CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
AP018409	Lactobacillus plantarum plasmid pSN35N-4 SN35N DNA, complete genome	0 crisprs	NA	0	0	1
AP018408	Lactobacillus plantarum plasmid pSN35N-3 SN35N DNA, complete genome	0 crisprs	NA	0	0	1
AP018406	Lactobacillus plantarum plasmid pSN35N-1 SN35N DNA, complete genome	0 crisprs	NA	0	0	0
AP018405	Lactobacillus plantarum SN35N DNA, complete genome	1 crisprs	RT,DEDDh,cas3,DinG,csa3,csn2,cas2,cas1,cas9,WYL	1	20	19
AP018407	Lactobacillus plantarum plasmid pSN35N-2 SN35N DNA, complete genome	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3070 : 60741

Streptococcus_phage(20.0%)

transposase,integrase

attL 108:167|attR 61111:64739

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
108:167	attL	NA	NA	NA	NA
BBA83623.1\|3070_4000_-\|transposase	transposase, IS30 family	H7BW47	unidentified_phage	2.3e-25	34.4
BBA83624.1\|4773_6000_+\|transposase	transposase	A0A1X9I619	Streptococcus_phage	1.1e-88	48.3
BBA83625.1\|6226_6373_-	hypothetical protein	NA	NA	NA	NA
BBA83626.1\|7296_8013_-	extracellular protein	K4ID66	Lactobacillus_phage	3.6e-10	55.7
BBA83627.1\|8395_9361_-\|transposase	transposase InsI for insertion sequence element IS30A	W5R8L2	Staphylococcus_phage	1.1e-43	36.3
BBA83628.1\|9777_10974_+	glycine/betaine/carnitine ABC transporter, ATP-binding subunit	G3M9Y6	Bacillus_virus	9.9e-29	36.4
BBA83629.1\|10973_11813_+	glycine/betaine ABC transporter	NA	NA	NA	NA
BBA83630.1\|11859_12738_+	glycine/betaine/carnitine ABC transporter, substrate-binding lipoprotein precursor	NA	NA	NA	NA
BBA83631.1\|12983_13949_-\|transposase	transposase	W5R8L2	Staphylococcus_phage	1.1e-25	28.8
BBA83632.1\|14098_14788_+\|transposase	transposase, IS30 family	H7BVY4	unidentified_phage	1.2e-10	27.2
BBA83633.1\|15066_15366_-	uncharacterized protein	NA	NA	NA	NA
BBA83634.1\|15367_16228_-	RepB	F0PIG8	Enterococcus_phage	1.7e-43	40.2
BBA83635.1\|17174_17507_+	hypothetical protein	NA	NA	NA	NA
BBA83636.1\|17956_18253_-\|transposase	transposase	NA	NA	NA	NA
BBA83637.1\|19031_19313_+	antitoxin of toxin-antitoxin stability system, RelB family	NA	NA	NA	NA
BBA83638.1\|19302_19809_+	addiction module toxin, PemK-like protein	NA	NA	NA	NA
BBA83639.1\|20445_20655_+\|transposase	transposase	NA	NA	NA	NA
BBA83640.1\|20718_20967_+	manganese transport protein	NA	NA	NA	NA
BBA83641.1\|21123_22032_+	magnesium and cobalt transport protein corA	NA	NA	NA	NA
BBA83642.1\|23123_23420_+\|transposase	transposase	NA	NA	NA	NA
BBA83643.1\|24082_24361_-	hypothetical protein	NA	NA	NA	NA
BBA83644.1\|24383_24626_-	hypothetical protein	NA	NA	NA	NA
BBA83645.1\|24879_26928_+	conjugal transfer protein traA	NA	NA	NA	NA
BBA83646.1\|27024_29160_+	DNA topoisomerase	A0A1X9I6W8	Streptococcus_phage	1.6e-109	46.8
BBA83647.1\|29282_29498_+	hypothetical protein	NA	NA	NA	NA
BBA83648.1\|29501_30626_+	uncharacterized protein pXO2-81/BXB0111/GBAA_pXO2_0111	NA	NA	NA	NA
BBA83649.1\|30649_31036_-	hypothetical protein	NA	NA	NA	NA
BBA83650.1\|31028_31349_-	hypothetical protein	NA	NA	NA	NA
BBA83651.1\|31341_32643_-	possible DNA-directed DNA polymerase	M1Q231	Streptococcus_phage	4.6e-80	39.1
BBA83652.1\|33167_33533_-	type I restriction-modification system, specificity subunit	A0A2H4PQP5	Staphylococcus_phage	1.7e-08	33.9
BBA83653.1\|33567_34497_-\|transposase	transposase, IS30 family	H7BW47	unidentified_phage	3.0e-25	34.4
BBA83654.1\|34660_36256_+	L-aspartate-beta-decarboxylase	A0A1X6WGT4	Pacmanvirus	2.1e-05	24.1
BBA83655.1\|36269_37928_+	aspartate/alanine antiporter	NA	NA	NA	NA
BBA83656.1\|38017_38227_-	uncharacterized protein	NA	NA	NA	NA
BBA83657.1\|38312_38993_-\|transposase	IS1216 transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-127	99.6
BBA83658.1\|39054_39366_+	uncharacterized protein pXO2-81/BXB0111/GBAA_pXO2_0111	NA	NA	NA	NA
BBA83659.1\|39631_39850_-\|transposase	transposase	NA	NA	NA	NA
BBA83660.1\|39937_40264_+\|transposase	transposase	NA	NA	NA	NA
BBA83661.1\|40308_40575_+	multidrug efflux pump protein	NA	NA	NA	NA
BBA83662.1\|40649_42917_-	cation transport ATPase	E4ZFI9	Streptococcus_phage	2.7e-59	30.1
BBA83663.1\|43167_43599_-	transcriptional regulator	NA	NA	NA	NA
BBA83664.1\|44184_44796_+	resolvase	M9Q1K0	Clostridium_phage	4.7e-19	34.0
BBA83665.1\|44895_46932_+	potassium uptake protein	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	2.3e-62	33.3
BBA83666.1\|47314_47752_+	transcription regulator	NA	NA	NA	NA
BBA83667.1\|48129_48684_+	DNA invertase	A0A1J1J8Z4	Escherichia_phage	8.9e-33	45.1
BBA83668.1\|49229_49661_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	1.3e-18	39.7
BBA83669.1\|49633_50005_-\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-28	54.1
BBA83670.1\|50117_50273_+	HD domain protein	NA	NA	NA	NA
BBA83671.1\|50377_50737_+	HD domain protein	A0A1Q1PP35	Noumeavirus	6.6e-05	33.7
BBA83672.1\|51525_51963_+	NrdI family protein	NA	NA	NA	NA
BBA83673.1\|51969_54138_+	ribonucleoside-diphosphate reductase	A8E2R1	Enterococcus_phage	2.1e-255	60.5
BBA83674.1\|54244_55171_+	ribonucleoside-diphosphate reductase beta subunit	A0A2H4P8A9	Corynebacterium_phage	1.9e-35	31.4
BBA83675.1\|55185_56136_+	ribonucleoside-diphosphate reductase beta subunit	A0A096XT60	Enterococcus_phage	9.4e-99	54.6
BBA83676.1\|56263_57076_-\|integrase	integrase	Q716C2	Shigella_phage	9.4e-15	29.0
BBA83677.1\|57189_57822_+	DNA integration/recombination/inversion protein	A0A286S1P7	Klebsiella_phage	3.6e-14	33.2
BBA83678.1\|58004_58934_+\|transposase	transposase, IS30 family	H7BW47	unidentified_phage	2.3e-25	34.4
BBA83679.1\|58955_59858_+	YitT family protein	M1Q1P6	Streptococcus_phage	8.2e-52	40.3
BBA83680.1\|59965_60337_+\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-28	54.1
BBA83681.1\|60309_60741_+\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	1.3e-18	39.7
61111:64739	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. AP018408

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2411 : 10486

Staphylococcus_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA83579.1\|2411_3587_+\|transposase	transposase	A0A0N9STL0	Staphylococcus_phage	6.3e-28	29.6
BBA83580.1\|3784_4354_-\|transposase	transposase	Q6J1X2	Lactobacillus_phage	2.4e-33	50.4
BBA83581.1\|4579_5509_-\|transposase	transposase, IS30 family	H7BVY4	unidentified_phage	5.2e-25	29.8
BBA83582.1\|5703_6879_+\|transposase	transposase	A0A0N9STL0	Staphylococcus_phage	6.3e-28	29.6
BBA83583.1\|7027_7249_-	uncharacterized protein	A0A1P8CWP5	Bacillus_phage	5.5e-10	45.5
BBA83584.1\|7362_8820_-	EpsN protein	NA	NA	NA	NA
BBA83585.1\|8975_9410_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.1e-25	44.2
BBA83586.1\|9467_9896_-\|transposase	IS30 family transposase	NA	NA	NA	NA
BBA83587.1\|9976_10486_-	EpsM	A0A2P1ELT8	Moumouvirus	7.7e-07	26.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. AP018405

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: AP018405_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

AP018405_2

1552980-1553478

TypeII

Consensus_repeat	Method
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CRT

7 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of AP018405_2

>merge|AP018405|2|1552980-1553478|PILER-CR,CRISPRCasFinder,CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGACTCCTTTCCTTATATATGTTTATAGTATAGCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACTACGGTACTCAATTACGATTAGATAATACAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGTAATTGTGGCTACGGCATTCTTAATTTGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACGTAATTGTGGCTACGGCATTCTTAATTTGAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCCTTGCAAGCACCGCTGCTGCCACAAACGTGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCACCCTCGTGGTTCGACACAGCCTTTTCAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCAGCCCAATTCTCACCAGCAGAACTAGAAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>AP018405|2|1|1552980-1553478|PILER-CR
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCCTTTCCTTATATATGTTTATAGTATAGC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACGGTACTCAATTACGATTAGATAATACAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGTGGCTACGGCATTCTTAATTTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGTGGCTACGGCATTCTTAATTTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CCTTGCAAGCACCGCTGCTGCCACAAACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CACCCTCGTGGTTCGACACAGCCTTTTCAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAGCCCAATTCTCACCAGCAGAACTAGAAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>AP018405|2|1|1552980-1553478|CRISPRCasFinder
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCCTTTCCTTATATATGTTTATAGTATAGC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACGGTACTCAATTACGATTAGATAATACAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGTGGCTACGGCATTCTTAATTTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGTGGCTACGGCATTCTTAATTTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CCTTGCAAGCACCGCTGCTGCCACAAACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CACCCTCGTGGTTCGACACAGCCTTTTCAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAGCCCAATTCTCACCAGCAGAACTAGAAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

>AP018405|2|2|1552980-1553478|CRT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TCCTTTCCTTATATATGTTTATAGTATAGC
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	TACGGTACTCAATTACGATTAGATAATACAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGTGGCTACGGCATTCTTAATTTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	GTAATTGTGGCTACGGCATTCTTAATTTGA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CCTTGCAAGCACCGCTGCTGCCACAAACGT
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CACCCTCGTGGTTCGACACAGCCTTTTCAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC	CAGCCCAATTCTCACCAGCAGAACTAGAAA
GTTCTAAACCTGTTTGATATGACTACTATTCAAGAC

Protein	Signature genes	Signature genes Name	Protein_function
AP018405.1\|BBA81877.1\|1563727_1565320_-\|DNA-binding-protein-with-HIRAN-domain	unknown	unknown	gnl\|CDD\|214906
AP018405.1\|BBA81863.1\|1547008_1547431_-\|small-heat-shock-protein	unknown	unknown	gnl\|CDD\|107228
AP018405.1\|BBA81861.1\|1544563_1545796_-\|MFS-family-major-facilitator-transporter	unknown	unknown	gnl\|CDD\|340949
AP018405.1\|BBA81867.1\|1549067_1549826_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
AP018405.1\|BBA81874.1\|1560731_1561439_-\|hypothetical-protein	unknown	unknown	unknown
AP018405.1\|BBA81878.1\|1565563_1566304_-\|glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|224982
AP018405.1\|BBA81869.1\|1553502_1554180_-\|CRISPR-type-II-A/NMEMI-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
AP018405.1\|BBA81876.1\|1563141_1563612_+\|NTP-pyrophosphohydrolase	unknown	unknown	gnl\|CDD\|240033
AP018405.1\|BBA81871.1\|1554459_1555365_-\|CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
AP018405.1\|BBA81872.1\|1555559_1559636_-\|hypothetical-protein	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
AP018405.1\|BBA81866.1\|1548830_1549025_+\|stress-responsive-transcription-regulator	unknown	unknown	gnl\|CDD\|377200
AP018405.1\|BBA81868.1\|1550110_1552849_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
AP018405.1\|BBA81859.1\|1542915_1544109_-\|transport-protein	unknown	unknown	gnl\|CDD\|340897
AP018405.1\|BBA81862.1\|1546465_1546921_+\|two-component-system-sensor-protein	unknown	unknown	gnl\|CDD\|378668
AP018405.1\|BBA81864.1\|1547576_1548050_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
AP018405.1\|BBA81870.1\|1554176_1554482_-\|CRISPR-associated-endoribonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
AP018405.1\|BBA81873.1\|1559924_1560707_-\|alpha-beta-hydrolase-superfamily	unknown	unknown	gnl\|CDD\|223669
AP018405.1\|BBA81875.1\|1561544_1562909_-\|transport-protein	unknown	unknown	gnl\|CDD\|182694
AP018405.1\|BBA81865.1\|1548162_1548765_+\|NADPH-dependent-FMN-reductase-family-protein	unknown	unknown	gnl\|CDD\|377026
AP018405.1\|BBA81860.1\|1544173_1544503_-\|transcription-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042

Protein	Function_ID	Function_description	E-value
AP018405.1\|BBA81877.1\|1563727_1565320_-\|DNA-binding-protein-with-HIRAN-domain	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.41904e-17
AP018405.1\|BBA81863.1\|1547008_1547431_-\|small-heat-shock-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.67238e-43
AP018405.1\|BBA81861.1\|1544563_1545796_-\|MFS-family-major-facilitator-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
AP018405.1\|BBA81867.1\|1549067_1549826_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.05874e-91
AP018405.1\|BBA81878.1\|1565563_1566304_-\|glutamine-amidotransferase	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
AP018405.1\|BBA81869.1\|1553502_1554180_-\|CRISPR-type-II-A/NMEMI-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.34637e-80
AP018405.1\|BBA81876.1\|1563141_1563612_+\|NTP-pyrophosphohydrolase	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
AP018405.1\|BBA81871.1\|1554459_1555365_-\|CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.41428e-89
AP018405.1\|BBA81872.1\|1555559_1559636_-\|hypothetical-protein	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.66373e-128
AP018405.1\|BBA81866.1\|1548830_1549025_+\|stress-responsive-transcription-regulator	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
AP018405.1\|BBA81868.1\|1550110_1552849_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
AP018405.1\|BBA81859.1\|1542915_1544109_-\|transport-protein	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6578e-118
AP018405.1\|BBA81862.1\|1546465_1546921_+\|two-component-system-sensor-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	1.50722e-25
AP018405.1\|BBA81864.1\|1547576_1548050_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000255443
AP018405.1\|BBA81870.1\|1554176_1554482_-\|CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
AP018405.1\|BBA81873.1\|1559924_1560707_-\|alpha-beta-hydrolase-superfamily	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.26017e-25
AP018405.1\|BBA81875.1\|1561544_1562909_-\|transport-protein	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
AP018405.1\|BBA81865.1\|1548162_1548765_+\|NADPH-dependent-FMN-reductase-family-protein	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.2024e-30
AP018405.1\|BBA81860.1\|1544173_1544503_-\|transcription-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.17836e-13

>AP018405.1|BBA81868.1|1550110_1552849_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTLALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>AP018405.1|BBA81867.1|1549067_1549826_-|purine-nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLAAIELAVESLAAY
>AP018405.1|BBA81866.1|1548830_1549025_+|stress-responsive-transcription-regulator
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>AP018405.1|BBA81865.1|1548162_1548765_+|NADPH-dependent-FMN-reductase-family-protein
MFKIAIILGSTRSQANGRALLNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>AP018405.1|BBA81864.1|1547576_1548050_-|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDATIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>AP018405.1|BBA81863.1|1547008_1547431_-|small-heat-shock-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAANKITASQADGVLTITLPKTQPSANDGQIEIQ
>AP018405.1|BBA81862.1|1546465_1546921_+|two-component-system-sensor-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSFLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>AP018405.1|BBA81861.1|1544563_1545796_-|MFS-family-major-facilitator-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>AP018405.1|BBA81860.1|1544173_1544503_-|transcription-regulator
MMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL
>AP018405.1|BBA81859.1|1542915_1544109_-|transport-protein
MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSSMAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGTLLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPLTMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFGLQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMIMVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADLSGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE
>AP018405.1|BBA81869.1|1553502_1554180_-|CRISPR-type-II-A/NMEMI-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGVHFPTELMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>AP018405.1|BBA81870.1|1554176_1554482_-|CRISPR-associated-endoribonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>AP018405.1|BBA81871.1|1554459_1555365_-|CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGAQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>AP018405.1|BBA81872.1|1555559_1559636_-|hypothetical-protein
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRIKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVSDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>AP018405.1|BBA81873.1|1559924_1560707_-|alpha-beta-hydrolase-superfamily
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRTVDAHELIEKLQLKQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSVAFNKALLEFLATC
>AP018405.1|BBA81874.1|1560731_1561439_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEVLSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSKAGLDDKTRQWLEKLKKLTPQDFNDHVE
>AP018405.1|BBA81875.1|1561544_1562909_-|transport-protein
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>AP018405.1|BBA81876.1|1563141_1563612_+|NTP-pyrophosphohydrolase
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>AP018405.1|BBA81877.1|1563727_1565320_-|DNA-binding-protein-with-HIRAN-domain
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>AP018405.1|BBA81878.1|1565563_1566304_-|glutamine-amidotransferase
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
AP018405_1	1.23\|476864\|31\|AP018405\|CRT	476864-476894	31	AP018405.1	475034-475064	2	0.935

1. spacer 1.23|476864|31|AP018405|CRT matches to position: 475034-475064, mismatch: 2, identity: 0.935

gtctgagtccgaatcactatcggaatccgaa	CRISPR spacer
gtctgagtccgagtcactgtcggaatccgaa	Protospacer
************.*****.************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156736-156760	0	1.0
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156886-156910	0	1.0
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1867-1891	0	1.0
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2239-2263	0	1.0
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	NZ_CP053341	Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence	16028-16057	0	1.0
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	NZ_CP031786	Lactobacillus paracasei strain 10266 plasmid pLP10266, complete sequence	21010-21039	0	1.0
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	NZ_CP032461	Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence	34303-34332	0	1.0
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	NZ_CP015860	Lactobacillus plantarum strain LZ227 plasmid LZ227p2, complete sequence	20777-20806	0	1.0
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	NZ_CP042384	Leuconostoc pseudomesenteroides strain CBA3630 plasmid unnamed1, complete sequence	32862-32891	0	1.0
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	NZ_CP023773	Lactobacillus plantarum strain PC520 plasmid p1, complete sequence	12850-12879	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	20598-20627	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP037432	Lactobacillus plantarum strain EM plasmid pEM3, complete sequence	32627-32656	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035575	Lactobacillus plantarum strain SRCM103303 plasmid unnamed4	27690-27719	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP021530	Pediococcus acidilactici strain SRCM101189 plasmid pPL1189-1, complete sequence	48837-48866	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP013756	Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence	12582-12611	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP013756	Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence	60652-60681	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032745	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence	40148-40177	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP021475	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-4, complete sequence	29655-29684	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP021475	Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-4, complete sequence	46228-46257	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP023492	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed2, complete sequence	1512-1541	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP017364	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-1, complete sequence	49642-49671	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP020096	Lactobacillus plantarum strain K25 plasmid unnamed3, complete sequence	32068-32097	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP020097	Lactobacillus plantarum strain K25 plasmid unnamed4, complete sequence	57768-57797	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP018765	Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence	37077-37106	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP023007	Pediococcus pentosaceus strain SS1-3 plasmid pSS1301, complete sequence	1861-1890	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP026507	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed2, complete sequence	36180-36209	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP047124	Lactobacillus hilgardii strain FLUB plasmid unnamed3	4622-4651	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP047124	Lactobacillus hilgardii strain FLUB plasmid unnamed3	18770-18799	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP013155	Lactobacillus plantarum strain MF1298 plasmid pMF1298-5, complete sequence	801-830	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP053338	Lactobacillus paraplantarum strain CK401 plasmid pCK401A, complete sequence	13087-13116	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP021485	Pediococcus acidilactici strain SRCM100424 plasmid pPl424-1, complete sequence	54214-54243	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035561	Lactobacillus plantarum strain SRCM103297 plasmid unnamed5	2315-2344	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035561	Lactobacillus plantarum strain SRCM103297 plasmid unnamed5	43968-43997	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035177	Lactobacillus plantarum strain SRCM103426 plasmid unnamed3	24586-24615	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028248	Pediococcus acidilactici strain SRCM102731 plasmid unnamed1, complete sequence	14587-14616	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028270	Pediococcus pentosaceus strain SRCM102740 plasmid unnamed1, complete sequence	55134-55163	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028267	Pediococcus pentosaceus strain SRCM102739 plasmid unnamed1, complete sequence	41840-41869	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028265	Pediococcus pentosaceus strain SRCM102738 plasmid unnamed1, complete sequence	7035-7064	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028250	Pediococcus acidilactici strain SRCM102732 plasmid unnamed1, complete sequence	39025-39054	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP023493	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence	39444-39473	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP017357	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-3, complete sequence	26600-26629	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035155	Pediococcus acidilactici strain SRCM103387 plasmid unnamed1	3632-3661	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP013752	Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence	32944-32973	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP017381	Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence	15391-15420	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP012652	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK04, complete sequence	11563-11592	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP023177	Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence	2142-2171	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP026509	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed4, complete sequence	14313-14342	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP047125	Lactobacillus hilgardii strain FLUB plasmid unnamed4	5096-5125	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP048923	Lactobacillus plantarum strain X7022 plasmid unnamed2, complete sequence	37049-37078	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028336	Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence	2141-2170	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028231	Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence	18369-18398	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NC_020826	Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence	30222-30251	0	1.0
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP021488	Pediococcus acidilactici strain SRCM100313 plasmid pPl313-1, complete sequence	63480-63509	0	1.0
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151531-151555	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151567-151591	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151603-151627	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153100-153124	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153544-153568	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154006-154030	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154150-154174	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156448-156472	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156958-156982	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157624-157648	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1003-1027	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2407-2431	1	0.96
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3295-3319	1	0.96
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155506-155536	1	0.968
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156286-156316	1	0.968
AP018405_2	2.3\|1553149\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553149-1553178	30	AY682195	Lactobacillus plantarum bacteriophage LP65, complete genome	8592-8621	1	0.967
AP018405_2	2.3\|1553149\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553149-1553178	30	NC_006565	Lactobacillus phage LP65, complete genome	8592-8621	1	0.967
AP018405_2	2.4\|1553215\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553215-1553244	30	AY682195	Lactobacillus plantarum bacteriophage LP65, complete genome	8592-8621	1	0.967
AP018405_2	2.4\|1553215\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553215-1553244	30	NC_006565	Lactobacillus phage LP65, complete genome	8592-8621	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP014913	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence	33902-33931	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP022131	Lactobacillus pentosus strain SLC13 plasmid pSLC13, complete sequence	14649-14678	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP017068	Lactobacillus plantarum strain LP3 plasmid pLB302, complete sequence	4552-4581	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP017375	Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-1, complete sequence	37685-37714	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP014931	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-7, complete sequence	17004-17033	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP027192	Lactobacillus sp. CBA3605 plasmid pCBA3605-2, complete sequence	9390-9419	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_LT960786	Lactobacillus sakei isolate MFPB19 plasmid 3, complete sequence	5802-5831	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP019984	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence	12851-12880	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP019984	Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence	27454-27483	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NC_008498	Lactobacillus brevis ATCC 367 plasmid 1, complete sequence	6154-6183	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	4292-4321	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP017960	Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence	18311-18340	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP020461	Lactobacillus sakei strain FAM18311 plasmid pFAM18311_2	19405-19434	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP031176	Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_B, complete sequence	24577-24606	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP035146	Lactobacillus plantarum strain SRCM103357 plasmid unnamed3	46455-46484	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP028262	Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence	56291-56320	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP022293	Lactobacillus plantarum strain DSR_M2 plasmid pDSRM202, complete sequence	1046-1075	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	AP018702	Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid3 DNA, complete genome	5437-5466	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP032655	Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence	40925-40954	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP053339	Lactobacillus paraplantarum strain CK401 plasmid pCK401B, complete sequence	7802-7831	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	32018-32047	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP021502	Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence	42754-42783	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP035560	Lactobacillus plantarum strain SRCM103297 plasmid unnamed4	17547-17576	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP032748	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed4, complete sequence	3342-3371	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP032758	Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence	11891-11920	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP016271	Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence	41209-41238	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP016800	Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-3, complete sequence	15116-15145	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP019752	Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-2, complete sequence	4520-4549	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP017957	Lactobacillus plantarum strain C410L1 plasmid unnamed3, complete sequence	14827-14856	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP014934	Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence	8524-8553	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP032660	Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence	70825-70854	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP014937	Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence	8525-8554	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	MK994179	Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence	7480-7509	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP028223	Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence	29960-29989	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_MF383377	Lactobacillus curvatus strain CRL 705 plasmid pRC12, complete sequence	11333-11362	1	0.967
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP028233	Lactobacillus plantarum strain SRCM101222 plasmid unnamed4, complete sequence	18371-18400	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	30031-30060	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP037431	Lactobacillus plantarum strain EM plasmid pEM2, complete sequence	45263-45292	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035145	Lactobacillus plantarum strain SRCM103357 plasmid unnamed2	46110-46139	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028280	Lactobacillus plantarum strain SRCM100995 plasmid unnamed5, complete sequence	15530-15559	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032360	Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence	24027-24056	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032643	Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence	40547-40576	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP028244	Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence	26681-26710	1	0.967
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP054261	Lactobacillus plantarum strain TCI507 plasmid unnamed2	11838-11867	1	0.967
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21088-21118	2	0.935
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15475-15505	2	0.935
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15583-15613	2	0.935
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15709-15739	2	0.935
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9646-9676	2	0.935
AP018405_1	1.23\|476864\|31\|AP018405\|CRT	476864-476894	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1543-1573	2	0.935
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153616-153646	2	0.935
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153934-153964	2	0.935
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151825-151855	2	0.935
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153238-153262	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153718-153742	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154078-154102	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154114-154138	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154222-154246	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154396-154420	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154486-154510	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155746-155770	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156844-156868	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157012-157036	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157120-157144	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151387-151411	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151423-151447	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153136-153160	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153172-153196	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153256-153280	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153736-153760	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153910-153934	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153970-153994	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154360-154384	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154414-154438	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154594-154618	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155026-155050	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155062-155086	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155260-155284	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155296-155320	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155524-155548	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155578-155602	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155614-155638	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155650-155674	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155848-155872	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156010-156034	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156466-156490	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156484-156508	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156502-156526	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156658-156682	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156790-156814	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156922-156946	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157156-157180	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1129-1153	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1579-1603	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1753-1777	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3259-3283	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3379-3403	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3691-3715	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	46-70	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1171-1195	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1237-1261	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1273-1297	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1435-1459	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1597-1621	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1831-1855	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2083-2107	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2593-2617	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2671-2695	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2707-2731	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3007-3031	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3343-3367	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3469-3493	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3529-3553	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3607-3631	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	967-991	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1003-1027	2	0.92
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	10-34	2	0.92
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151879-151909	2	0.935
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154828-154858	2	0.935
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155794-155824	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154774-154804	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155170-155200	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155224-155254	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155404-155434	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155830-155860	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156412-156442	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1561-1591	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3151-3181	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3379-3409	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3691-3721	2	0.935
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1111-1141	2	0.935
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	AY682195	Lactobacillus plantarum bacteriophage LP65, complete genome	347-376	2	0.933
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	NC_006565	Lactobacillus phage LP65, complete genome	347-376	2	0.933
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP014632	Lactobacillus backii strain TMW 1.1988 plasmid L11988-8, complete sequence	26733-26762	2	0.933
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP014333	Weissella jogaejeotgali strain FOL01 plasmid pFOL01, complete sequence	24847-24876	2	0.933
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP033891	Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence	740-769	2	0.933
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP031210	Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_B, complete sequence	39283-39312	2	0.933
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP027197	Lactobacillus sp. CBA3606 plasmid pCBA3606-3, complete sequence	15002-15031	2	0.933
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP013156	Lactobacillus plantarum strain MF1298 plasmid pMF1298-6, complete sequence	3252-3281	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP035016	Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence	8968-8997	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	9132-9161	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032465	Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence	42008-42037	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP019723	Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence	30398-30427	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP053913	Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence	4743-4772	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP031319	Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence	27077-27106	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP029350	Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence	2505-2534	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	10758-10787	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP032467	Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence	43634-43663	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP046661	Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence	22570-22599	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	5803-5832	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP018868	Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence	54661-54690	2	0.933
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	NZ_CP012290	Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-2, complete sequence	33510-33539	2	0.933
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21070-21100	3	0.903
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15457-15487	3	0.903
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15565-15595	3	0.903
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15691-15721	3	0.903
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9628-9658	3	0.903
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2785-2815	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151843-151873	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154666-154696	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154882-154912	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155080-155110	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155314-155344	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151621-151651	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154648-154678	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157498-157528	3	0.903
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2653-2683	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154042-154072	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155902-155932	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151405-151435	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151441-151471	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151621-151651	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151951-151981	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153082-153112	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153598-153628	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153616-153646	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153892-153922	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2929-2959	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1831-1861	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3187-3217	3	0.903
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3607-3637	3	0.903
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151254-151278	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151639-151663	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151693-151717	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153652-153676	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153670-153694	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153688-153712	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154186-154210	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154240-154264	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154258-154282	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154378-154402	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154522-154546	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154792-154816	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155008-155032	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155188-155212	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155242-155266	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155422-155446	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155482	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155506-155530	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156220-156244	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156262	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156286-156310	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156304-156328	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156430-156454	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156622-156646	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156772-156796	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156826-156850	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156994-157018	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157030-157054	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157084-157108	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157138-157162	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157318-157342	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157354-157378	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157444-157468	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157516-157540	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157570-157594	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157606-157630	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1345-1369	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1507-1531	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1795-1819	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1939-1963	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1975-1999	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2785-2809	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2803-2827	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3115-3139	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3151-3175	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3511-3535	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2029-2053	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2443-2467	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1021-1045	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1075-1099	3	0.88
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1129-1153	3	0.88
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154042-154072	3	0.903
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154738-154768	3	0.903
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154936-154966	3	0.903
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155134-155164	3	0.903
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155368-155398	3	0.903
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155902-155932	3	0.903
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157192-157222	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151639-151669	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151693-151723	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154324-154354	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157354-157384	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157516-157546	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2101-2131	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2185-2215	3	0.903
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3487-3517	3	0.903
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP047124	Lactobacillus hilgardii strain FLUB plasmid unnamed3	8988-9017	3	0.9
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP047124	Lactobacillus hilgardii strain FLUB plasmid unnamed3	23131-23160	3	0.9
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156430-156460	4	0.871
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1003-1033	4	0.871
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21070-21100	4	0.871
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15457-15487	4	0.871
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15565-15595	4	0.871
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15691-15721	4	0.871
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9628-9658	4	0.871
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151459-151489	4	0.871
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151969-151999	4	0.871
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153208-153238	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151843-151873	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152005-152035	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153274-153304	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153382-153412	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153472-153502	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153490-153520	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153508-153538	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153754-153784	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154666-154696	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154684-154714	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154702-154732	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154882-154912	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154900-154930	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154972-155002	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155080-155110	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155098-155128	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155314-155344	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155332-155362	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155542-155572	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156028-156058	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156376-156406	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156520-156550	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156754-156784	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156904-156934	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1309-1339	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2167-2197	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2725-2755	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3313-3343	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	64-94	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	28-58	4	0.871
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152992-153016	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	MH779514	Mycobacterium phage Paito, complete genome	29909-29933	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	NC_047816	Ralstonia phage RS-PI-1, complete genome	37045-37069	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	HG796221	Burkholderia phage Bp-AMP4 complete genome	19353-19377	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	HG796220	Burkholderia phage Bp-AMP3 complete genome	10454-10478	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	MN191861	Burkholderia phage AMP1, complete genome	6265-6289	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	HG796219	Burkholderia phage Bp-AMP2 complete genome	10968-10992	4	0.84
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	NC_047743	Burkholderia phage Bp-AMP1 complete genome	10969-10993	4	0.84
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153934-153964	4	0.871
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154504-154534	4	0.871
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151236-151266	5	0.839
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	NZ_CP053023	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-B-Sy, complete sequence	201781-201805	5	0.8
AP018405_1	1.29\|477236\|25\|AP018405\|CRT	477236-477260	25	NZ_CP013266	Sphingobium baderi strain DE-13 plasmid pDE2, complete sequence	21613-21637	5	0.8
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156556-156586	5	0.839
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157192-157222	5	0.839
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2275-2305	5	0.839
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2371-2401	5	0.839
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3625-3655	5	0.839
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154096-154126	5	0.839
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154132-154162	5	0.839
AP018405_1	1.16\|476462\|31\|AP018405\|CRT	476462-476492	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155488	6	0.806
AP018405_1	1.16\|476462\|31\|AP018405\|CRT	476462-476492	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156268	6	0.806
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155488	6	0.806
AP018405_1	1.18\|476588\|31\|AP018405\|CRT	476588-476618	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156268	6	0.806
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154276-154306	6	0.806
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155458-155488	6	0.806
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156238-156268	6	0.806
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1165-1195	6	0.806
AP018405_1	1.23\|476864\|31\|AP018405\|CRT	476864-476894	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	6	0.806
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154096-154126	6	0.806
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154132-154162	6	0.806
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153838-153868	6	0.806
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156112-156142	6	0.806
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156586-156616	6	0.806
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3211-3241	6	0.806
AP018405_1	1.42\|478196\|49\|AP018405\|CRT	478196-478244	49	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153010-153058	6	0.878
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151747-151777	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151765-151795	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153136-153166	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154594-154624	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155026-155056	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155260-155290	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155578-155608	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155614-155644	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155650-155680	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156322-156352	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1057-1087	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1021-1051	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1615-1645	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1885-1915	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3043-3073	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3547-3577	6	0.806
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1147-1177	6	0.806
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155746-155776	6	0.806
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	NZ_KX258624	Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence	33713-33742	6	0.8
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157552-157606	7	0.873
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151765-151819	7	0.873
AP018405_1	1.17\|476516\|49\|AP018405\|CRT	476516-476564	49	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17339-17387	7	0.857
AP018405_1	1.17\|476516\|49\|AP018405\|CRT	476516-476564	49	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18653-18701	7	0.857