .* .*******.****** *********

198. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatacctgtagaaaagttatgccggtggc	Protospacer
** ..  ************** *******

199. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tagaagagtagaaaagttatgatggtggc	Protospacer
**.. .***************..******

200. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tagaagagtagaaaagttatgatggtggc	Protospacer
**.. .***************..******

201. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035177 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed3) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
aaaacttgtagaaaagttaaggcggtggc	Protospacer
 **..  ************ *********

202. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggatcaagtagagaagttaaggcggtggc	Protospacer
 .* .*******.****** *********

203. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_020826 (Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggatcaagtagagaagttaaggcggtggc	Protospacer
 .* .*******.****** *********

204. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tagaagagtagaaaagttatgatggtggc	Protospacer
**.. .***************..******

205. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tagaagagtagaaaagttatgatggtggc	Protospacer
**.. .***************..******

206. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcgagtagagaagttaaggcggtggc	Protospacer
 ** ..******.****** *********

207. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP014878 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcgagtagagaagttaaggcggtggc	Protospacer
 ** ..******.****** *********

208. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP025993 (Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tatactagtagagaagttaaggcggtggc	Protospacer
** .. ******.****** *********

209. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
tagaagagtagaaaagttatgatggtggc	Protospacer
**.. .***************..******

210. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP014904 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence) position: , mismatch: 6, identity: 0.793

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
gaatcgagtagagaagttaaggcggtggc	Protospacer
 ** ..******.****** *********

211. spacer 1.19|1559503|29|AP018543|PILER-CR matches to NZ_AF135182 (Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence) position: , mismatch: 6, identity: 0.793

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
acgaagcagaaaaagccaataaaaaagcc	Protospacer
*.*. .*********** **********.

212. spacer 1.19|1559503|29|AP018543|PILER-CR matches to NC_002523 (Serratia entomophila plasmid pADAP, complete sequence) position: , mismatch: 6, identity: 0.793

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
acgaagcagaaaaagccaataaaaaagcc	Protospacer
*.*. .*********** **********.

213. spacer 1.19|1559503|29|AP018543|PILER-CR matches to MT774376 (CrAssphage cr55_1, complete genome) position: , mismatch: 6, identity: 0.793

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
tagatgcagaaaaagcttataaaaaagca	Protospacer
  *.*.**********.***********

214. spacer 1.19|1559503|29|AP018543|PILER-CR matches to MT774380 (CrAssphage cr1_1, complete genome) position: , mismatch: 6, identity: 0.793

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
tagatgcagaaaaagcttataaaaaagca	Protospacer
  *.*.**********.***********

215. spacer 2.2|1806619|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP045411 (Roseovarius sp. THAF8 plasmid pTHAF8_a, complete sequence) position: , mismatch: 6, identity: 0.8

tcgac-ttgccttcctaagatataaacttct	CRISPR spacer
-ggacgcagctttcctaagatctaaacttct	Protospacer
  *** . **.********** *********

216. spacer 2.2|1806619|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP045394 (Roseovarius sp. THAF27 plasmid pTHAF27_a, complete sequence) position: , mismatch: 6, identity: 0.8

tcgac-ttgccttcctaagatataaacttct	CRISPR spacer
-ggacgcagctttcctaagatctaaacttct	Protospacer
  *** . **.********** *********

217. spacer 1.3|1559305|30|AP018543|CRISPRCasFinder,CRT matches to MN692986 (Marine virus AFVG_117M62, complete genome) position: , mismatch: 7, identity: 0.767

caatgcctattttgattctatgactacgat	CRISPR spacer
tgaagtatattttgattctatgcctgcgat	Protospacer
..* *. *************** **.****

218. spacer 1.3|1559305|30|AP018543|CRISPRCasFinder,CRT matches to NC_003276 (Nostoc sp. PCC 7120 = FACHB-418 plasmid pCC7120alpha, complete sequence) position: , mismatch: 7, identity: 0.767

caatgcctattttgattctatgactacgat	CRISPR spacer
ctgtgcctatattgattccatgactatcac	Protospacer
* .******* *******.*******. *.

219. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttaagtagagaagttaaggcggtggct	Protospacer
 .  ********.****** *********

220. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttaagtagagaagttaaggcggtggct	Protospacer
 .  ********.****** *********

221. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021876 (Enterococcus wangshanyuanii strain MN05 plasmid unnamed3) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ataaaaagtagaaagtttatggcggtggca	Protospacer
  *. *********. *************.

222. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035175 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaaacttgtagaaaagttaaggcggtggct	Protospacer
 **..  ************ *********

223. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP033889 (Lactobacillus plantarum strain LMT1-48 plasmid p_1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatcaagtagagaagttaaggcggtggct	Protospacer
 .* .*******.****** *********

224. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatacctgtagaaaagttatgccggtggct	Protospacer
** ..  ************** *******

225. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tagaagagtagaaaagttatgatggtggct	Protospacer
**.. .***************..******

226. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_018265 (Melissococcus plutonius DAT561 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tagaagagtagaaaagttatgatggtggct	Protospacer
**.. .***************..******

227. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035177 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed3) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
aaaacttgtagaaaagttaaggcggtggct	Protospacer
 **..  ************ *********

228. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP040375 (Lactobacillus plantarum subsp. plantarum strain BNH17 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggatcaagtagagaagttaaggcggtggct	Protospacer
 .* .*******.****** *********

229. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_020826 (Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggatcaagtagagaagttaaggcggtggct	Protospacer
 .* .*******.****** *********

230. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP006684 (Melissococcus plutonius S1 plasmid pMEPL_178, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tagaagagtagaaaagttatgatggtggct	Protospacer
**.. .***************..******

231. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_AP021886 (Melissococcus plutonius strain DAT1033 plasmid pMP1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tagaagagtagaaaagttatgatggtggct	Protospacer
**.. .***************..******

232. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021471 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcgagtagagaagttaaggcggtggct	Protospacer
 ** ..******.****** *********

233. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP014878 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-5, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcgagtagagaagttaaggcggtggct	Protospacer
 ** ..******.****** *********

234. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP025993 (Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tatactagtagagaagttaaggcggtggct	Protospacer
** .. ******.****** *********

235. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_AP018525 (Melissococcus plutonius strain DAT585 plasmid pMP1, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
tagaagagtagaaaagttatgatggtggct	Protospacer
**.. .***************..******

236. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_013543 (Lactobacillus paracasei subsp. paracasei plasmid pCD01, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
atagcttgtagagaagttaaggcggtggcg	Protospacer
  **.  *****.****** **********

237. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP014904 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-5, complete sequence) position: , mismatch: 7, identity: 0.767

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
gaatcgagtagagaagttaaggcggtggct	Protospacer
 ** ..******.****** *********

238. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to NZ_AF135182 (Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence) position: , mismatch: 7, identity: 0.767

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
acgaagcagaaaaagccaataaaaaagccc	Protospacer
*.*. .*********** **********..

239. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to NC_002523 (Serratia entomophila plasmid pADAP, complete sequence) position: , mismatch: 7, identity: 0.767

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
acgaagcagaaaaagccaataaaaaagccc	Protospacer
*.*. .*********** **********..

240. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to MT774376 (CrAssphage cr55_1, complete genome) position: , mismatch: 7, identity: 0.767

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
tagatgcagaaaaagcttataaaaaagcaa	Protospacer
  *.*.**********.***********

241. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to MT774380 (CrAssphage cr1_1, complete genome) position: , mismatch: 7, identity: 0.767

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
tagatgcagaaaaagcttataaaaaagcaa	Protospacer
  *.*.**********.***********

242. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to MF327009 (Shigella phage Sf25, complete genome) position: , mismatch: 7, identity: 0.767

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
ttgcactagaaaaagcttataaagaagctt	Protospacer
 **   .*********.******.******

243. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to MK448921 (Streptococcus phage Javan374, complete genome) position: , mismatch: 7, identity: 0.767

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
aaaatacagtaagagcctataaaaaaggat	Protospacer
* ..***** **.**************  *

244. spacer 1.10|1559767|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014286 (Bacillus thuringiensis strain Bt185 plasmid pBT1850054, complete sequence) position: , mismatch: 7, identity: 0.767

cttccgatactagtttaaagcaatggaacg	CRISPR spacer
cttccgatactagcttaaagaaatcttaaa	Protospacer
*************.****** ***   * .

245. spacer 1.10|1559767|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032610 (Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence) position: , mismatch: 7, identity: 0.767

cttccgatactagtttaaagcaatggaacg	CRISPR spacer
cttccgatactagcttaaagaaatcttaaa	Protospacer
*************.****** ***   * .

246. spacer 1.10|1559767|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP032610 (Bacillus thuringiensis strain QZL38 plasmid p.3, complete sequence) position: , mismatch: 7, identity: 0.767

cttccgatactagtttaaagcaatggaacg	CRISPR spacer
cttccgatactagcttaaagaaatcttaaa	Protospacer
*************.****** ***   * .

247. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP042406 (Leuconostoc mesenteroides strain CBA3628 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

248. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028252 (Leuconostoc mesenteroides strain SRCM102733 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

249. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP046064 (Leuconostoc mesenteroides subsp. mesenteroides strain CBA3607 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

250. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021967 (Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713101, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

251. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035747 (Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

252. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_LT996085 (Lactobacillus acidipiscis strain ACA-DC 1533 plasmid pLAC2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

253. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP018181 (Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

254. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035141 (Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

255. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028256 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

256. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_018699 (Leuconostoc carnosum JB16 plasmid pKLC4, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

257. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021492 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

258. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035272 (Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

259. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035272 (Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

260. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_008496 (Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 plasmid pLEUM1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

261. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP045036 (Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

262. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP045036 (Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

263. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP045036 (Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

264. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP018177 (Lactobacillus hordei strain TMW 1.1822 plasmid pL11822-1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agttcaagtagagaagttaaggcggtggc	Protospacer
 .  .*******.****** *********

265. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_010467 (Leuconostoc citreum KM20 plasmid pLCK3, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

266. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035140 (Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

267. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

268. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP013756 (Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

269. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP042422 (Leuconostoc lactis strain CBA3622 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

270. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021494 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

271. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP013150 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

272. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP035749 (Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

273. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP050806 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

274. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_014131 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL4701, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

275. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NC_015756 (Weissella koreensis KACC 15510 plasmid WKp2903, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

276. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP017997 (Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

277. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP017376 (Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

278. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP042384 (Leuconostoc pseudomesenteroides strain CBA3630 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

279. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021931 (Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

280. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028257 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

281. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP028258 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

282. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP018797 (Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

283. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP013752 (Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

284. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP021493 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

285. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP016599 (Leuconostoc lactis strain WiKim40 plasmid pWK40-1, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
ggtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

286. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP023177 (Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agatccagtagagaagttaaggcggtggc	Protospacer
 .* . ******.****** *********

287. spacer 1.17|1559371|29|AP018543|PILER-CR matches to NZ_CP042415 (Leuconostoc citreum strain CBA3624 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

taagtaagtagaaaagttatggcggtggc	CRISPR spacer
agtttgagtagagaagttaaggcggtggc	Protospacer
 .  *.******.****** *********

288. spacer 1.19|1559503|29|AP018543|PILER-CR matches to NC_009035 (Shewanella baltica OS155 plasmid pSbal01, complete sequence) position: , mismatch: 7, identity: 0.759

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
gttcataagaaaaagcccataaaaaagct	Protospacer
.*     **********.***********

289. spacer 1.19|1559503|29|AP018543|PILER-CR matches to MK448924 (Streptococcus phage Javan384, complete genome) position: , mismatch: 7, identity: 0.759

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
cgaatgcagaaaaagcatataaaacagct	Protospacer
  ..*.********** ******* ****

290. spacer 1.19|1559503|29|AP018543|PILER-CR matches to MK448723 (Streptococcus phage Javan271, complete genome) position: , mismatch: 7, identity: 0.759

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
caaatgctgaaaaagcctataaaacagct	Protospacer
  ..*.* **************** ****

291. spacer 1.19|1559503|29|AP018543|PILER-CR matches to MK448921 (Streptococcus phage Javan374, complete genome) position: , mismatch: 7, identity: 0.759

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
aaaatacagtaagagcctataaaaaagga	Protospacer
* ..***** **.**************

292. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024317 (Borrelia miyamotoi strain Yekat-6 plasmid pYkt6-lp72, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttatatcacttaatgtaattaagtac	Protospacer
****** ************.****   *.

293. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024391 (Borrelia miyamotoi strain Izh-4 plasmid pIzh4-lp72, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttatatcacttaatgtaattaagtac	Protospacer
****** ************.****   *.

294. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024206 (Borrelia miyamotoi strain Izh-5 plasmid pIzh5-lp72, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttatatcacttaatgtaattaagtac	Protospacer
****** ************.****   *.

295. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024334 (Borrelia miyamotoi strain Yekat-1 plasmid pYkt1-lp72, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttatatcacttaatgtaattaagtac	Protospacer
****** ************.****   *.

296. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024352 (Borrelia miyamotoi strain Izh-16 plasmid pIzh16-lp72, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttatatcacttaatgtaattaagtac	Protospacer
****** ************.****   *.

297. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP024372 (Borrelia miyamotoi strain Izh-14 plasmid pIzh14-lp72, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
aaatttatatcacttaatgtaattaagtac	Protospacer
****** ************.****   *.

298. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_LR215002 (Mycoplasma conjunctivae strain NCTC10147 plasmid 6) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
atatttttatcacttattccaattttacca	Protospacer
* ************** * ******. . *

299. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP013139 (Pseudoalteromonas sp. Bsw20308 plasmid pPBSW1, complete sequence) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
gtgtatttattacttaatgcaatttattaa	Protospacer
. .* *****.************** **.*

300. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to LR214958 (Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 4) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
atatttttatcacttattccaattttacca	Protospacer
* ************** * ******. . *

301. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to LR214961 (Mycoplasma fermentans strain NCTC10117 genome assembly, plasmid: 7) position: , mismatch: 7, identity: 0.767

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
atatttttatcacttattccaattttacca	Protospacer
* ************** * ******. . *

302. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP042406 (Leuconostoc mesenteroides strain CBA3628 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

303. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028252 (Leuconostoc mesenteroides strain SRCM102733 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

304. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP046064 (Leuconostoc mesenteroides subsp. mesenteroides strain CBA3607 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

305. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021967 (Leuconostoc mesenteroides strain CBA7131 plasmid pLMCBA713101, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

306. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035747 (Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

307. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_LT996085 (Lactobacillus acidipiscis strain ACA-DC 1533 plasmid pLAC2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

308. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP018181 (Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

309. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035141 (Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

310. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028256 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

311. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_018699 (Leuconostoc carnosum JB16 plasmid pKLC4, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

312. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021492 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

313. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035272 (Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

314. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035272 (Leuconostoc mesenteroides strain SRCM103453 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

315. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_008496 (Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293 plasmid pLEUM1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

316. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP045036 (Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

317. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP045036 (Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

318. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP045036 (Lactobacillus mali strain LM596 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

319. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP018177 (Lactobacillus hordei strain TMW 1.1822 plasmid pL11822-1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agttcaagtagagaagttaaggcggtggct	Protospacer
 .  .*******.****** *********

320. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_010467 (Leuconostoc citreum KM20 plasmid pLCK3, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

321. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035140 (Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

322. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035572 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed1) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

323. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP013756 (Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

324. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP042422 (Leuconostoc lactis strain CBA3622 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

325. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021494 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

326. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP013150 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

327. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP035749 (Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

328. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP050806 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

329. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_014131 (Leuconostoc kimchii IMSNU 11154 plasmid LkipL4701, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

330. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NC_015756 (Weissella koreensis KACC 15510 plasmid WKp2903, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

331. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP017997 (Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

332. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP017376 (Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

333. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP042384 (Leuconostoc pseudomesenteroides strain CBA3630 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

334. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021931 (Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

335. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028257 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

336. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP028258 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

337. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP018797 (Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

338. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP013752 (Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

339. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP021493 (Leuconostoc mesenteroides strain WiKim33 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

340. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP016599 (Leuconostoc lactis strain WiKim40 plasmid pWK40-1, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
ggtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

341. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP023177 (Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agatccagtagagaagttaaggcggtggct	Protospacer
 .* . ******.****** *********

342. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP042415 (Leuconostoc citreum strain CBA3624 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
agtttgagtagagaagttaaggcggtggct	Protospacer
 .  *.******.****** *********

343. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to NC_009035 (Shewanella baltica OS155 plasmid pSbal01, complete sequence) position: , mismatch: 8, identity: 0.733

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
gttcataagaaaaagcccataaaaaagctc	Protospacer
.*     **********.***********.

344. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to MK448924 (Streptococcus phage Javan384, complete genome) position: , mismatch: 8, identity: 0.733

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
cgaatgcagaaaaagcatataaaacagctg	Protospacer
  ..*.********** ******* ****

345. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to MK448723 (Streptococcus phage Javan271, complete genome) position: , mismatch: 8, identity: 0.733

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
caaatgctgaaaaagcctataaaacagctg	Protospacer
  ..*.* **************** ****

346. spacer 1.7|1559569|30|AP018543|CRISPRCasFinder,CRT matches to MG720309 (Vibrio phage Ares1, complete genome) position: , mismatch: 8, identity: 0.733

tcatacctatatcggttagctctttggtaa	CRISPR spacer
cggcacctaaatcggttagctctttaacaa	Protospacer
. ..***** ***************...**

347. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP028862 (Borreliella garinii strain 20047 plasmid lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
atattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

348. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP017218 (Borreliella burgdorferi strain B331 plasmid B331_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

349. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_017804 (Borreliella garinii BgVir plasmid lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
atattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

350. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP018745 (Borreliella garinii strain CIP 103362 isolate 20047 plasmid p_lp54_linear) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
atattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

351. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031397 (Borreliella burgdorferi strain MM1 plasmid plsm_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

352. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019854 (Borreliella burgdorferi plasmid lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

353. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019765 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

354. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015809 (Borrelia mayonii strain MN14-1539 plasmid lp54) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
atattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

355. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_011784 (Borreliella burgdorferi ZS7 plasmid ZS7_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

356. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_013130 (Borreliella burgdorferi N40 plasmid N40_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

357. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015795 (Borrelia mayonii strain MN14-1420 plasmid lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
atattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

358. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_013128 (Borrelia burgdorferi 297 plasmid 297_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

359. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_013129 (Borreliella burgdorferi JD1 plasmid JD1_lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

360. spacer 1.12|1559900|29|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NC_001857 (Borreliella burgdorferi B31 plasmid lp54, complete sequence) position: , mismatch: 8, identity: 0.724

tggttaaaaaggaagccatcaaagagaca	CRISPR spacer
acattaaaaatgaagcaatcaaagagctt	Protospacer
  .******* ***** ********* .

361. spacer 1.13|1559965|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.733

tggttgccgtcagcaccatcaagaggaaca	CRISPR spacer
acagcgccgtcagcgccatcaagagggcca	Protospacer
  . .*********.***********. **

362. spacer 1.13|1559965|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 8, identity: 0.733

tggttgccgtcagcaccatcaagaggaaca	CRISPR spacer
tggttgccgccagcaccatgaagggtcgag	Protospacer
*********.********* ***.*  . .

363. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP042810 (Acetobacter oryzoeni strain B6 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
tgattactatactgttatgaaagaaaattc	Protospacer
*      ***.******* ***********

364. spacer 1.14|1560031|30|AP018543|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

ttcagcgtatgctgttattaaagaaaattc	CRISPR spacer
aaatgtatatgctgttactaaagaaaatac	Protospacer
    *..**********.********** *

365. spacer 1.19|1559503|29|AP018543|PILER-CR matches to NC_018276 (Croceibacter phage P2559S, complete genome) position: , mismatch: 8, identity: 0.724

atggtacagaaaaagcctataaaaaagct	CRISPR spacer
tagcggtagaaaaagcctataaaatagcc	Protospacer
  *  ..***************** ***.

366. spacer 2.1|1806553|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP011038 (Pseudoalteromonas nigrifaciens strain KMM 661 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatttttatcacttaatgcaatttcttga	CRISPR spacer
gtgtttttagcacttaatgcaattgattat	Protospacer
. .****** **************  **.

367. spacer 1.2|1559239|30|AP018543|CRISPRCasFinder,CRT matches to NC_014533 (Gloeothece verrucosa PCC 7822 plasmid Cy782201, complete sequence) position: , mismatch: 9, identity: 0.7

aaatgttgcgatgaataattttaattggaa	CRISPR spacer
ctctgtagcgatgaataatttttattactc	Protospacer
   *** *************** ***.

368. spacer 1.4|1559371|30|AP018543|CRISPRCasFinder,CRT matches to NZ_CP023393 (Lactococcus raffinolactis strain WiKim0068 plasmid pWiKim0068-1, complete sequence) position: , mismatch: 9, identity: 0.7

taagtaagtagaaaagttatggcggtggcg	CRISPR spacer
atcacttgtagaaaagttaagacggtggcg	Protospacer
   ..  ************ *.********

369. spacer 1.6|1559503|30|AP018543|CRISPRCasFinder,CRT matches to NC_018276 (Croceibacter phage P2559S, complete genome) position: , mismatch: 9, identity: 0.7

atggtacagaaaaagcctataaaaaagctt	CRISPR spacer
tagcggtagaaaaagcctataaaatagccc	Protospacer
  *  ..***************** ***..

370. spacer 2.3|1806685|30|AP018543|CRISPRCasFinder,CRT matches to NC_047893 (Escherichia phage DTL, complete genome) position: , mismatch: 9, identity: 0.7

atcgaaaacattatacgaacataaatttgt	CRISPR spacer
ttaagtgacaatatacgaacataaatttag	Protospacer
 * .. .*** *****************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1092230 : 1106859

Enterococcus_phage(46.15%)

holin,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD27637.1\|1092230_1092716_-	toxin	A0A097BY56	Enterococcus_phage	4.4e-60	70.5
BBD27638.1\|1092750_1093233_-	transcriptional regulator	R9QTP6	Staphylococcus_phage	2.6e-20	47.7
BBD27639.1\|1093630_1094386_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	8.7e-31	56.0
BBD27640.1\|1094404_1095247_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	4.8e-30	30.7
BBD27641.1\|1095249_1095342_+	hypothetical protein	NA	NA	NA	NA
BBD27642.1\|1095334_1095565_+	hypothetical protein	NA	NA	NA	NA
BBD27643.1\|1095725_1096133_+	transcriptional regulator	NA	NA	NA	NA
BBD27644.1\|1096378_1096771_+	hypothetical protein	NA	NA	NA	NA
BBD27645.1\|1096783_1097296_+\|tail	phage major tail protein, TP901-1 family	W6LP72	Streptococcus_phage	8.8e-35	49.4
BBD27646.1\|1097328_1097688_+	hypothetical protein	A0A0F6N4J9	Staphylococcus_phage	1.4e-07	31.4
BBD27647.1\|1097705_1098074_+	hypothetical protein	Q38180	Lactococcus_phage	3.3e-07	32.0
BBD27648.1\|1098063_1100997_+	membrane protein	A0A1U9WR55	Streptococcus_virus	1.1e-09	25.0
BBD27649.1\|1100998_1101925_+\|tail	phage tail family protein	C9E2K5	Enterococcus_phage	9.0e-147	78.6
BBD27650.1\|1101937_1103395_+	phage minor structural protein	C9E2K6	Enterococcus_phage	1.9e-175	47.7
BBD27651.1\|1103427_1105197_+	hypothetical protein	A0A097BYA8	Enterococcus_phage	3.4e-142	72.0
BBD27652.1\|1105220_1105616_+\|holin	holin	F0PIJ6	Enterococcus_phage	2.8e-33	48.9
BBD27653.1\|1105761_1106859_+	endolysin	A0A139ZVY1	Enterococcus_phage	4.0e-77	44.6

DBSCAN-SWA_2

1248425 : 1291068

Listeria_phage(48.72%)

head,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD27780.1\|1248425_1249022_-	hypothetical protein	A0A059T7Z1	Listeria_phage	2.0e-30	35.8
BBD27781.1\|1249049_1249514_-	ImmA/IrrE family metallo-endopeptidase	R4IBK9	Listeria_phage	1.1e-20	36.6
BBD27782.1\|1249530_1249839_-	XRE family transcriptional regulator	A0A1W6JQ26	Staphylococcus_phage	8.5e-09	36.3
BBD27783.1\|1249981_1250251_+	hypothetical protein	NA	NA	NA	NA
BBD27784.1\|1250229_1250376_+	hypothetical protein	NA	NA	NA	NA
BBD27785.1\|1250438_1250999_+	hypothetical protein	NA	NA	NA	NA
BBD27786.1\|1250979_1251210_+	DNA-binding protein	NA	NA	NA	NA
BBD27787.1\|1251221_1251389_+	hypothetical protein	NA	NA	NA	NA
BBD27788.1\|1251389_1251605_+	hypothetical protein	NA	NA	NA	NA
BBD27789.1\|1251660_1251951_+	hypothetical protein	NA	NA	NA	NA
BBD27790.1\|1251955_1254070_+	hypothetical protein	A0A1L2K2K3	Aeribacillus_phage	3.1e-49	25.2
BBD27791.1\|1254070_1255243_+	hypothetical protein	NA	NA	NA	NA
BBD27792.1\|1255242_1255944_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	2.7e-50	42.7
BBD27793.1\|1255961_1256720_+	DNA damage-inducible protein DnaD	A0A1B0Y2R2	Lactobacillus_phage	7.4e-14	61.4
BBD27794.1\|1256735_1257233_+	recombinase RecU	A0A1L2JY30	Aeribacillus_phage	8.3e-14	35.4
BBD27795.1\|1257253_1257568_+	hypothetical protein	NA	NA	NA	NA
BBD27796.1\|1257651_1258401_+	hypothetical protein	D2IZY3	Enterococcus_phage	6.7e-116	84.5
BBD27797.1\|1258425_1258620_+	hypothetical protein	NA	NA	NA	NA
BBD27798.1\|1258650_1258878_+	hypothetical protein	C9E2N4	Enterococcus_phage	1.3e-06	49.1
BBD27799.1\|1258919_1259237_+	DNA topoisomerase domain-containing protein	NA	NA	NA	NA
BBD27800.1\|1259236_1259404_+	hypothetical protein	A0A097BY78	Enterococcus_phage	3.1e-21	96.4
BBD27801.1\|1259396_1259963_+	DUF1642 domain-containing protein	D2IZL3	Enterococcus_phage	1.5e-40	49.0
BBD27802.1\|1259962_1260394_+	hypothetical protein	C9E2N9	Enterococcus_phage	1.2e-29	77.1
BBD27803.1\|1260407_1260725_+	replicase domain-containing protein	NA	NA	NA	NA
BBD27804.1\|1260718_1260925_+	hypothetical protein	D2IZL5	Enterococcus_phage	1.6e-27	86.4
BBD27805.1\|1260925_1261105_+	hypothetical protein	NA	NA	NA	NA
BBD27806.1\|1261137_1261230_+	hypothetical protein	NA	NA	NA	NA
BBD27807.1\|1261245_1261425_+	hypothetical protein	NA	NA	NA	NA
BBD27808.1\|1261525_1262110_+	positive control factor	NA	NA	NA	NA
BBD27809.1\|1262544_1262748_+	hypothetical protein	NA	NA	NA	NA
BBD27810.1\|1262849_1263119_+	hypothetical protein	NA	NA	NA	NA
BBD27811.1\|1263163_1264432_+	adenine methyltransferase	A0A2I4R670	Erysipelothrix_phage	7.6e-96	46.4
BBD27812.1\|1264515_1264788_+	hypothetical protein	A8ATN7	Listeria_phage	7.2e-12	53.8
BBD27813.1\|1264802_1265528_+\|terminase	terminase small subunit	A0A1W6JNJ8	Staphylococcus_phage	4.6e-05	32.4
BBD27814.1\|1265508_1266945_+	hypothetical protein	A5GYP8	Lactococcus_phage	1.9e-199	72.1
BBD27815.1\|1267010_1267661_+	hypothetical protein	NA	NA	NA	NA
BBD27816.1\|1267710_1269105_+	DUF1073 domain-containing protein	A8ATG1	Listeria_phage	3.6e-147	56.6
BBD27817.1\|1269094_1270339_+\|head	minor head protein	A8ATG2	Listeria_phage	1.3e-52	41.6
BBD27818.1\|1270331_1270496_+	hypothetical protein	NA	NA	NA	NA
BBD27819.1\|1270552_1270840_+	hypothetical protein	A0A0S2MYE7	Enterococcus_phage	1.7e-27	68.3
BBD27820.1\|1270832_1271042_+	LysM domain-containing protein	NA	NA	NA	NA
BBD27821.1\|1271054_1272155_+	hypothetical protein	A8ATG4	Listeria_phage	1.5e-87	58.9
BBD27822.1\|1272157_1272628_+	hypothetical protein	NA	NA	NA	NA
BBD27823.1\|1272649_1273531_+	DUF2184 domain-containing protein	A8ATG6	Listeria_phage	3.9e-83	51.8
BBD27824.1\|1273545_1273932_+	hypothetical protein	D6PSX8	Lactobacillus_phage	4.6e-12	35.8
BBD27825.1\|1273943_1274285_+	DUF4054 domain-containing protein	A8ATG8	Listeria_phage	1.0e-18	47.7
BBD27826.1\|1274284_1274887_+	hypothetical protein	D6PSY0	Lactobacillus_phage	9.0e-39	45.5
BBD27827.1\|1274886_1275261_+	hypothetical protein	A8ATH0	Listeria_phage	5.6e-31	50.8
BBD27828.1\|1275253_1275721_+	hypothetical protein	NA	NA	NA	NA
BBD27829.1\|1275717_1276755_+	DUF3383 domain-containing protein	A8ATH2	Listeria_phage	6.4e-101	55.8
BBD27830.1\|1276770_1277169_+	hypothetical protein	A8ATH3	Listeria_phage	6.6e-30	54.0
BBD27831.1\|1277221_1277554_+	hypothetical protein	A8ATH4	Listeria_phage	8.2e-26	57.8
BBD27832.1\|1277737_1282903_+	peptidase M23	A8ATH6	Listeria_phage	2.2e-149	41.5
BBD27833.1\|1282902_1283460_+	peptidoglycan-binding protein LysM	A8ATH7	Listeria_phage	2.8e-34	43.2
BBD27834.1\|1283469_1283832_+	hypothetical protein	A8ATH8	Listeria_phage	5.1e-29	46.6
BBD27835.1\|1283832_1284663_+	hypothetical protein	A8ATH9	Listeria_phage	1.7e-64	45.4
BBD27836.1\|1284662_1284995_+	hypothetical protein	A8ATI0	Listeria_phage	1.6e-21	50.0
BBD27837.1\|1284994_1285342_+	DUF2634 domain-containing protein	A0A2H4J4S8	uncultured_Caudovirales_phage	6.4e-13	49.4
BBD27838.1\|1285334_1286489_+	hypothetical protein	A8ATI2	Listeria_phage	5.6e-114	54.1
BBD27839.1\|1286472_1287102_+	hypothetical protein	A8ATI3	Listeria_phage	4.1e-58	57.4
BBD27840.1\|1287120_1288764_+	hypothetical protein	D2J018	Enterococcus_phage	2.6e-112	66.3
BBD27841.1\|1288785_1289220_+	hypothetical protein	NA	NA	NA	NA
BBD27842.1\|1289219_1289348_+	XkdX family protein	NA	NA	NA	NA
BBD27843.1\|1289352_1289709_+	hypothetical protein	NA	NA	NA	NA
BBD27844.1\|1289705_1289903_+	hypothetical protein	NA	NA	NA	NA
BBD27845.1\|1289961_1291068_+	endolysin	A0A139ZVY1	Enterococcus_phage	2.6e-84	47.4

DBSCAN-SWA_3

1583689 : 1592333

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD28133.1\|1583689_1584262_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.1e-25	35.1
BBD28134.1\|1584258_1585290_-	phosphoribosylformylglycinamidine cyclo-ligase	M4QRQ6	Synechococcus_phage	1.1e-55	45.6
BBD28135.1\|1585291_1586731_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	3.6e-49	33.0
BBD28136.1\|1586706_1588926_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	3.3e-147	39.9
BBD28137.1\|1588922_1589597_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
BBD28138.1\|1589597_1589849_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
BBD28139.1\|1589862_1590576_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3ELR0	Synechococcus_phage	7.4e-48	42.5
BBD28140.1\|1590727_1591864_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
BBD28141.1\|1591844_1592333_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	8.4e-19	42.0

DBSCAN-SWA_4

1732114 : 1784827

Enterococcus_phage(30.0%)

capsid,integrase,tail,holin,protease,portal,tRNA,terminase

attL 1747519:1747537|attR 1784883:1784901

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD28272.1\|1732114_1733884_-\|tRNA	aspartate--tRNA ligase	A0A2K9L424	Tupanvirus	3.0e-13	30.3
BBD28273.1\|1733901_1735203_-\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	1.5e-22	26.4
BBD28274.1\|1735560_1736007_-\|tRNA	D-aminoacyl-tRNA deacylase	NA	NA	NA	NA
BBD28275.1\|1736030_1738244_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2I2L310	Orpheovirus	1.3e-10	38.0
BBD28276.1\|1738458_1739211_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
BBD28277.1\|1739212_1740160_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
BBD28278.1\|1740175_1740661_-	DUF3013 domain-containing protein	NA	NA	NA	NA
BBD28279.1\|1740617_1741295_-	DNA-3-methyladenine glycosylase	NA	NA	NA	NA
BBD28280.1\|1741423_1742701_+	replication-associated recombination protein A	A0A127AWE7	Bacillus_phage	1.8e-105	49.9
BBD28281.1\|1743028_1743307_+	hypothetical protein	NA	NA	NA	NA
BBD28282.1\|1743485_1743959_+	universal stress protein	NA	NA	NA	NA
BBD28283.1\|1744070_1745258_-	acetate kinase	NA	NA	NA	NA
BBD28284.1\|1745282_1746254_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
BBD28285.1\|1746418_1746772_-	hypothetical protein	NA	NA	NA	NA
BBD28286.1\|1746771_1747206_-	competence protein ComG	NA	NA	NA	NA
BBD28287.1\|1747195_1747597_-	type II secretion system protein	NA	NA	NA	NA
1747519:1747537	attL	NA	NA	NA	NA
BBD28288.1\|1747899_1748025_+	hypothetical protein	NA	NA	NA	NA
BBD28289.1\|1748323_1749241_-	ferrochelatase	NA	NA	NA	NA
BBD28290.1\|1750007_1750232_-	hypothetical protein	NA	NA	NA	NA
BBD28291.1\|1750331_1750532_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.5e-24	78.8
BBD28292.1\|1751367_1752627_-	LysM peptidoglycan-binding domain-containing protein	A0A0S2MYF3	Enterococcus_phage	7.5e-221	90.5
BBD28293.1\|1752680_1753109_-\|holin	holin	F0PIJ6	Enterococcus_phage	5.1e-36	53.4
BBD28294.1\|1753108_1753645_-	hypothetical protein	D2J074	Enterococcus_phage	1.4e-86	90.4
BBD28295.1\|1753645_1754674_-	hypothetical protein	D2J073	Enterococcus_phage	6.8e-103	57.3
BBD28296.1\|1754684_1755809_-	hypothetical protein	Q77MU2	Lactococcus_phage	8.8e-88	45.3
BBD28297.1\|1755811_1756711_-\|tail	phage tail family protein	D2J071	Enterococcus_phage	2.9e-49	37.4
BBD28298.1\|1756710_1761462_-\|tail	phage tail tape measure protein	J7KDT4	Streptococcus_phage	7.2e-14	43.0
BBD28299.1\|1761480_1761603_-	hypothetical protein	NA	NA	NA	NA
BBD28300.1\|1761683_1762031_-	hypothetical protein	NA	NA	NA	NA
BBD28301.1\|1762087_1762561_-\|tail	tail protein	A0A1D6Z291	Staphylococcus_phage	6.0e-22	45.1
BBD28302.1\|1762634_1763228_-\|tail	tail protein	A0A060AKE9	Staphylococcus_phage	2.6e-22	35.1
BBD28303.1\|1763260_1763656_-	hypothetical protein	A0A059T681	Listeria_phage	2.9e-17	44.2
BBD28304.1\|1763652_1764057_-	hypothetical protein	A0A2P0ZLD7	Lactobacillus_phage	9.7e-21	44.1
BBD28305.1\|1764053_1764428_-	hypothetical protein	A8ATA1	Listeria_phage	1.5e-28	52.1
BBD28306.1\|1764414_1764720_-	hypothetical protein	A0A0U4K528	Bacillus_phage	1.3e-09	47.5
BBD28307.1\|1764797_1765943_-\|capsid	phage major capsid protein	A8AT98	Listeria_phage	7.8e-116	56.0
BBD28308.1\|1765969_1766743_-\|protease	Clp protease ClpP	A0A059T5F2	Listeria_phage	4.0e-55	50.6
BBD28309.1\|1766714_1767890_-\|portal	phage portal protein	A0A2H4JBZ5	uncultured_Caudovirales_phage	8.4e-73	40.5
BBD28310.1\|1768046_1768208_+	hypothetical protein	NA	NA	NA	NA
BBD28311.1\|1768152_1769832_-\|terminase	terminase large subunit	D2XR15	Bacillus_phage	1.4e-225	68.9
BBD28312.1\|1769828_1770140_-	hypothetical protein	D2XR14	Bacillus_phage	1.2e-15	49.0
BBD28313.1\|1770232_1770904_-	hypothetical protein	A0A0B5A095	Streptococcus_phage	1.1e-16	47.9
BBD28314.1\|1771022_1771337_-	HNH endonuclease	A0A1S5SFB3	Streptococcus_phage	3.5e-26	58.0
BBD28315.1\|1771333_1771663_-	hypothetical protein	NA	NA	NA	NA
BBD28316.1\|1771735_1772482_-	hypothetical protein	NA	NA	NA	NA
BBD28317.1\|1772856_1773324_-	ArpU family transcriptional regulator	D7RWH7	Brochothrix_phage	3.8e-08	27.9
BBD28318.1\|1773652_1773901_+	hypothetical protein	NA	NA	NA	NA
BBD28319.1\|1773986_1774193_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	1.3e-24	96.8
BBD28320.1\|1774208_1774814_-	hypothetical protein	NA	NA	NA	NA
BBD28321.1\|1774833_1775304_-	DUF1064 domain-containing protein	A0A1I9KKZ1	Lactobacillus_phage	1.9e-31	45.9
BBD28322.1\|1775282_1775456_-	hypothetical protein	NA	NA	NA	NA
BBD28323.1\|1775452_1775722_-	hypothetical protein	NA	NA	NA	NA
BBD28324.1\|1775860_1776700_-	DNA replication protein DnaC	U5PVD6	Bacillus_phage	2.0e-20	31.7
BBD28325.1\|1776711_1777467_-	DnaD domain protein	B4XYS6	Lactobacillus_phage	7.6e-43	63.6
BBD28326.1\|1777481_1778297_-	hypothetical protein	J7KGZ1	Streptococcus_phage	2.5e-60	49.8
BBD28327.1\|1778259_1779276_-	DNA recombination protein RecT	A0A1S5SAA8	Streptococcus_phage	5.4e-60	44.5
BBD28328.1\|1779378_1779603_-	hypothetical protein	D2IZX4	Enterococcus_phage	1.5e-15	58.9
BBD28329.1\|1779599_1779923_-	hypothetical protein	D2IYT5	Enterococcus_phage	5.9e-29	64.5
BBD28330.1\|1779962_1780178_-	hypothetical protein	A0A0S2MY96	Enterococcus_phage	1.3e-16	75.0
BBD28331.1\|1780184_1780496_-	hypothetical protein	NA	NA	NA	NA
BBD28332.1\|1780506_1780683_-	XRE family transcriptional regulator	D2IZW2	Enterococcus_phage	1.7e-14	65.5
BBD28333.1\|1780994_1781327_+	transcriptional regulator	A0A097QQ00	Enterococcus_phage	2.6e-35	69.1
BBD28334.1\|1781343_1781688_+	ImmA/IrrE family metallo-endopeptidase	A0A097QQ08	Enterococcus_phage	2.9e-42	73.5
BBD28335.1\|1781772_1782687_+	hypothetical protein	NA	NA	NA	NA
BBD28336.1\|1782854_1783583_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	2.4e-22	48.4
BBD28337.1\|1783678_1784827_+\|integrase	site-specific integrase	A0A0M5M609	Bacillus_phage	2.9e-38	29.3
1784883:1784901	attR	NA	NA	NA	NA

DBSCAN-SWA_5

1848555 : 1934481

101

Enterococcus_phage(78.26%)

capsid,head,transposase,integrase,tail,holin,portal,tRNA,terminase

attL 1893662:1893688|attR 1934556:1934582

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD28391.1\|1848555_1849485_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
BBD28392.1\|1849485_1850232_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	3.6e-13	41.2
BBD28393.1\|1851259_1852624_-	hypothetical protein	NA	NA	NA	NA
BBD28394.1\|1852620_1853586_-	glycosyltransferase	A0A075B8F6	Enterobacteria_phage	2.4e-65	43.3
BBD28395.1\|1853873_1854329_+\|transposase	IS200/IS605 family transposase	A0A0H3UZM0	Geobacillus_virus	5.1e-18	36.8
BBD28396.1\|1854455_1855406_-	epimerase	A0A1V0SKV4	Klosneuvirus	4.4e-48	36.5
BBD28397.1\|1856028_1857414_-	hypothetical protein	NA	NA	NA	NA
BBD28398.1\|1857477_1857882_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	1.7e-17	37.0
BBD28399.1\|1857878_1858766_-	glycosyl transferase	NA	NA	NA	NA
BBD28400.1\|1858765_1860199_-	sugar isomerase	NA	NA	NA	NA
BBD28401.1\|1860208_1861360_-	teichoic acid biosynthesis protein F	NA	NA	NA	NA
BBD28402.1\|1861356_1862355_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	5.4e-12	43.5
BBD28403.1\|1862481_1865799_-	hypothetical protein	D6PSS2	Lactobacillus_phage	2.9e-22	34.1
BBD28404.1\|1865816_1866644_-	ammonia monooxygenase	F2Y1U7	Organic_Lake_phycodnavirus	1.2e-12	29.1
BBD28405.1\|1866654_1868052_-	sugar transferase	NA	NA	NA	NA
BBD28406.1\|1868157_1869459_-	hypothetical protein	NA	NA	NA	NA
BBD28407.1\|1869487_1871458_-	hypothetical protein	NA	NA	NA	NA
BBD28408.1\|1871491_1873633_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
BBD28409.1\|1873644_1876788_-	glycosyl transferase family 2	NA	NA	NA	NA
BBD28410.1\|1876777_1877995_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-08	24.0
BBD28411.1\|1878007_1878802_-	ABC transporter permease	NA	NA	NA	NA
BBD28412.1\|1879049_1879391_+	hypothetical protein	NA	NA	NA	NA
BBD28413.1\|1879464_1879815_-	DUF2304 domain-containing protein	NA	NA	NA	NA
BBD28414.1\|1879814_1880558_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
BBD28415.1\|1880592_1881435_-	dTDP-4-dehydrorhamnose reductase	A0A1D8EQE2	Escherichia_phage	2.5e-26	33.6
BBD28416.1\|1881527_1882556_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.9e-68	41.9
BBD28417.1\|1882580_1883153_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.4e-41	50.3
BBD28418.1\|1883165_1884032_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	6.1e-105	63.9
BBD28419.1\|1884153_1884867_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
BBD28420.1\|1884870_1885698_-	glycosyl transferase family 2	NA	NA	NA	NA
BBD28421.1\|1885697_1886480_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
BBD28422.1\|1886607_1887744_-	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
BBD28423.1\|1887854_1888763_-	YihY/virulence factor BrkB family protein	NA	NA	NA	NA
BBD28424.1\|1888778_1889543_-	type I methionyl aminopeptidase	NA	NA	NA	NA
BBD28425.1\|1889717_1890161_+	flavodoxin	NA	NA	NA	NA
BBD28426.1\|1890235_1890709_-	tryptophan-rich sensory protein	NA	NA	NA	NA
BBD28427.1\|1890866_1891439_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
BBD28428.1\|1891685_1892924_+	aminopeptidase	NA	NA	NA	NA
BBD28429.1\|1893182_1893563_+	PH domain-containing protein	A6N235	Microbacterium_phage	2.5e-10	33.0
1893662:1893688	attL	NA	NA	NA	NA
BBD28430.1\|1893896_1894145_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	1.6e-37	100.0
BBD28431.1\|1894240_1895203_-	hypothetical protein	A0A0S2MYH0	Enterococcus_phage	3.1e-182	100.0
BBD28432.1\|1895504_1895894_+	hypothetical protein	NA	NA	NA	NA
BBD28433.1\|1895905_1896502_+	hypothetical protein	NA	NA	NA	NA
BBD28434.1\|1896603_1897863_-	1,4-beta-N-acetylmuramidase	A0A0S2MYF3	Enterococcus_phage	1.5e-237	97.6
BBD28435.1\|1897867_1898071_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	2.6e-30	100.0
BBD28436.1\|1898067_1898295_-	hypothetical protein	A0A0S2MYL7	Enterococcus_phage	1.3e-30	98.6
BBD28437.1\|1898386_1900771_-	glycerophosphodiester phosphodiesterase	A0A0S2MYI4	Enterococcus_phage	0.0e+00	100.0
BBD28438.1\|1900782_1900956_-	hypothetical protein	A0A0S2MYG7	Enterococcus_phage	2.3e-24	100.0
BBD28439.1\|1900956_1902975_-	phage minor structural protein, region	A0A0S2MYF5	Enterococcus_phage	1.4e-309	100.0
BBD28440.1\|1902991_1903921_-\|tail	tail protein	A0A097BY64	Enterococcus_phage	8.1e-172	99.4
BBD28441.1\|1903921_1907329_-	tape measure domain-containing protein	A0A0S2MYN1	Enterococcus_phage	0.0e+00	100.0
BBD28442.1\|1907344_1907602_-	hypothetical protein	A0A0S2MYH1	Enterococcus_phage	1.6e-40	100.0
BBD28443.1\|1907694_1908045_-	hypothetical protein	A0A0S2MYH5	Enterococcus_phage	2.5e-57	100.0
BBD28444.1\|1908100_1908559_-	hypothetical protein	A0A0S2MYH7	Enterococcus_phage	3.7e-77	100.0
BBD28445.1\|1908636_1909167_-\|tail	phage major tail protein, TP901-1 family	A0A0S2MYF4	Enterococcus_phage	1.5e-93	100.0
BBD28446.1\|1909182_1909572_-\|capsid	phage capsid protein	A0A0S2MYG3	Enterococcus_phage	6.6e-67	99.2
BBD28447.1\|1909568_1909949_-	hypothetical protein	A0A0S2MYE9	Enterococcus_phage	2.1e-65	100.0
BBD28448.1\|1909923_1910259_-	hypothetical protein	A0A0S2MYE1	Enterococcus_phage	1.1e-57	100.0
BBD28449.1\|1910255_1910588_-	hypothetical protein	A0A0S2MYD5	Enterococcus_phage	5.5e-54	100.0
BBD28450.1\|1910661_1911594_-\|capsid	phage major capsid protein	A0A1B1V000	Enterococcus_phage	2.3e-174	100.0
BBD28451.1\|1911606_1912206_-	hypothetical protein	A0A0S2MYF0	Enterococcus_phage	3.5e-75	100.0
BBD28452.1\|1912328_1912661_-	hypothetical protein	A0A0S2MYE7	Enterococcus_phage	2.1e-58	100.0
BBD28453.1\|1912686_1912956_-	hypothetical protein	A0A0S2MYD1	Enterococcus_phage	3.8e-45	100.0
BBD28454.1\|1912956_1913895_-\|head	phage head morphogenesis protein	A0A0S2MYG5	Enterococcus_phage	9.7e-173	100.0
BBD28455.1\|1913899_1915438_-\|portal	phage portal protein	A0A1B1V003	Enterococcus_phage	1.9e-287	99.8
BBD28456.1\|1915455_1916754_-\|terminase	PBSX family phage terminase large subunit	D2J001	Enterococcus_phage	4.9e-231	92.1
BBD28457.1\|1916746_1917541_-\|terminase	small subunit of terminase	D2J000	Enterococcus_phage	5.6e-121	91.8
BBD28458.1\|1917593_1917818_-	hypothetical protein	NA	NA	NA	NA
BBD28459.1\|1919398_1919815_-	autolysin	D2IZL7	Enterococcus_phage	1.7e-68	99.3
BBD28460.1\|1920237_1920408_-	hypothetical protein	D2IZL5	Enterococcus_phage	8.2e-22	85.7
BBD28461.1\|1920407_1920569_-	hypothetical protein	D2IZL4	Enterococcus_phage	5.9e-22	92.5
BBD28462.1\|1920569_1921088_-	hypothetical protein	D2IZZ0	Enterococcus_phage	9.9e-18	37.5
BBD28463.1\|1921063_1921303_-	hypothetical protein	NA	NA	NA	NA
BBD28464.1\|1921314_1921566_-	hypothetical protein	A0A0Y0C5A8	Bacillus_phage	7.9e-05	39.0
BBD28465.1\|1921562_1921886_-	hypothetical protein	NA	NA	NA	NA
BBD28466.1\|1921891_1922128_-	hypothetical protein	A0A096XT77	Enterococcus_phage	2.2e-09	43.6
BBD28467.1\|1922142_1922367_-	hypothetical protein	NA	NA	NA	NA
BBD28468.1\|1922366_1922714_-	hypothetical protein	D2IZY9	Enterococcus_phage	4.6e-27	61.2
BBD28469.1\|1922750_1922930_-	hypothetical protein	D2IZY7	Enterococcus_phage	9.8e-26	96.6
BBD28470.1\|1923222_1923606_-	class I SAM-dependent methyltransferase	D2IYU6	Enterococcus_phage	1.1e-71	96.1
BBD28471.1\|1923659_1923860_-	hypothetical protein	A0A1B1V001	Enterococcus_phage	7.4e-22	90.0
BBD28472.1\|1923944_1924214_-	hypothetical protein	NA	NA	NA	NA
BBD28473.1\|1924225_1924753_-	single-stranded DNA-binding protein	A0A097PAQ3	Streptococcus_pyogenes_phage	9.0e-43	58.3
BBD28474.1\|1924742_1925051_-	hypothetical protein	D2IZR4	Enterococcus_phage	1.6e-44	90.9
BBD28475.1\|1925050_1926064_-	hypothetical protein	A0A0S2MYA8	Enterococcus_phage	1.7e-159	99.3
BBD28476.1\|1926082_1926763_-	hypothetical protein	A0A0S2MYA3	Enterococcus_phage	4.8e-129	100.0
BBD28477.1\|1926759_1927740_-	DUF1351 domain-containing protein	A0A0S2MYB3	Enterococcus_phage	1.5e-123	99.7
BBD28478.1\|1927682_1928360_-	single-stranded DNA-binding protein	A0A0S2MYH3	Enterococcus_phage	3.3e-122	100.0
BBD28479.1\|1928360_1928597_-	hypothetical protein	A0A0S2MYD6	Enterococcus_phage	6.2e-36	100.0
BBD28480.1\|1928653_1928809_-	hypothetical protein	A0A0S2MYB0	Enterococcus_phage	8.2e-21	100.0
BBD28481.1\|1928809_1928920_-	hypothetical protein	C9E2M6	Enterococcus_phage	2.3e-09	94.1
BBD28482.1\|1928916_1929090_-	hypothetical protein	A0A0S2MY96	Enterococcus_phage	4.0e-24	100.0
BBD28483.1\|1929111_1929360_-	hypothetical protein	A0A0S2MYC6	Enterococcus_phage	2.1e-42	100.0
BBD28484.1\|1929375_1930095_-	oxidoreductase	A0A0S2MYI3	Enterococcus_phage	2.3e-134	100.0
BBD28485.1\|1930176_1930410_-	DUF739 domain-containing protein	A0A0S2MYC3	Enterococcus_phage	7.8e-39	100.0
BBD28486.1\|1930568_1931141_+	transcriptional regulator	C9E2M1	Enterococcus_phage	7.4e-99	98.9
BBD28487.1\|1931157_1931631_+	hypothetical protein	A0A0S2MYA6	Enterococcus_phage	5.4e-87	100.0
BBD28488.1\|1931719_1932421_+	hypothetical protein	A0A0S2MYA9	Enterococcus_phage	5.5e-96	100.0
BBD28489.1\|1932444_1932645_+	hypothetical protein	A0A0S2MYA2	Enterococcus_phage	7.4e-30	100.0
BBD28490.1\|1932705_1933278_+	hypothetical protein	A0A1B1UZZ9	Enterococcus_phage	9.4e-86	100.0
BBD28491.1\|1933344_1934481_+\|integrase	site-specific integrase	A0A0S2MYI6	Enterococcus_phage	2.9e-211	100.0
1934556:1934582	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2340085 : 2349825

Streptococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD28859.1\|2340085_2342269_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	3.1e-286	66.8
BBD28860.1\|2342301_2342898_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	6.0e-51	56.4
BBD28861.1\|2342942_2344061_-	DNA polymerase IV	NA	NA	NA	NA
BBD28862.1\|2344186_2344945_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
BBD28863.1\|2344928_2345591_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.7e-19	31.1
BBD28864.1\|2345605_2346478_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	6.2e-81	57.6
BBD28865.1\|2346589_2346937_-	initiation-control protein YabA	M1PFV3	Streptococcus_phage	8.1e-16	36.7
BBD28866.1\|2346929_2347769_-	signal peptidase II	NA	NA	NA	NA
BBD28867.1\|2347885_2348836_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.2e-34	33.0
BBD28868.1\|2348837_2349167_-	hypothetical protein	NA	NA	NA	NA
BBD28869.1\|2349186_2349825_-	thymidylate kinase	M1PSC7	Streptococcus_phage	2.1e-54	53.8

DBSCAN-SWA_7

2749008 : 2814355

Streptococcus_phage(21.43%)

holin,protease,transposase,integrase

attL 2741525:2741542|attR 2817358:2817375

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2741525:2741542	attL	NA	NA	NA	NA
BBD29250.1\|2749008_2749584_-\|integrase	integrase	E2ELN7	Clostridium_phage	1.7e-26	39.7
BBD29251.1\|2749792_2751001_+\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	2.8e-55	34.5
BBD29252.1\|2751362_2751755_-	30S ribosomal protein S9	NA	NA	NA	NA
BBD29253.1\|2751768_2752314_-	50S ribosomal protein L13	NA	NA	NA	NA
BBD29254.1\|2752433_2752901_-	DNA starvation/stationary phase protection protein	C1KFH1	Lactobacillus_virus	1.0e-05	25.9
BBD29255.1\|2753028_2753748_-	lipoprotein	NA	NA	NA	NA
BBD29256.1\|2753831_2755352_-	gluconate kinase	NA	NA	NA	NA
BBD29257.1\|2755460_2756153_+	prepilin peptidase	NA	NA	NA	NA
BBD29258.1\|2756333_2757638_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.2e-43	31.1
BBD29259.1\|2757735_2761389_-	DNA-directed RNA polymerase subunit beta'	R4TQM7	Phaeocystis_globosa_virus	1.4e-65	24.8
BBD29260.1\|2761555_2765170_-	DNA-directed RNA polymerase, beta subunit	A0A1B1ISA9	uncultured_Mediterranean_phage	2.0e-48	24.5
BBD29261.1\|2765391_2765529_-	hypothetical protein	NA	NA	NA	NA
BBD29262.1\|2765540_2765882_-	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SAB3	Streptococcus_phage	4.2e-17	42.5
BBD29263.1\|2765881_2766112_-	hypothetical protein	NA	NA	NA	NA
BBD29264.1\|2766285_2766501_-	DNA-binding protein	NA	NA	NA	NA
BBD29265.1\|2766639_2767632_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
BBD29266.1\|2767698_2768331_-	RloB domain-containing protein	NA	NA	NA	NA
BBD29267.1\|2768339_2769635_-	abortive infection protein	NA	NA	NA	NA
BBD29268.1\|2769660_2769795_-	hypothetical protein	NA	NA	NA	NA
BBD29269.1\|2770096_2771713_+	phosphatase PAP2 family protein	NA	NA	NA	NA
BBD29270.1\|2771982_2772126_+\|holin	putative holin-like toxin	NA	NA	NA	NA
BBD29271.1\|2772320_2775320_-	WxL domain-containing protein	NA	NA	NA	NA
BBD29272.1\|2775651_2779581_-	WxL domain-containing protein	NA	NA	NA	NA
BBD29273.1\|2779567_2779930_-	cell wall surface anchor protein	NA	NA	NA	NA
BBD29274.1\|2780316_2781264_-	1,4-dihydroxy-2-naphthoate polyprenyltransferase	NA	NA	NA	NA
BBD29275.1\|2781277_2782345_-	FAD:protein FMN transferase	NA	NA	NA	NA
BBD29276.1\|2782599_2783529_-	FMN-binding domain-containing protein	NA	NA	NA	NA
BBD29277.1\|2783806_2785753_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
BBD29278.1\|2785970_2786393_+	hypothetical protein	NA	NA	NA	NA
BBD29279.1\|2786404_2786962_+	heptaprenyl diphosphate synthase subunit I	NA	NA	NA	NA
BBD29280.1\|2786999_2787986_+	geranylgeranyl pyrophosphate synthase	NA	NA	NA	NA
BBD29281.1\|2788306_2788537_+	AbrB family transcriptional regulator	NA	NA	NA	NA
BBD29282.1\|2788526_2788892_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SEX8	Streptococcus_phage	6.1e-14	42.5
BBD29283.1\|2789379_2791458_-	hypothetical protein	NA	NA	NA	NA
BBD29284.1\|2791880_2792672_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.1e-23	29.8
BBD29285.1\|2792664_2793258_-	non-canonical purine NTP pyrophosphatase	A0A1K0ISQ7	Cassava_brown_streak_virus	1.5e-09	34.3
BBD29286.1\|2793261_2793822_-	GTP cyclohydrolase I FolE	S4VV34	Pandoravirus	2.0e-32	49.1
BBD29287.1\|2793824_2794310_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
BBD29288.1\|2794310_2794673_-	dihydroneopterin aldolase	NA	NA	NA	NA
BBD29289.1\|2795259_2796081_-	hypothetical protein	NA	NA	NA	NA
BBD29290.1\|2796084_2796732_-	hypothetical protein	NA	NA	NA	NA
BBD29291.1\|2796728_2797436_-	hypothetical protein	NA	NA	NA	NA
BBD29292.1\|2797799_2797904_-	hypothetical protein	NA	NA	NA	NA
BBD29293.1\|2798199_2799549_-	glutathione-disulfide reductase	NA	NA	NA	NA
BBD29294.1\|2799635_2799929_-	hypothetical protein	NA	NA	NA	NA
BBD29295.1\|2799913_2800039_-	hypothetical protein	NA	NA	NA	NA
BBD29296.1\|2800061_2801201_-	transcriptional regulator	B6SBZ6	Clostridium_virus	5.1e-43	33.2
BBD29297.1\|2801178_2801844_-	conserved hypothetical protein	NA	NA	NA	NA
BBD29298.1\|2802106_2803660_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
BBD29299.1\|2803660_2804755_-	DUF917 domain-containing protein	NA	NA	NA	NA
BBD29300.1\|2804774_2806043_-	cytosine permease	NA	NA	NA	NA
BBD29301.1\|2806729_2808292_-	PucR family transcriptional regulator	NA	NA	NA	NA
BBD29302.1\|2808315_2809563_-\|protease	collagenase-like protease	Q6DW11	Phage_TP	8.7e-44	34.2
BBD29303.1\|2809590_2810511_-	U32 family peptidase	NA	NA	NA	NA
BBD29304.1\|2810691_2811726_-	FUSC family protein	NA	NA	NA	NA
BBD29305.1\|2811859_2814355_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A0A8J958	Klebsiella_phage	1.9e-127	39.5
2817358:2817375	attR	NA	NA	NA	NA

DBSCAN-SWA_8

2855923 : 2873446

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD29333.1\|2855923_2856238_+	DUF961 domain-containing protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
BBD29334.1\|2856256_2856640_+	DUF961 domain-containing protein	A0A1S5SF96	Streptococcus_phage	2.3e-64	100.0
BBD29335.1\|2856668_2858054_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
BBD29336.1\|2858231_2859437_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
BBD29337.1\|2859479_2859701_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
BBD29338.1\|2859817_2860315_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.7e-91	100.0
BBD29339.1\|2860289_2860796_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
BBD29340.1\|2860779_2863227_+	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	100.0
BBD29341.1\|2863229_2865407_+	membrane protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	100.0
BBD29342.1\|2865403_2866405_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
BBD29343.1\|2866401_2867334_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	3.1e-171	99.4
BBD29344.1\|2867710_2869630_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
BBD29345.1\|2869975_2870329_-	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
BBD29346.1\|2870833_2871256_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
BBD29347.1\|2871252_2871483_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
BBD29348.1\|2871943_2872147_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
BBD29349.1\|2872228_2873446_+\|transposase	transposase	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0

Anti-CRISPR protein detection

Acr_ID: AP018543.1|BBD27784.1|1250229_1250376_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: AP018543.1|BBD27785.1|1250438_1250999_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

AP018543.1|BBD27784.1|1250229_1250376_+|hypothetical-protein

1250229_1250376_+

48 aa aa

HTH_XRE,HTH_17

Identity	Hit_domain_coverage
0.4117647058823529	0.9607843137254902

1248425-1291068

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
AP018543_1	TypeII	1.8\|1559635\|30\|AP018543\|CRISPRCasFinder,CRT	1559635-1559664	30	1255940-1255969	0

1. spacer 1.8|1559635|30|AP018543|CRISPRCasFinder,CRT matches to AP018543 position: 1255940-1255969, mismatch: 0

catagagagtggaggtgtgacattgaatta	CRISPR spacer
catagagagtggaggtgtgacattgaatta	Protospacer
******************************

AP018543.1|BBD27785.1|1250438_1250999_+|hypothetical-protein

1250438_1250999_+

186 aa aa

HTH_XRE,HTH_17

Identity	Hit_domain_coverage
0.4117647058823529	0.9607843137254902

1248425-1291068

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
AP018543_1	TypeII	1.8\|1559635\|30\|AP018543\|CRISPRCasFinder,CRT	1559635-1559664	30	1255940-1255969	0

1. spacer 1.8|1559635|30|AP018543|CRISPRCasFinder,CRT matches to AP018543 position: 1255940-1255969, mismatch: 0

catagagagtggaggtgtgacattgaatta	CRISPR spacer
catagagagtggaggtgtgacattgaatta	Protospacer
******************************

2. AP018546

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2066 : 58390

Streptococcus_phage(68.97%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD29558.1\|2066_2684_+	recombinase family protein	A0A219YA40	Aeromonas_phage	4.5e-17	36.1
BBD29559.1\|2683_4828_+	type IA DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	2.5e-264	96.9
BBD29560.1\|4916_5813_+	partitioning protein ParA	A0A1X9I765	Streptococcus_phage	8.2e-153	98.2
BBD29561.1\|5904_6120_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
BBD29562.1\|6136_6409_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
BBD29563.1\|6410_7274_+	toxin zeta	NA	NA	NA	NA
BBD29564.1\|7447_8812_-\|transposase	putative transposase	A0A2D1GQC1	Lysinibacillus_phage	7.2e-100	43.5
BBD29565.1\|9009_9429_-	metallothiol transferase FosB	NA	NA	NA	NA
BBD29566.1\|9726_9855_-	hypothetical protein	NA	NA	NA	NA
BBD29567.1\|9880_10021_-	hypothetical protein	E4ZFP9	Streptococcus_phage	8.0e-15	93.0
BBD29568.1\|9965_10703_-	23S rRNA methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
BBD29569.1\|11605_11722_+	hypothetical protein	NA	NA	NA	NA
BBD29570.1\|11694_12012_+	hypothetical protein	A0A1W6JN36	Lactococcus_phage	3.5e-26	79.4
BBD29571.1\|12536_13043_+	chaperone protein DnaJ	NA	NA	NA	NA
BBD29572.1\|13147_13381_+	hypothetical protein	NA	NA	NA	NA
BBD29573.1\|13403_13661_-	hypothetical protein	NA	NA	NA	NA
BBD29574.1\|13663_13963_-	hypothetical protein	NA	NA	NA	NA
BBD29575.1\|14275_16240_+	Mobilization protein A	NA	NA	NA	NA
BBD29576.1\|16263_16596_+	hypothetical protein	NA	NA	NA	NA
BBD29577.1\|16614_16998_+	hypothetical protein	NA	NA	NA	NA
BBD29578.1\|17080_17644_+	hypothetical protein	NA	NA	NA	NA
BBD29579.1\|17654_19616_+	AAA-like domain protein	NA	NA	NA	NA
BBD29580.1\|19629_20982_+	hypothetical protein	NA	NA	NA	NA
BBD29581.1\|21003_22113_+	N-acetylmuramoyl-L-alanine amidase domain-containing protein precursor	A0A1S5SEZ8	Streptococcus_phage	4.4e-39	43.1
BBD29582.1\|22125_22677_+	hypothetical protein	NA	NA	NA	NA
BBD29583.1\|22681_23113_+	hypothetical protein	NA	NA	NA	NA
BBD29584.1\|23105_24761_+	conjugal transfer protein TraG	NA	NA	NA	NA
BBD29585.1\|24778_25702_+	hypothetical protein	NA	NA	NA	NA
BBD29586.1\|25701_26634_+	hypothetical protein	NA	NA	NA	NA
BBD29587.1\|26650_27622_+	hypothetical protein	NA	NA	NA	NA
BBD29588.1\|27650_28019_+	hypothetical protein	NA	NA	NA	NA
BBD29589.1\|28078_28828_+	cell wall surface anchor protein	NA	NA	NA	NA
BBD29590.1\|29255_30449_-\|transposase	putative transposase	A0A1S5SEW7	Streptococcus_phage	2.1e-143	64.1
BBD29591.1\|30527_30734_-	excisionase	A0A1S5SF07	Streptococcus_phage	1.1e-25	87.3
BBD29592.1\|30726_31869_-	hypothetical protein	A0A1S5SEX3	Streptococcus_phage	4.8e-65	36.2
BBD29593.1\|32377_33013_+	HTH-type transcriptional regulator SinR	NA	NA	NA	NA
BBD29594.1\|33503_34436_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	9.0e-171	99.0
BBD29595.1\|34812_36732_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.4
BBD29596.1\|37077_37431_-	XRE family transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
BBD29597.1\|37790_37979_+	hypothetical protein	NA	NA	NA	NA
BBD29598.1\|37998_38355_+	RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	3.5e-30	60.3
BBD29599.1\|38956_39514_-	zeta toxin	NA	NA	NA	NA
BBD29600.1\|39704_40487_-	tetracycline resistance protein, class B	NA	NA	NA	NA
BBD29601.1\|40528_41215_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	3.6e-124	97.3
BBD29602.1\|41517_41856_+	morphine 6-dehydrogenase	NA	NA	NA	NA
BBD29603.1\|42085_44113_+	beta-lactam-inducible penicillin-binding protein	NA	NA	NA	NA
BBD29604.1\|44739_45426_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
BBD29605.1\|45675_46071_+	hypothetical protein	NA	NA	NA	NA
BBD29606.1\|46395_47013_+	recombinase family protein	Q1MVP4	Enterobacteria_phage	5.1e-13	33.1
BBD29607.1\|47053_47353_+	hypothetical protein	NA	NA	NA	NA
BBD29608.1\|47386_47584_+	hypothetical protein	NA	NA	NA	NA
BBD29609.1\|47886_48219_+	hypothetical protein	NA	NA	NA	NA
BBD29610.1\|48251_48536_-	hypothetical protein	NA	NA	NA	NA
BBD29611.1\|48528_49419_-	hypothetical protein	F0PIG8	Enterococcus_phage	1.5e-29	31.7
BBD29612.1\|50107_51628_+	repS protein	NA	NA	NA	NA
BBD29613.1\|51921_52608_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.0e-126	98.7
BBD29614.1\|52692_53373_+\|transposase	IS256 family transposase IS256	A0A0N9S006	Staphylococcus_phage	8.8e-75	100.0
BBD29615.1\|53502_54942_-	bifunctional aminoglycoside N-acetyltransferase AAC(6')-Ie/aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A0N9SKF6	Staphylococcus_phage	7.2e-284	99.6
BBD29616.1\|54942_55326_-	N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	3.1e-69	98.4
BBD29617.1\|55315_56452_-	hypothetical protein	A0A0N9SKF6	Staphylococcus_phage	3.6e-222	100.0
BBD29618.1\|56608_57295_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	4.5e-127	99.6
BBD29619.1\|57516_58254_+	23S rRNA methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.6e-133	99.2
BBD29620.1\|58198_58390_+	hypothetical protein	E4ZFP9	Streptococcus_phage	1.8e-25	93.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. AP018544

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1762 : 53490

Streptococcus_phage(47.06%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD29373.1\|1762_2431_-\|protease	putative protease	NA	NA	NA	NA
BBD29374.1\|2466_2784_-	hypothetical protein	NA	NA	NA	NA
BBD29375.1\|3628_3928_+	replication control protein PrgN	NA	NA	NA	NA
BBD29376.1\|4712_5255_-	hypothetical protein	NA	NA	NA	NA
BBD29377.1\|5264_6197_-	ParA family protein	F0PIG8	Enterococcus_phage	4.2e-35	32.0
BBD29378.1\|6778_7795_+	replication protein RepA	NA	NA	NA	NA
BBD29379.1\|7940_9101_+	TraB family protein	NA	NA	NA	NA
BBD29380.1\|9155_10001_-	XRE family transcriptional regulator	NA	NA	NA	NA
BBD29381.1\|10828_11209_+	hypothetical protein	NA	NA	NA	NA
BBD29382.1\|11208_11481_+	pheromone-responsive regulatory protein S	NA	NA	NA	NA
BBD29383.1\|11793_12087_+	hypothetical protein	NA	NA	NA	NA
BBD29384.1\|12049_14773_+	SEC10/PgrA surface exclusion domain-containing protein	NA	NA	NA	NA
BBD29385.1\|14916_15252_+	hypothetical protein	F0PIH7	Enterococcus_phage	2.3e-39	69.4
BBD29386.1\|15541_19459_+	aggregation substance	NA	NA	NA	NA
BBD29387.1\|19520_19877_+	PrgU-like protein	NA	NA	NA	NA
BBD29388.1\|19898_20285_+	hypothetical protein	NA	NA	NA	NA
BBD29389.1\|20352_20613_+	hypothetical protein	NA	NA	NA	NA
BBD29390.1\|20623_21502_+	hypothetical protein	NA	NA	NA	NA
BBD29391.1\|21521_21866_+	hypothetical protein	NA	NA	NA	NA
BBD29392.1\|21914_22364_+	LPXTG-motif cell wall anchor domain protein	NA	NA	NA	NA
BBD29393.1\|22389_23661_+	CHAP domain-containing protein	A0A1P8CMP9	Staphylococcus_phage	7.6e-11	36.2
BBD29394.1\|23663_24281_+	conserved hypothetical protein	NA	NA	NA	NA
BBD29395.1\|24312_24681_+	hypothetical protein	NA	NA	NA	NA
BBD29396.1\|24777_26061_-\|transposase	putative transposase	A0A1S5SBP9	Streptococcus_phage	5.8e-43	32.8
BBD29397.1\|26229_26529_+	hypothetical protein	NA	NA	NA	NA
BBD29398.1\|26521_27556_+	conjugal transfer protein	NA	NA	NA	NA
BBD29399.1\|27545_27821_+	hypothetical protein	NA	NA	NA	NA
BBD29400.1\|27820_28210_+	hypothetical protein	NA	NA	NA	NA
BBD29401.1\|28241_28724_+	hypothetical protein	NA	NA	NA	NA
BBD29402.1\|28816_29275_+	single-stranded DNA-binding protein	Q9B008	Lactococcus_phage	6.6e-42	59.2
BBD29403.1\|29307_31872_+	hypothetical protein	NA	NA	NA	NA
BBD29404.1\|31828_32224_+	hypothetical protein	NA	NA	NA	NA
BBD29405.1\|32241_34587_+	MAEBL family membrane protein	NA	NA	NA	NA
BBD29406.1\|34573_36832_+	putative type IV secretion-system coupling protein	NA	NA	NA	NA
BBD29407.1\|37411_38140_+	ArsR family transcriptional regulator	NA	NA	NA	NA
BBD29408.1\|38145_38634_+	hypothetical protein	NA	NA	NA	NA
BBD29409.1\|38859_39234_+	hypothetical protein	NA	NA	NA	NA
BBD29410.1\|39240_39507_+	hypothetical protein	A0A1W6JN36	Lactococcus_phage	2.0e-22	68.2
BBD29411.1\|39668_40445_+	hypothetical protein	A8ATL9	Listeria_phage	2.5e-17	44.6
BBD29412.1\|40441_41776_+	PcfJ protein	A8ATM0	Listeria_phage	1.9e-97	42.0
BBD29413.1\|41915_42392_+	single-stranded DNA-binding protein	A0A1S5PRS2	Streptococcus_phage	8.8e-21	49.5
BBD29414.1\|43164_43851_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
BBD29415.1\|43886_44216_+	hypothetical protein	NA	NA	NA	NA
BBD29416.1\|44233_44443_+	hypothetical protein	NA	NA	NA	NA
BBD29417.1\|44475_44577_+	hypothetical protein	NA	NA	NA	NA
BBD29418.1\|44945_45284_-\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6E7	Streptococcus_phage	4.6e-56	94.5
BBD29419.1\|45625_45844_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
BBD29420.1\|45833_46448_+	XRE family transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	5.5e-07	46.8
BBD29421.1\|46574_47540_+	bacitracin ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.6e-43	47.6
BBD29422.1\|47580_48282_+	bacitracin transport permease BCRB	NA	NA	NA	NA
BBD29423.1\|48281_49112_+	undecaprenyl-diphosphatase	NA	NA	NA	NA
BBD29424.1\|49309_49996_-\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-116	90.7
BBD29425.1\|50652_51390_+	23S rRNA methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.2e-133	99.2
BBD29426.1\|51402_52188_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	5.5e-153	100.0
BBD29427.1\|52803_53490_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6

DBSCAN-SWA_2

59007 : 103624

Streptococcus_phage(50.0%)

integrase,transposase

attL 84640:84654|attR 104498:104512

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBD29432.1\|59007_59904_+	partitioning protein ParA	A0A1X9I765	Streptococcus_phage	1.9e-154	99.3
BBD29433.1\|59995_60211_+	peptide-binding protein	A0A1X9I6D5	Streptococcus_phage	4.2e-31	97.1
BBD29434.1\|60228_60501_+	antitoxin	A0A1X9I6E5	Streptococcus_phage	5.0e-05	100.0
BBD29435.1\|60502_61366_+	toxin zeta	NA	NA	NA	NA
BBD29436.1\|61487_61787_+	chaperone protein DnaJ	NA	NA	NA	NA
BBD29437.1\|62069_62666_-	transcriptional regulator BetI	NA	NA	NA	NA
BBD29438.1\|62796_63858_+	ABC-type transporter ATP-binding protein EcsA	A0A2H4PQG7	Staphylococcus_phage	3.6e-22	30.2
BBD29439.1\|63881_65495_+	hypothetical protein	NA	NA	NA	NA
BBD29440.1\|65566_66091_-\|integrase	integrase core domain protein	W5R8L2	Staphylococcus_phage	8.1e-36	44.4
BBD29441.1\|66132_66819_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
BBD29442.1\|67132_67738_+	resolvase family site-specific recombinase	M9Q1K0	Clostridium_phage	5.7e-17	31.9
BBD29443.1\|67734_69258_-	putative RNA helicase	NA	NA	NA	NA
BBD29444.1\|69471_70650_+\|transposase	ISEf1, transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
BBD29445.1\|70801_71500_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	7.1e-136	100.0
BBD29446.1\|71496_72039_+	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
BBD29447.1\|72140_72926_+	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	5.5e-153	100.0
BBD29448.1\|73675_74413_+	23S rRNA methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
BBD29449.1\|74357_74549_+	hypothetical protein	E4ZFP9	Streptococcus_phage	1.6e-26	95.2
BBD29450.1\|74717_75581_+	aminoglycoside nucleotidyltransferase ANT(6)-Ia	A0A1X9I6F2	Streptococcus_phage	8.7e-168	100.0
BBD29451.1\|75624_76152_+	adenine phosphoribosyltransferase	A0A1X9I6E2	Streptococcus_phage	1.9e-93	100.0
BBD29452.1\|76283_77093_+	streptomycin 3''-adenylyltransferase	NA	NA	NA	NA
BBD29453.1\|77310_77562_+	hypothetical protein	NA	NA	NA	NA
BBD29454.1\|77612_78071_-	hypothetical protein	NA	NA	NA	NA
BBD29455.1\|78132_78717_+	hypothetical protein	A0A2K5B2B4	Erysipelothrix_phage	4.1e-20	31.1
BBD29456.1\|79159_80644_+	putative ABC transporter ATP-binding protein YheS	A0A2H4UUX5	Bodo_saltans_virus	2.6e-26	26.0
BBD29457.1\|80697_81501_+	lincosamide nucleotidyltransferase	NA	NA	NA	NA
BBD29458.1\|81949_83029_-\|transposase	putative transposase	A0A1S5SBP9	Streptococcus_phage	1.6e-38	33.5
BBD29459.1\|83528_83753_+	helix-turn-helix domain protein	NA	NA	NA	NA
BBD29460.1\|83767_84637_+	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	1.2e-153	92.0
BBD29461.1\|84617_85352_+	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
84640:84654	attL	NA	NA	NA	NA
BBD29462.1\|85384_85906_+	N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	4.9e-73	100.0
BBD29463.1\|85906_86290_+	hypothetical protein	A0A1X9I6C2	Streptococcus_phage	1.8e-69	98.4
BBD29464.1\|86267_87338_+	hypothetical protein	A0A0N9SKF6	Staphylococcus_phage	5.8e-206	99.7
BBD29465.1\|87395_87512_+	hypothetical protein	NA	NA	NA	NA
BBD29466.1\|87625_88804_+\|transposase	ISEf1, transposase	A0A220NQR7	Corynebacterium_phage	3.0e-30	25.6
BBD29467.1\|89328_89742_-	toxin Doc	A0A0N9SKD8	Staphylococcus_phage	6.7e-17	41.5
BBD29468.1\|89738_89975_-	hypothetical protein	NA	NA	NA	NA
BBD29469.1\|90425_93542_-	type III restriction enzyme, res subunit	A0A2K5B256	Erysipelothrix_phage	2.0e-129	34.3
BBD29470.1\|93576_95346_-	putative methyltransferase	A0A2K5B2C1	Erysipelothrix_phage	3.4e-102	40.7
BBD29471.1\|95348_95906_-	hypothetical protein	NA	NA	NA	NA
BBD29472.1\|96018_97302_-\|transposase	putative transposase	A0A1S5SBP9	Streptococcus_phage	5.8e-43	32.8
BBD29473.1\|97446_100635_-	ATP-dependent RNA helicase RhlE	A0A2K5B2B9	Erysipelothrix_phage	9.8e-217	41.1
BBD29474.1\|100652_100763_-	hypothetical protein	NA	NA	NA	NA
BBD29475.1\|101428_102019_-	recombinase	D2XR58	Bacillus_phage	7.0e-28	35.1
BBD29476.1\|102476_103250_-\|integrase	integrase core domain protein	A0A1P8CWQ3	Bacillus_phage	1.0e-71	55.9
BBD29477.1\|103360_103624_-\|transposase	putative transposase	A0A1P8CWP5	Bacillus_phage	3.1e-12	45.2
104498:104512	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. AP018543

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

2. AP018546

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. AP018544

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection