CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
AP018937	Streptococcus pneumoniae HU-OH DNA, complete genome	2 crisprs	DEDDh,cas3,DinG,RT	0	0	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018937_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018937_1

94186-94281

Orphan

Consensus_repeat	Method
AATGTGTAAGATTTTTATATATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of AP018937_1

>merge|AP018937|1|94186-94281|CRISPRCasFinder
AATGTGTAAGATTTTTATATATAATTTTTCTACACATACATTGTACATCTAAAAGAAAGCCCTGTCAAGAGAAATGTGTAAAATTTTTATATATAA

>AP018937|1|1|94186-94281|CRISPRCasFinder
AATGTGTAAGATTTTTATATATAA	TTTTTCTACACATACATTGTACATCTAAAAGAAAGCCCTGTCAAGAGA
AATGTGTAAAATTTTTATATATAA

Protein	Signature genes	Signature genes Name	Protein_function
AP018937.1\|BBG36113.1\|86052_86976_+\|L-arabinose-transport-system-permease-protein	unknown	unknown	gnl\|CDD\|223472
AP018937.1\|BBG36111.1\|84569_84791_+\|hypothetical-protein	unknown	unknown	unknown
AP018937.1\|BBG36126.1\|100417_101089_-\|L-serine-dehydratase,-beta-chain	unknown	unknown	gnl\|CDD\|224674
AP018937.1\|BBG36117.1\|91231_92296_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374284
AP018937.1\|BBG36130.1\|105165_105807_+\|Macrolide-export-ATP-binding/permease-protein	unknown	unknown	gnl\|CDD\|188353
AP018937.1\|BBG36112.1\|85109_86039_+\|putative-multiple-sugar-transport-system	unknown	unknown	gnl\|CDD\|226666
AP018937.1\|BBG36123.1\|96729_98580_+\|UDP-N-acetyl-alpha-D-glucosamine-C6-dehydratase	unknown	unknown	gnl\|CDD\|224011
AP018937.1\|BBG36128.1\|102721_103009_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273735
AP018937.1\|BBG36118.1\|92357_93269_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372574
AP018937.1\|BBG36119.1\|93261_93855_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227053
AP018937.1\|BBG36121.1\|94306_95473_-\|putative-transporter-YycB	unknown	unknown	gnl\|CDD\|340897
AP018937.1\|BBG36122.1\|95623_96691_+\|Poly-beta-1,6-N-acetyl-D-glucosamine-synthase	unknown	unknown	gnl\|CDD\|133016
AP018937.1\|BBG36120.1\|93841_94168_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224609
AP018937.1\|BBG36116.1\|90193_91054_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|339103
AP018937.1\|BBG36127.1\|101330_101918_+\|putative-cell-wall-hydrolase-LytN	unknown	unknown	gnl\|CDD\|212030
AP018937.1\|BBG36114.1\|87185_88661_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378792
AP018937.1\|BBG36115.1\|88932_89919_+\|Thiosulfate-sulfurtransferase-GlpE	unknown	unknown	gnl\|CDD\|234663
AP018937.1\|BBG36125.1\|99536_100409_-\|L-serine-dehydratase,-alpha-chain	unknown	unknown	gnl\|CDD\|129801
AP018937.1\|BBG36124.1\|98882_99515_-\|5'-nucleotidase	unknown	unknown	gnl\|CDD\|319798
AP018937.1\|BBG36129.1\|103060_105169_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273736

Protein	Function_ID	Function_description	E-value
AP018937.1\|BBG36113.1\|86052_86976_+\|L-arabinose-transport-system-permease-protein	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	5.04007e-69
AP018937.1\|BBG36126.1\|100417_101089_-\|L-serine-dehydratase,-beta-chain	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.1908e-89
AP018937.1\|BBG36117.1\|91231_92296_-\|hypothetical-protein	gnl\|CDD\|374284	pfam16001, DUF4775, Domain of unknown function (DUF4775). This family of proteins is functionally uncharacterized. This family of proteins is found in eukaryotes. Proteins in this family are typically between 308 and 484 amino acids in length.	0.000365448
AP018937.1\|BBG36130.1\|105165_105807_+\|Macrolide-export-ATP-binding/permease-protein	gnl\|CDD\|188353	TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	3.50361e-111
AP018937.1\|BBG36112.1\|85109_86039_+\|putative-multiple-sugar-transport-system	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	3.01638e-143
AP018937.1\|BBG36123.1\|96729_98580_+\|UDP-N-acetyl-alpha-D-glucosamine-C6-dehydratase	gnl\|CDD\|224011	COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	0
AP018937.1\|BBG36128.1\|102721_103009_+\|hypothetical-protein	gnl\|CDD\|273735	TIGR01653, hypothetical_protein, bacteriocin, lactococcin 972 family. This model represents bacteriocins related to lactococcin 972. Members tend to be found in association with a seven transmembrane putative immunity protein. [Cellular processes, Toxin production and resistance].	6.91587e-26
AP018937.1\|BBG36118.1\|92357_93269_-\|hypothetical-protein	gnl\|CDD\|372574	pfam13349, DUF4097, Putative adhesin. This has a putative all-beta structure with a twenty-residue repeat with a highly conserved repeating GD, gly-asp, motif. It may form part of a bacterial adhesin.	1.41713e-39
AP018937.1\|BBG36119.1\|93261_93855_-\|hypothetical-protein	gnl\|CDD\|227053	COG4709, COG4709, Predicted membrane protein [Function unknown].	2.84602e-63
AP018937.1\|BBG36121.1\|94306_95473_-\|putative-transporter-YycB	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.12983e-126
AP018937.1\|BBG36122.1\|95623_96691_+\|Poly-beta-1,6-N-acetyl-D-glucosamine-synthase	gnl\|CDD\|133016	cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.	6.35969e-109
AP018937.1\|BBG36120.1\|93841_94168_-\|hypothetical-protein	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	8.86871e-19
AP018937.1\|BBG36116.1\|90193_91054_+\|hypothetical-protein	gnl\|CDD\|339103	pfam14132, DUF4299, Domain of unknown function (DUF4299). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 275 and 313 amino acids in length. There are two conserved sequence motifs: RGF and DAY. There are two completely conserved residues (P and D) that may be functionally important.	8.25368e-122
AP018937.1\|BBG36127.1\|101330_101918_+\|putative-cell-wall-hydrolase-LytN	gnl\|CDD\|212030	cd00118, LysM, Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.	5.22512e-13
AP018937.1\|BBG36114.1\|87185_88661_+\|hypothetical-protein	gnl\|CDD\|378792	pfam12010, DUF3502, Domain of unknown function (DUF3502). This presumed domain is functionally uncharacterized. This domain is found in bacteria. This domain is about 140 amino acids in length. This domain is found associated with pfam01547.	4.24398e-44
AP018937.1\|BBG36115.1\|88932_89919_+\|Thiosulfate-sulfurtransferase-GlpE	gnl\|CDD\|234663	PRK00142, PRK00142, rhodanese-related sulfurtransferase.	0
AP018937.1\|BBG36125.1\|99536_100409_-\|L-serine-dehydratase,-alpha-chain	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.65225e-106
AP018937.1\|BBG36124.1\|98882_99515_-\|5'-nucleotidase	gnl\|CDD\|319798	cd04302, HAD_5NT, haloacid dehalogenase (HAD)-like 5'-nucleotidases similar to the Pseudomonas aeruginosa PA0065. 5'-nucleotidases dephosphorylate nucleoside 5'-monophosphates to nucleosides and inorganic phosphate. Purified Pseudomonas aeruginosa PA0065 displayed high activity toward 5'-UMP and 5'-IMP, significant activity against 5'-XMP and 5'-TMP, and low activity against 5'-CMP. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.79283e-97
AP018937.1\|BBG36129.1\|103060_105169_+\|hypothetical-protein	gnl\|CDD\|273736	TIGR01654, unnamed_protein_product, bacteriocin-associated integral membrane (putative immunity) protein. This model represents a family of integral membrane proteins, most of which are about 650 residues in size and predicted to span the membrane seven times. Nearly half of the members of this family are found in association with a member of the lactococcin 972 family of bacteriocins (TIGR01653). Others may be associated with uncharacterized proteins that may also act as bacteriocins. Although this protein is suggested to be an immunity protein, and the bacteriocin is suggested to be exported by a Sec-dependent process, the role of this protein is unclear. [Cellular processes, Toxin production and resistance].	0

>AP018937.1|BBG36120.1|93841_94168_-|hypothetical-protein
MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYPILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWALYTDTINGIIEGSIRHDKN
>AP018937.1|BBG36119.1|93261_93855_-|hypothetical-protein
MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGVEGEEELIASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTILAQAKSAFILIFGSGLLAIGASSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA
>AP018937.1|BBG36118.1|92357_93269_-|hypothetical-protein
MRKWTKGFLIFGVVTTVIGFILLFVGIQSDGIKSLLSMSKEPVYDSRTEKLTFGKEVENLEITLHQHTLTITDSFDDQIHISYHPSLSAHHDFITNQNDRTLSLTDKKLSETPFLSSGIGGILHIASSYSSRFEEVILRLPKGRTLKGINISANRGQTTIINASLENATLNTNSYILRIEGSRIKNSKLTTPNIVNIFDTVLTDSQLESTDNHFHAENIQVHGKVELTAKDYLRIILDQKESQRINWDISSNYGSIFQFTREKPESRGTELSNPYKTEKTDVKDQLIARSDDNIDLISTPSRR
>AP018937.1|BBG36117.1|91231_92296_-|hypothetical-protein
MKQEWFESNDFVKTTSKNKPEEQAQEVADKAEETIADFDTPIGKNTQVEEEVSQAEVELESQQEEKIETPEVGEARTEIEEKKASNSTEEESDLSKETEKVTIAEESQEALPQQKATTKEPLLISKSLESPYIPDQAPKSRDKWKEQVLDFWSWLVEAIKSPTSKFETSITHSYTAFLLLILFSASSFFFSIYHIKHAYYGHIASINSRFPEQLAPLTLFSIISILVATTLFFFSFLLGSFVVRRFIHQEKDWTLDKVLQQYSQLLAIPIFLTAIASFFAFFDSLRFTALLCVISIGIILLASLHIITRPSQASETDSFYQLFLSVLVNGVIILLFFVAEVALIGDYLRILAFL
>AP018937.1|BBG36116.1|90193_91054_+|hypothetical-protein
MAKTFFIPNKQSILGEQEILNAKSILALLDGLESHSYDVVYLRQPLNRLEYIECAIVGQSQFLFKVSYADGQKAYRVDLPDLLTKTDWQIIKSFLDALLAYTGTDIEGLDGFDFEAYFQASIQAYLADPVARFTICQGIFNPIFFSRENLKSFLEADGLAQFEARVRAVQETDAYFARVSFYQDGEGKVHGVYHLAQGVKTVLPREPFVPAAYIEQLVDKEVQWEIDLVQITGDGSKPEDYESIARLDYAKFLEVLPPSFYHQLDANQIEIQPILGQDFKTLAQEK
>AP018937.1|BBG36115.1|88932_89919_+|Thiosulfate-sulfurtransferase-GlpE
MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGMEDLWFKIDEENEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRNFRELPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGESLDQAATV
>AP018937.1|BBG36114.1|87185_88661_+|hypothetical-protein
MKNWKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKMYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFADNYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVNGKIYAVPVAANVASSQNFAFNGTLLAKYGIDISGVTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVANGLPFVIDLEGDTTKVVNRYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILNLLNTNPELLNGLVYGPEGKNWEKIEGKENRVRVLDGYKGNTHMGGWNTGNNWILYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKAIPELMEKLKSEGAYEKVLNEMQKQYDEFLKNKK
>AP018937.1|BBG36113.1|86052_86976_+|L-arabinose-transport-system-permease-protein
MAKKKIKKEKIDNVGIHSFSKKADIFFSIISGLIALSCILPFVFVIIISVTDEKSLLQYGYSFFPSQFGLDGFEFLAQFKDKILQALFISVFVTVVGTLTNVFITTTYAYAISRTTFKYRRFFTIFVLLSMLFNAGLVPGYIMVTRVLQLGDTVWALIVPMLLSPFNIILMRSFFKKTIPEAILESARIDGASEARIFFQICLPLSLPGIATITLLTALGFWNDWFNALLYIKSDNLYPLQYLLMQIQQNMDYIAKAVGLTGQLGVALPKETGRMAMVVVATLPIAILYPFFQRYFVKGLTIGGVKE
>AP018937.1|BBG36112.1|85109_86039_+|putative-multiple-sugar-transport-system
MKKFSKTLRDNWIFLLMVLPGALWLILFFYIPVFGNVVAFKDYHMTSNGFIDSIINSKWVGLDNFRFLFSSRDAFIITRNTVLYNLGFIFLGLVVSVGIAIILSELRSKRMVKIFQTSMLFPYFLSWVIISFFTDAFLNIDKGVFNHLLESLGLKEVNFYADLGIWPYLLLFLGIWKGFGYSSVMYYATIMGIDPTYYEAATVDGASKWQRIRNVTIPQLTPLVTVLTILAVGNIFRADFGLFYQIPHNAGQLYNVTNVLDVYVFNGLTQTADIGMAAAAGLYQSVVGLILVILSNLLARRVDPNSALF
>AP018937.1|BBG36111.1|84569_84791_+|hypothetical-protein
MSLQIKLKKLAKELSKLLKDSNLETVDKDVLENSQKELQKAVLFLADEKGSEHTEAEVIDNLKEVIAKLKANA
>AP018937.1|BBG36121.1|94306_95473_-|putative-transporter-YycB
MKKQSLFFVPGIILIGVSLRTPFTVLPIILGNISQGLEVEVSSLGVLTSLPLLMFTLFSPFSTRLAQKIGLEHLFTYSLFFLTIGSLIRLINLPLLYLGTLMVGASVAVINVLLPSLIQANQPKKIGFLTTLYVTSMGIATALASYLAVPITQASSWKGLILLLTLLCLATFLVWLPNHRYNHRLAPQTKQKSQIKVMRNKQVWAIIIFSGFQSLIFYTVMTWLPTMSIHAGLSSHEAGLLTSILSLISIPFSMTIPSLTTSLSTRNRQLMLTLVSLAGVVGISMLFFPINNFIYWLAIHLLIGTATSALFPYLMVNFSLKTSAPEKTAQLSGLSQTGGYILAAFGPTLFGYSFDLFHSWVPSVAALLLIDILMTVALFTVDRADKIL
>AP018937.1|BBG36122.1|95623_96691_+|Poly-beta-1,6-N-acetyl-D-glucosamine-synthase
MTQNVESLLVSIVISAYNEEKYLPGLIEDLKNQTYPKENIEILFINAMSTDGTTAIIQQFIKEDTEFNSIRLYNNPKKNQASGFNLGVKHSVGDLILKIDAHSKVTESFVMNNVAIIQQGEFVCGGPRPTIVEGKGKWAETLHLVEENMFGSSIANYRNSSEDRYVSSIFHGMYKREVFQKVGLVNEQLGRTEDNDIHYRIREHGYKIRYSPSILSYQYIRPTFKKMLYQKYSNGLWIGLTSHVQFKCLSLFHYVPCLFVLSLVFSLALLPITFVFITLLLGAYFLLLSLLTLLTLLKHKNGFLIVMPFLLFSIHFAYGFGTIVGLIRGFKWKKEYKGTIIYLDKISQINQNMLQ
>AP018937.1|BBG36123.1|96729_98580_+|UDP-N-acetyl-alpha-D-glucosamine-C6-dehydratase
MNKKLTDYVIDLVEILNKQQKQVFWGIFDIFSMVVSIIVSYILFYGLINPAPVDYIIYTSLAFLFYQLMIVFWGLNASISRYSKITDFMKIFFGVTASSVLSYSICYAFLPLFSIRFIILFILLSTFLILLPRITWQLIYSRRKKGSGDGEHRRTFLIGAGDGGALFMDSYQHPTSELELVGILDKDSKKKGQKLGGIPVLGSYDNLPELAKRHQIERVIVAIPSLDPSEYERILQMCNKLGVKCYKMPKVETVVQGLHQAGTGFQKIDITDLLGRQEIRLDESRLGAELTGKTILVTGAGGSIGSEICRQVSRFNPERIVLLGHGENSIYLVYHELIRKFQGIDYVPVIADIQDYDRLLQVFEQYKPAIVYHAAAHKHVPMMERNPKEAFKNNIRGTYNVARAVDEAKVPKMVMISTDKAVNPPNVMGATKRVAELIVTGFNQRSQSTYCAVRFGNVLGSRGSVIPVFERQIAEGGPVTVTDFRMTRYFMTIPEASRLVIHAGAYAKDGEVFILDMGKPVKIYDLAKKMVLLSGHTESEIPIVEVGIRPGEKLYEELLVSTELVDNQVMDKIFVGKVNVMPLESINQKIGEFRTLSGDELKQAIIAFANQTTHIE
>AP018937.1|BBG36124.1|98882_99515_-|5'-nucleotidase
MTSITAIFFDLDGTLVDSSIGIHNAFTYTFKELGVPSPDAKTIRGFMGPPLESSFATCLSKDQISEAVQIYRSYYKAKGIYEAQLFPQIIDLLEELSSSYPLYITTTKNTSTAQDMAKNLEIHHFFDGIYGSSPEAPHKADVIHQALQTHQLVPQQAIIIGDTKFDMLGARETGIQKLAVTWGFGEQADLLNYQPDYIAHKPLEVLAYFQ
>AP018937.1|BBG36125.1|99536_100409_-|L-serine-dehydratase,-alpha-chain
MFYSIKELVEQADLDFQGNVAELMITTEFELTGREREEVFLLMERNLEVMKASVQLGLNENKSRSGLTGGDAAKLDHYIENGKTLSDYTILSAARNAIAVNEHNAKMGLVCATPTAGSAGCLPSVLTAAIEKLDLSHEQQLDFLFAAGAFGLVIANNASISGAEGGCQAEVGSASAMSAAALTLAAGGTPYQASQAIAFVIKNMLGLICDPVAGLVEVPCVKRNAMGASFAFIAADMALAGIESKIPVDEVIDAMYQVGASMPTAFRETAEGGLATTPTGRRLQKEIFGE
>AP018937.1|BBG36126.1|100417_101089_-|L-serine-dehydratase,-beta-chain
MKSLRFQSVFDIIGPVMIGPSSSHTAGAVRIGKIVSSIFDDTPTEVEFQLFNSFAKTYRGHGTDLALVAGILGMDTDDPEIPNSLEIAHKRGIKIVWTIQKDSNAPHPNTTKITVKNAHKTISVTGISIGGGNIQVTELNGFAVSLNMNTPTIIIVHQDIPGMIALVTEALSRYGINIAQMNVTREKAGEKAIMIIEVDSRNCDEAIEEIRKIPHLHNVNFFK
>AP018937.1|BBG36127.1|101330_101918_+|putative-cell-wall-hydrolase-LytN
MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAENNHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTVSGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYGSWTAAKNFWLNNGWY
>AP018937.1|BBG36128.1|102721_103009_+|hypothetical-protein
MRKLVKIGVASLMVCGILATTNALAVWVEGGQWNYGVGWTGTFGYSDYLHSTRYHTATVRHGGRTSKDYAKPEAWARASLTKIPPTGMEYFYGFE
>AP018937.1|BBG36129.1|103060_105169_+|hypothetical-protein
MKKISNFCMLLLLLCTTFFVFNVNYTREVVRIQEMGKTVDSLDLYLKDINEPAASVLRFFEDVSKEYKVSIIKTDSGDEVVKSGVFDKDTFPYQEFGISSLDFTTDGEGVYSNKEISNKLGTIPTFLKAKPIQLMTFQTYIKDTSRSLNGRYTITSTQEMDKDRIVQKWSDFFKIDQATLLEPTYKSAVEVINRDLLLSAIVFVLAILLLVLVTVYQPMMEMKRVGVQKLLGFQDRAVLADVVKGNLYLLLGGALVINLGVFFLLDYKPKDLFPMLWLSHFLLLQLYLFISWLTYLLIQKMTISSLLKGFSSFKFGLIFNYVMKIGTTILLTALLIGVGRSLEQENKEPAYQQQWVSQGNYLTLETFKLNDNLWQEELAGSGKSTDYFYRFYQDLVEKTQAGYVQSSSLPVKNFVQSEQIQQYQLTDTVDVYYANRNFLKSKGFKLPDTGIKKVILMPASTKGEEDKNQLLGKLIAFHSMKYEEQQKRTIEEMDVEIAYYEGDWSFFPYSDKRKENLSNPIISLVNDSDMMWDEKASLSTTGLNNPIKIENTVQHQKEITELVEKLSDGNYLKFSSIQAIQQEKVDSYRDAVRNFNLLFALFGLLSMMISYFLLVTTFLLKRRDIITKKFMGWKLVDRYRPLLVLLLLGYSFPLLVLIFFAHAFLPPLLFAGFTCLDILFVLGLASRMEKRSLVELLKGGIL
>AP018937.1|BBG36130.1|105165_105807_+|Macrolide-export-ATP-binding/permease-protein
MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLNLLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLALKYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADEPTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRIIELGEGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: AP018937_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018937_2

1036691-1036770

Orphan

Consensus_repeat	Method
GGGCCAAGCGGTGGCGGACACCAGAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of AP018937_2

>merge|AP018937|2|1036691-1036770|CRISPRCasFinder
GGGCCAAGCGGTGGCGGACACCAGAACAAAATCCGATAGCAATCTTGGACGTACGGGCCAAGCGGTGGCAGACACCAGAA

>AP018937|2|2|1036691-1036770|CRISPRCasFinder
GGGCCAAGCGGTGGCGGACACCAGAA	CAAAATCCGATAGCAATCTTGGACGTAC
GGGCCAAGCGGTGGCAGACACCAGAA

Protein	Signature genes	Signature genes Name	Protein_function
AP018937.1\|BBG37043.1\|1028032_1029913_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226036
AP018937.1\|BBG37039.1\|1025549_1026140_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379128
AP018937.1\|BBG37057.1\|1044240_1044978_-\|rRNA-adenine-N-6-methyltransferase	unknown	unknown	gnl\|CDD\|366074
AP018937.1\|BBG37041.1\|1027258_1027558_+\|hypothetical-protein	unknown	unknown	unknown
AP018937.1\|BBG37042.1\|1027547_1028036_+\|hypothetical-protein	unknown	unknown	unknown
AP018937.1\|BBG37055.1\|1043331_1043886_-\|DNA-invertase-hin	unknown	unknown	gnl\|CDD\|239737
AP018937.1\|BBG37056.1\|1044104_1044236_-\|hypothetical-protein	unknown	unknown	unknown
AP018937.1\|BBG37045.1\|1030192_1031047_+\|hypothetical-protein	unknown	unknown	unknown
AP018937.1\|BBG37058.1\|1045902_1047822_-\|Tetracycline-resistance-protein-TetM-from	unknown	unknown	gnl\|CDD\|206731
AP018937.1\|BBG37051.1\|1038960_1039191_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378900
AP018937.1\|BBG37054.1\|1040409_1043328_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376561
AP018937.1\|BBG37046.1\|1031100_1031460_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378907
AP018937.1\|BBG37053.1\|1040114_1040354_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376540
AP018937.1\|BBG37052.1\|1039187_1039610_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274357
AP018937.1\|BBG37050.1\|1038296_1038500_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|286167
AP018937.1\|BBG37044.1\|1029933_1030176_+\|hypothetical-protein	unknown	unknown	unknown
AP018937.1\|BBG37047.1\|1031410_1033768_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274279
AP018937.1\|BBG37049.1\|1036997_1038215_-\|Transposase-from-transposon-Tn916	unknown	unknown	gnl\|CDD\|334163
AP018937.1\|BBG37040.1\|1026139_1026976_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378065
AP018937.1\|BBG37048.1\|1033779_1036593_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|380090

Protein	Function_ID	Function_description	E-value
AP018937.1\|BBG37043.1\|1028032_1029913_+\|hypothetical-protein	gnl\|CDD\|226036	COG3505, VirD4, Type IV secretory pathway, VirD4 components [Intracellular trafficking and secretion].	1.86788e-57
AP018937.1\|BBG37039.1\|1025549_1026140_+\|hypothetical-protein	gnl\|CDD\|379128	pfam13338, AbiEi_4, Transcriptional regulator, AbiEi antitoxin. AbiEi_4 is the cognate antitoxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	0.00529716
AP018937.1\|BBG37057.1\|1044240_1044978_-\|rRNA-adenine-N-6-methyltransferase	gnl\|CDD\|366074	pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase.	1.79353e-85
AP018937.1\|BBG37054.1\|1040409_1043328_-\|hypothetical-protein	gnl\|CDD\|376561	pfam01526, DDE_Tnp_Tn3, Tn3 transposase DDE domain. This family includes transposases of Tn3, Tn21, Tn1721, Tn2501, Tn3926 transposons from E-coli. The specific binding of the Tn3 transposase to DNA has been demonstrated. Sequence analysis has suggested that the invariant triad of Asp689, Asp765, Glu895 (numbering as in Tn3) may correspond to the D-D-35-E motif previously implicated in the catalysis of numerous transposases.	2.45971e-169
AP018937.1\|BBG37055.1\|1043331_1043886_-\|DNA-invertase-hin	gnl\|CDD\|239737	cd03768, SR_ResInv, Serine Recombinase (SR) family, Resolvase and Invertase subfamily, catalytic domain; members contain a C-terminal DNA binding domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. Resolvases and invertases affect resolution or inversion and comprise a major phylogenic group. Resolvases (e.g. Tn3, gamma-delta, and Tn5044) normally recombine two sites in direct repeat causing deletion of the DNA between the sites. Invertases (e.g. Gin and Hin) recombine sites in inverted repeat to invert the DNA between the sites. Cointegrate resolution with gamma-delta resolvase requires the formation of a synaptosome of three resolvase dimers bound to each of two res sites on the DNA. Also included in this subfamily are some putative integrases including a sequence from bacteriophage phi-FC1.	3.41563e-56
AP018937.1\|BBG37058.1\|1045902_1047822_-\|Tetracycline-resistance-protein-TetM-from	gnl\|CDD\|206731	cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins. Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria. Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site. This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative. Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G. EF-G and Tet(M) compete for binding on the ribosomes. Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind. Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity. These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.	5.9776e-145
AP018937.1\|BBG37051.1\|1038960_1039191_-\|hypothetical-protein	gnl\|CDD\|378900	pfam12645, HTH_16, Helix-turn-helix domain. This domain appears to be a helix-turn-helix domain suggesting that this might be a transcriptional regulatory protein. Some members of this family are annotated as conjugative transposon domains.	4.41299e-26
AP018937.1\|BBG37046.1\|1031100_1031460_+\|hypothetical-protein	gnl\|CDD\|378907	pfam12666, PrgI, PrgI family protein. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 116 and 146 amino acids in length. This protein is found in an operon that is part of a Type IV secretion system.	6.29003e-15
AP018937.1\|BBG37040.1\|1026139_1026976_+\|hypothetical-protein	gnl\|CDD\|378065	pfam08843, AbiEii, Nucleotidyl transferase AbiEii toxin, Type IV TA system. This family was recently identified as belonging to the nucleotidyltransferase superfamily. AbiEii is the cognate toxin of the type IV toxin-antitoxin 'innate immunity' bacterial abortive infection (Abi) system that protects bacteria from the spread of a phage infection. The Abi system is activated upon infection with phage to abort the cell thus preventing the spread of phage through viral replication. There are some 20 or more Abis, and they are predominantly plasmid-encoded lactococcal systems. TA, toxin-antitoxin, systems on plasmids function by killing cells that lose the plasmid upon division. AbiE phage resistance systems function as novel Type IV TAs and are widespread in bacteria and archaea. The cognate antitoxin is pfam13338.	3.10204e-26
AP018937.1\|BBG37052.1\|1039187_1039610_-\|hypothetical-protein	gnl\|CDD\|274357	TIGR02937, RNA_polymerase_sigma_factor, RNA polymerase sigma factor, sigma-70 family. This model encompasses all varieties of the sigma-70 type sigma factors including the ECF subfamily. A number of sigma factors have names with a different number than 70 (i.e. sigma-38), but in fact, all except for the Sigma-54 family (TIGR02395) are included within this family. Several Pfam models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs.	1.0214e-10
AP018937.1\|BBG37050.1\|1038296_1038500_-\|hypothetical-protein	gnl\|CDD\|286167	pfam09035, Tn916-Xis, Excisionase from transposon Tn916. The phage-encoded excisionase protein Tn916-Xis adopts a winged-helix structure that consists of a three-stranded anti-parallel beta-sheet that packs against a helix-turn-helix (HTH) motif and a third C-terminal alpha-helix. It is encoded for by Tn916, which also codes for the integrase Tn916-Int. The protein interacts with DNA by the insertion of helix alpha-2 into the major groove and the contact of the hairpin that connects strands beta-2 and beta-3 with the adjacent phosphodiester backbone and/or minor groove. Tn916-Xis stimulates phage excision and inhibits viral integration by stabilizing distorted DNA structures.	1.3564e-15
AP018937.1\|BBG37047.1\|1031410_1033768_+\|hypothetical-protein	gnl\|CDD\|274279	TIGR02746, hypothetical_protein, type-IV secretion system protein TraC. The protein family described here is common among the F, P and I-like type IV secretion systems. Gene symbols include TraC (F-type), TrbE/VirB4 (P-type) and TraU (I-type). The protein conyains the Walker A and B motifs and so is a putative nucleotide triphosphatase.	2.15862e-14
AP018937.1\|BBG37049.1\|1036997_1038215_-\|Transposase-from-transposon-Tn916	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	6.12129e-48
AP018937.1\|BBG37053.1\|1040114_1040354_+\|hypothetical-protein	gnl\|CDD\|376540	pfam01381, HTH_3, Helix-turn-helix. This large family of DNA binding helix-turn helix proteins includes Cro and CI. Within Neisseria gonorrhoeae NGO_0477, the full protein fold incorporates a helix-turn-helix motif, but the function of this member is unlikely to be that of a DNA-binding regulator, the function of most other members, so is not necessarily characteristic of the whole family.	9.95295e-13
AP018937.1\|BBG37048.1\|1033779_1036593_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|380090	pfam18013, Phage_lysozyme2, Phage tail lysozyme. This domain has a lysozyme like fold. It is found in the tail protein of various phages probably giving them the ability to degrade the host cell wall peptidoglycan layer.	1.81742e-36

>AP018937.1|BBG37048.1|1033779_1036593_+|N-acetylmuramoyl-L-alanine-amidase
MKDKREIIRARKAFRRSLKDEKKFLKQGKKEVRKQKKDSAGLDEKRWKKEIKEKLEEMREASKERVRQANEDYNHILQNSPPSLLNRKELRDRRLPHARKRLKIAKKQFREAKVEAKEERKESRKERKINQKFLYGQESKQKSNFFFQGKSLEELKAKKEVKAAKENLKSTKQAYKSKKVSRKAKTFLYVLGREGGELASENEDLEGYRTLQETIRKGKRYSRLSYNLGKASVKTGQATGRFTKKRLTNTKERYHHFKAGKGWKLAKDNPSSFKNRYRKLKKQGLTSVRNIYQKLKAAFSFFTFAAGNPATWIVGGLVFLLLLMMSFFLGFSSASLIQQDEFELTKAYTHLTWEDAEHTRTNDKGITYYTKVDDVMGYMNFKFHDYELHKPVYLFSSETYKDYLSTLWHDLNDGEDLKSMQDLYETPKYKLSKDDQEEMKELKEEGVYASMQELDNPFEGKSNEDSLTMTYRYGYYDLDGKPTLQEYILLEAKAHQTIVAPMDGVVSLDGDNVILTNGKGENESRLTLYSIHNGRAIEGTRVLTGDIIGETPDDTGLKVSYQKYKNKKEKLVYVNPQFYFPKVIQLQTTILPAIGQFGGDEFERAKHIYEFLKSQGASPQAIAAILGNWSVESSINPKRAEGDYLSPPVGATDSSWDDESWLAIGGPAIYSGAYPNILHRGLGLGQWTDTADGSTRHTALLNYARTQNKKWYDLDLQLDFMLHGDSPYYQSWLKDFFKNTGSAANLAQLFLTYWEGNSGDKLLERQTRATEWYYQIEKGFSQTNGGQAKSDPQSLEGVRGDLYDHSVPGGGDGMAYAYGQCTWGVAARMNQLGLKLKGRNGEKISIINTMGNGQDWVATASSLGGETGSTPRAGAIVSFVGGTHGTPASYGHVAFVEKVYDDGSFLVSETNYGGNPNYTFRKISQADSAISFAYTTK
>AP018937.1|BBG37047.1|1031410_1033768_+|hypothetical-protein
MKRKSNTLKKQKTSMTNKKEKVKDKKEEVLPSTANTLSYQALYQNGLMQVKEDYFSQSYLLGDVNYQTVGLEDKGAIIEKYSDLINSLDDQTNFQLTIFNKRLNLEKFRQSVLYEEKEDGYDSYRKELNRMMNQNLDSGENNFSAVKLISFGRKDSNPKQAYRSLSQIGEYFKSGFSEIDARFESLAGEERVNLLADMLRGEHHLPFSYRDLTKSGQTTRHFIAPNLLDFKNKNYLQINDRLLQIVYVRDYGMELGDQFIRDLMQGDLELIVSLHAQSSTKADAMKKLRTKKTLMESQKIGEQQKLARTGIYLEKVGHVLESNIDEAEELLKTMTETGDKLFQTVFLIGVFGQDEEELKQALDTIQQVAGSNDLMIDKLPYMQEAAFNSLLPFGCDFLEGVSRSLLTSNIAVNSPWTSVDLQDRSGKYYGINQISSNIITIDRSLLNTPSGLILGTSGAGKGMATKHEIITTKIKESGENTEIIIVDPEAEYSVIGRAFGGEMIDIAPDSQTYLNVLDLSEENMDEDPVKVKSEFLLSFIGKLLDRKMDGREKSIIDRVTRLTYQSFKEPSLEEWVFVLSQQPEEEAQNLALDMELYVEGSLDIFSHKTNIQTGSNFLIYNVKKLGDELKQIALMVVFDQIWNRVVRNQKLGKKTWIYFDEMQLLLLDKYASDFFFKLWSRVRKYGASPTGITQNVETLLLDPNGRRIIANSEFMILLKQAKNDREELVQLLGLSKELEKYLVNPEKGAGLIKAGSVVVPFKNKIPQGTQLFDIMSTDPDKMASN
>AP018937.1|BBG37046.1|1031100_1031460_+|hypothetical-protein
MNTRVFKDISKYQHRAWLGFTTRQIIFVLPAFIVTIIVLGLNLFFWQFGDWFVYGFVFAFTIPLMLFGVYKPNDLYFEHYLKYRLHFELTVPLRTITGKKGSEHEKKIKYIKETKNFND
>AP018937.1|BBG37045.1|1030192_1031047_+|hypothetical-protein
MNLSLVSPFVYLASEKISAENLFEGFNVDLQSTVDLIKSLSSYNPTVWTYMSSITKSVMQPLGVAILSVVLILEFSKMAKKIANSGGAMTFEALAPMLISYIMVAVVITNTTVIVEAIIGIASHAIEQVASIVAHGGAKYDTISGLKGSGFIGRMIVGFFALLIWLVRIVSAAMVNLLVSIRFIQLYLMIPFAPLTIPTFLSDEWKSIGIGYLKNIMVYAVQGVLIFLIVSLVPLFESAGKIAVSNGAGVLQSLAIMFGSLIQAILLIIALVGSQRTARSILGM
>AP018937.1|BBG37044.1|1029933_1030176_+|hypothetical-protein
MFTHFKGFVYGVDASAMFAQAMSLLQKGLIAVGAFLVVVGIVNLATNIKDGGPGVRNAILEIVGGVMVGAAGAFVTQISI
>AP018937.1|BBG37043.1|1028032_1029913_+|hypothetical-protein
MMYSGKKFLLFSLLGILLGYLFHRLTLLYDSYTGNSLDKWTHLLMEGQDEVLQSPWNVSFTGKSSAFFLLGFVMMLLVYLYLETGKKQYREGVEYGSARFGTLKEKKLFYGKEFSHDTILAQDVRLTLLDKKPPQYDRNKNIAVIGGSGSGKTFRFVKPNLIQMNSSNIVVDPKDHLAEKTGKLFLENGYQVKVLDLVNMKNSDGFNPFRYIETENDLNRMLTVYFNNTKGSGSRSDPFWDEASMTLVRALASYLVDFYNPPKTREQLIEESRLSQKEYKNLLKRQKKEVEERKKRGRYPSFAEISKLIKHLSKGENQEKSVLEILFENYAKKYGTENFTMRNWADFQNYKDKTLDSVIAVTTAKFTLFNIQSVMDLTKRDTLDMKTWGKEKSMVYLVIPDNDSTFRFLSALFFSTVFQTLTRQADIDFKGQLPLHVRVYLDEFANIGEIPDFAEQTSTVRSRNMSLVPILQNIAQLQGLYKEKEAWKTILGNCDSLVYLGGNDEDTFKFMSGLLGKQTIDVRNTSRSFGQTGSGSLSHQKIARDLMTPDEVGNMKRHECLVRIANMPVFKSKKYNSTKHPNWRYLANQESDERWWNYQINPLNQNQENHLEGLRIRDLTFESSLK
>AP018937.1|BBG37042.1|1027547_1028036_+|hypothetical-protein
MSSEQQERMAVQYAERSLLFTVKSLLKILEWSRRQALAQDSAYKIGVQKLEELLQSPYAIDTINLKKDFLDKPIDIEKFKAFIEKEEIPLAIAWQGDSLHFYTKDRSILDNHLDHLLEKMVNDPEKLADFTMDKSLDDAIDEAKSQITFRQEGAVKQKEMVR
>AP018937.1|BBG37041.1|1027258_1027558_+|hypothetical-protein
MKVVNLYDLKQMGNKGGCTIQLIHHFPFGMGLGHLKKDYIEFKRVGIFDGKAVEVTLREPYSRDLLQVVKSIKQRQKLIAYRYKEGKLLFVKKEASDVL
>AP018937.1|BBG37040.1|1026139_1026976_+|hypothetical-protein
MFSNANSFKAKIKNISKDKGIPAQQVQQHYLIEQVLKMISTSPYRDSFIVKGGYLIGQMIGLDKRTTMDLDVTLKGTEMSRENLIHIFEEILCSKTDGFSFSVDKLEPIRQDDEYGGFSLKLNATFDTLKEVVFIDITTGDKITPREITYSMTSIFTNESIKIWTYNLETVLAEKLETIISRGLASTRPRDRYDLFTLYKLRKEEINLEVLKNALENTAEKRESKDTIYNWEEQVRGIEISDYQKELWIRYQRQFKYAKDISFDNSVQVIKEIMQQIF
>AP018937.1|BBG37039.1|1025549_1026140_+|hypothetical-protein
MVDKREKLMNYFNQYGFLTFKQVIDENLHYKTLLKMITEGKIDAEEKGLYRLPDIYLDEWFVLQYRFPKGIYSLETALWLHGLSLTIPFNMTMSFPYGTNTKNIKEADICPIILRSHYSEGIIEIERLPGQFIKVYEVERVLVECLRPVHQVDLQIIAPAFKKYFQQNQIHLHKLFYYAQLFKVTDKLQSYTEVLS
>AP018937.1|BBG37049.1|1036997_1038215_-|Transposase-from-transposon-Tn916
MSEKRRDNKGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSENGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYSKNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQAFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTFCTNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA
>AP018937.1|BBG37050.1|1038296_1038500_-|hypothetical-protein
MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKIIDTLDAI
>AP018937.1|BBG37051.1|1038960_1039191_-|hypothetical-protein
MKTQYPMIPFPLIVKATDGDTEAINQILHHYRGYITKRSLRLMKDEYGNQSMVVDEVLRGRMETRLITKILSFEIK
>AP018937.1|BBG37052.1|1039187_1039610_-|hypothetical-protein
MKPSSFQTTIENQFDYICKRAMEDERKNYMLYLSRIAKREVSFSDVGDYLVSQFATTDNYSTDFQIFTLNGLSVGVENDLLSEALRELPDKKREILLLFYFMDMSDSEIADLLKLNRSTVYRHRTSGLALIKKFMEEFEE
>AP018937.1|BBG37053.1|1040114_1040354_+|hypothetical-protein
MRKKEDKYDFRAFGLAIKEARLKRGLTREQVGALIEIDPRYLTNIENKGQHPSIQVLYDLVSLLHVSVDEFFLPGVPSA
>AP018937.1|BBG37054.1|1040409_1043328_-|hypothetical-protein
MAMKRILTTSQREQLLSVDHLSEEDFKAYFSFSDYDLEVINQHRGKVNKLGFAIQLCLARYPGCSLSNWPIKSTRLTSYVSRQLHLDAIDLNSYDHRNTRANHFNEILEVFNYHRFGSANTQKQLIEYLIELALENDDSIYLMKKTIDFLTRKRIIFPSIATLEDIISRCRDKAENNLFSILLCSLTDIQIEKLESLFQIYEETKITKLAWLKDIPGKANPESFMSICKKVEVIASMGLGTINVSHINRNRFLQLARLGENYDAYDFSRFELEKRYSLLIAFLVNHHQYLIDQLIEINDRILASIKRKGTRDSQEQLKEKGKLATKKLEHYASLIDALHFAKDNDSNPFDEIERIMPWEDLVQDGEEAKKITGNKNHGYLEMVRNKANYLRRYTPMLLRTLSFKATPAANPVLMALTQLTDLHNSGKRKIPADTSTDFVSKKWKSLVRPEEGKIDRSYYELVAFTELKNNIRSGDISVEGSMIHRNIDDYLVDLSACIDSETIPDTFEDYLKDREIILDLQLQFYSTVDKRISRANLKKLEKVTPSEAEIYRKKLYSIIPKIRLSDLLIEVDSWTNFSQEFSHDSTGKPPSEQERKIIFAALLGLGMNIGLEKMAQSTPGISYSQLANAKQWRFYKEALTRAQSVLVNYQLKLPVADFWGEGKTTASDGMRVPVGVSALKSDVNPHYKSMEKGATMIRSINDRHTTHHIEVASTNTREATHTLDGLLYHETDLDIEEHFTDTNGYSDQVFGMTALLGFDFEPRIRNIKKSQLFSIKSPSYYPNLSEDISGKINVKIIEENYDEIKRIAYSIQTGKVSSSLLLGKLGSYARKNRVALALRELGRIEKSIFMIDYITDSELRRRITHGLNKTEAINALARELFFGRRGKFMERDIRRQLQSASALNVLINAISIWNAVYLQAAYNYLVKIDPEVTKYMKHVSPINWEHITFLGEYKFDLLSIPKHLRELNIKNK
>AP018937.1|BBG37055.1|1043331_1043886_-|DNA-invertase-hin
MIFGYARVSTDDQNLSLQIDALTHYGIDKLFQEKVTGAKKDRPQLEEMINLLREGDSVVIYKLDRISRSTKHLIELSELFEELSVNFISIQDNVDTSTSMGRFFFRVMASLAELERDIIIERTNSGLKAARVRGKKGGRPSKGKLSIDLALKMYDSKEYSIRQILDASKLSKTTFYRYLNKRNA
>AP018937.1|BBG37056.1|1044104_1044236_-|hypothetical-protein
MSRFCKFGKLHVTKGNVDKLLGILLTASKELKRSLAPTGNLYR
>AP018937.1|BBG37057.1|1044240_1044978_-|rRNA-adenine-N-6-methyltransferase
MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTTKLAKISKQVTSIELDSHLFNLSSEKLKLNIRVTLIHQDILQFQFPNKQRYKIVGNIPYHLSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFHPKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNNLSTVTYEQVLSIFNSYLLFNGRK
>AP018937.1|BBG37058.1|1045902_1047822_-|Tetracycline-resistance-protein-TetM-from
MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKNNIGIDNLIEVITNKFYSSTHRGQSELCGKVFKIEYSEKRQRLAYIRLYSGVLHLRDSVRISEKEKIKITEMYTSINGELCKIDKAYSGEIVILQNEFLKLNSVLGDTKLLPQRERIENPLPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKVQMEVISALLQEKYHVEIELKEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLPLGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQVLKKAGTELLEPYLSFKIYAPQEYLSRAYNDAPKYCANIVDTQLKNNEVILSGEIPARCIQEYRSDLTFFTNGRSVCLTELKGYHVTTGEPVCQPRRPNSRIDKVRYMFNKIT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

40125 : 51581

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG36072.1\|40125_42279_+	Lactococcin-G-processing and transport	W8CYL7	Bacillus_phage	4.0e-44	27.8
BBG36073.1\|42291_43641_+	Lactococcin A secretion protein LcnD	NA	NA	NA	NA
BBG36074.1\|43810_44518_+	Phosphoribosylaminoimidazole-succinocarboxamide	A0A1D8KNF0	Synechococcus_phage	1.0e-41	39.2
BBG36075.1\|44719_48445_+	Phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	5.6e-38	25.9
BBG36076.1\|48537_49980_+	Amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.7e-55	35.1
BBG36077.1\|50016_51039_+	Phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	7.3e-65	43.9
BBG36078.1\|51035_51581_+	Phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	7.4e-24	35.0

DBSCAN-SWA_2

738810 : 746152

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG36763.1\|738810_739338_-	hypothetical protein	A0A1S5SBP9	Streptococcus_phage	6.4e-89	95.4
BBG36764.1\|739334_739622_-	hypothetical protein	A0A1S5SBP9	Streptococcus_phage	8.7e-24	71.8
BBG36765.1\|739618_740137_-	hypothetical protein	A0A1S5SBP9	Streptococcus_phage	1.7e-81	95.5
BBG36766.1\|740330_740828_+	Free methionine-R-sulfoxide reductase	NA	NA	NA	NA
BBG36767.1\|740827_742483_+	DNA polymerase III subunit tau	A0A1L2BWV7	Bacteriophage	1.1e-46	33.5
BBG36768.1\|742510_742705_+	hypothetical protein	NA	NA	NA	NA
BBG36769.1\|742854_743625_+	putative ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.5e-09	28.5
BBG36770.1\|743652_744915_+	FeS cluster assembly protein SufB	NA	NA	NA	NA
BBG36771.1\|744925_746152_+	Cysteine desulfurase SufS	Q2XUY6	environmental_halophage	2.5e-104	44.8

DBSCAN-SWA_3

807932 : 818328

Streptococcus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG36827.1\|807932_808841_+	HTH-type transcriptional regulator CysB	A0A2P0ZL89	Lactobacillus_phage	5.2e-06	27.7
BBG36828.1\|808837_809299_+	Lipoprotein signal peptidase	NA	NA	NA	NA
BBG36829.1\|809288_810176_+	Ribosomal large subunit pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	1.3e-09	28.0
BBG36830.1\|810178_812062_+	Autolysin	Q332B9	Clostridium_botulinum_C_phage	9.5e-10	23.7
BBG36831.1\|812162_813272_+	Glutamate 5-kinase 1	A0A1X9I5D0	Streptococcus_phage	1.4e-114	58.4
BBG36832.1\|813281_814544_+	Gamma-glutamyl phosphate reductase	A0A1X9I5D4	Streptococcus_phage	7.2e-139	64.0
BBG36833.1\|814547_815345_+	Pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	8.0e-59	50.2
BBG36834.1\|815564_816203_+	Thymidylate kinase	M1PSC7	Streptococcus_phage	9.8e-76	68.1
BBG36835.1\|816199_817090_+	DNA polymerase III subunit gamma/tau	M1NSC1	Streptococcus_phage	5.4e-72	51.0
BBG36836.1\|817129_817447_+	Initiation-control protein YabA	M1PFV3	Streptococcus_phage	2.9e-28	60.0
BBG36837.1\|817449_818328_+	Ribosomal RNA small subunit methyltransferase I	M1PLC5	Streptococcus_phage	8.7e-115	75.4

DBSCAN-SWA_4

1033779 : 1067164

Streptococcus_phage(82.61%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG37048.1\|1033779_1036593_+	N-acetylmuramoyl-L-alanine amidase	Q4Z9D9	Staphylococcus_phage	1.2e-08	40.4
BBG37049.1\|1036997_1038215_-	Transposase from transposon Tn916	A0A1S5SEW7	Streptococcus_phage	3.7e-233	100.0
BBG37050.1\|1038296_1038500_-	hypothetical protein	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
BBG37051.1\|1038960_1039191_-	hypothetical protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
BBG37052.1\|1039187_1039610_-	hypothetical protein	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
BBG37053.1\|1040114_1040354_+	hypothetical protein	A0A1S5SFA6	Streptococcus_phage	9.1e-35	100.0
BBG37054.1\|1040409_1043328_-	hypothetical protein	A0A1B0V7H9	Salmonella_phage	1.1e-169	36.1
BBG37055.1\|1043331_1043886_-	DNA-invertase hin	A0A0F7LA37	Escherichia_phage	2.3e-36	52.1
BBG37056.1\|1044104_1044236_-	hypothetical protein	E4ZFP9	Streptococcus_phage	8.2e-14	90.7
BBG37057.1\|1044240_1044978_-	rRNA adenine N-6-methyltransferase	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
BBG37058.1\|1045902_1047822_-	Tetracycline resistance protein TetM from	A0A1S5SF82	Streptococcus_phage	0.0e+00	98.1
BBG37059.1\|1048198_1049116_-	hypothetical protein	A0A1S5SF22	Streptococcus_phage	1.0e-166	99.0
BBG37060.1\|1049130_1050132_-	putative endopeptidase p60	A0A1S5SEZ8	Streptococcus_phage	6.5e-191	99.7
BBG37061.1\|1050128_1052240_-	hypothetical protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	99.9
BBG37062.1\|1052308_1054756_-	hypothetical protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	99.8
BBG37063.1\|1054739_1055246_-	hypothetical protein	A0A1S5SEX7	Streptococcus_phage	8.6e-91	100.0
BBG37064.1\|1055220_1055718_-	hypothetical protein	A0A1S5SF25	Streptococcus_phage	4.9e-91	99.4
BBG37065.1\|1055834_1056056_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
BBG37066.1\|1056403_1057303_-	hypothetical protein	A0A1S5SEX3	Streptococcus_phage	3.9e-155	100.0
BBG37067.1\|1057480_1058866_-	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
BBG37068.1\|1058894_1059278_-	hypothetical protein	A0A1S5SF96	Streptococcus_phage	2.3e-64	100.0
BBG37069.1\|1059296_1059611_-	hypothetical protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
BBG37070.1\|1060487_1060898_+	hypothetical protein	NA	NA	NA	NA
BBG37071.1\|1060945_1067164_+	hypothetical protein	A0A248SL14	Klebsiella_phage	4.6e-218	30.4

DBSCAN-SWA_5

1080004 : 1088009

Streptococcus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG37089.1\|1080004_1080688_+	HTH-type transcriptional regulator PrtR	E8ZDN4	Streptococcus_phage	8.3e-65	52.7
BBG37090.1\|1080690_1082106_+	DNA polymerase IV	M1Q231	Streptococcus_phage	6.8e-202	72.8
BBG37091.1\|1082105_1082468_+	hypothetical protein	A0A1B0RXA8	Streptococcus_phage	1.1e-20	45.0
BBG37092.1\|1082457_1082748_+	hypothetical protein	Q6DMX6	Streptococcus_phage	3.1e-21	52.7
BBG37093.1\|1083042_1083399_+	hypothetical protein	NA	NA	NA	NA
BBG37094.1\|1083403_1083769_+	hypothetical protein	NA	NA	NA	NA
BBG37095.1\|1083755_1085585_+	hypothetical protein	A0A1B0RXG0	Streptococcus_phage	3.6e-06	37.5
BBG37096.1\|1085688_1085916_+	hypothetical protein	A0A0A7RUJ5	Clostridium_phage	1.0e-06	46.9
BBG37097.1\|1086182_1086416_+	hypothetical protein	W6LM55	Streptococcus_phage	4.6e-15	50.7
BBG37098.1\|1086500_1088009_+	Transposase from transposon Tn916	M1NRJ9	Streptococcus_phage	8.4e-25	27.6

DBSCAN-SWA_6

1328412 : 1334189

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG37350.1\|1328412_1329024_+	Peptide deformylase	E3SLL2	Synechococcus_phage	4.9e-16	42.4
BBG37351.1\|1329068_1329797_+\|tRNA	Putative TrmH family tRNA/rRNA	NA	NA	NA	NA
BBG37352.1\|1329834_1330746_-	Thioredoxin reductase	G3MA85	Bacillus_virus	2.9e-89	51.5
BBG37353.1\|1330811_1331036_-	hypothetical protein	NA	NA	NA	NA
BBG37354.1\|1331113_1331857_-	L-cystine import ATP-binding protein TcyN	G9BWD6	Planktothrix_phage	1.6e-29	41.0
BBG37355.1\|1331856_1332657_-	putative amino-acid permease protein YxeN	NA	NA	NA	NA
BBG37356.1\|1332814_1333171_-	Regulatory protein MgsR	M1PLC0	Streptococcus_phage	1.2e-33	57.3
BBG37357.1\|1333164_1333695_-	Methylated-DNA--protein-cysteine	M1PFU9	Streptococcus_phage	1.4e-46	54.3
BBG37358.1\|1333694_1334189_-	hypothetical protein	M1PSC3	Streptococcus_phage	1.9e-42	52.1

DBSCAN-SWA_7

1424574 : 1431328

Streptococcus_phage(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG37449.1\|1424574_1425543_+	Ferredoxin--NADP reductase 2	Q9JRK7	Streptococcus_phage	4.8e-66	99.2
BBG37450.1\|1425576_1426488_-	Putative sporulation transcription regulator	Q7AWZ3	Streptococcus_phage	1.5e-154	99.7
BBG37451.1\|1426484_1427462_-	Putative gluconeogenesis factor	A1IMD5	Streptococcus_phage	5.7e-184	99.7
BBG37452.1\|1427458_1428349_-	Nucleotide-binding protein YvcJ	A0A0R8VB27	Thermobifida_phage	5.1e-06	29.8
BBG37453.1\|1428400_1428781_-	2-iminobutanoate/2-iminopropanoate deaminase	NA	NA	NA	NA
BBG37454.1\|1428791_1429379_-	putative GTP-binding protein EngB	NA	NA	NA	NA
BBG37455.1\|1429387_1430620_-\|protease	ATP-dependent Clp protease ATP-binding subunit	G3M9Z9	Bacillus_virus	4.2e-131	59.0
BBG37456.1\|1430651_1430822_-	hypothetical protein	NA	NA	NA	NA
BBG37457.1\|1430821_1431328_-	Dihydrofolate reductase	G3MBI7	Bacillus_virus	6.7e-27	42.5

DBSCAN-SWA_8

1675174 : 1682506

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG37703.1\|1675174_1675876_+	UDP-glucose 4-epimerase	A0A2K9L1R4	Tupanvirus	1.6e-34	36.5
BBG37704.1\|1676298_1677258_+	Iron-uptake system permease protein FeuB	A0A2H4IY97	uncultured_Caudovirales_phage	2.4e-57	40.8
BBG37705.1\|1677247_1678204_+	Ferric enterobactin transport system permease	NA	NA	NA	NA
BBG37706.1\|1678200_1678953_+	Iron(3+)-hydroxamate import ATP-binding protein	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.4e-12	30.2
BBG37707.1\|1679048_1680014_+	putative ABC transporter solute-binding protein	NA	NA	NA	NA
BBG37708.1\|1680238_1680481_-	Putative membrane protein insertion efficiency	A0A2H4PQM5	Staphylococcus_phage	1.3e-17	59.4
BBG37709.1\|1680480_1681203_-	Ribosomal large subunit pseudouridine synthase	NA	NA	NA	NA
BBG37710.1\|1681189_1681759_-	Segregation and condensation protein B	A0A1B1IVT7	uncultured_Mediterranean_phage	5.0e-15	34.9
BBG37711.1\|1681777_1682506_-	Segregation and condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	9.0e-09	22.3

DBSCAN-SWA_9

2036148 : 2044902

Bacillus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBG38040.1\|2036148_2036988_-	Energy-coupling factor transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.1e-15	32.6
BBG38041.1\|2036972_2037800_-	Energy-coupling factor transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.6e-17	33.3
BBG38042.1\|2037796_2038342_-	CDP-diacylglycerol--glycerol-3-phosphate	NA	NA	NA	NA
BBG38043.1\|2038352_2039174_-	Cytoskeleton protein RodZ	NA	NA	NA	NA
BBG38044.1\|2039215_2040499_-\|protease	putative zinc protease	A0A1E1EST3	Acanthamoeba_castellanii_mimivirus	1.9e-17	29.5
BBG38045.1\|2040495_2041746_-\|protease	putative zinc protease	A0A1X9I714	Streptococcus_phage	2.0e-93	42.3
BBG38046.1\|2041904_2042273_+	hypothetical protein	A0A1X9I5V8	Streptococcus_phage	7.0e-18	57.3
BBG38047.1\|2042275_2043373_+	DNA replication and repair protein RecF	NA	NA	NA	NA
BBG38048.1\|2043423_2044902_-	Inosine-5'-monophosphate dehydrogenase	A0A1V0SHK8	Klosneuvirus	2.2e-94	40.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. AP018937

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection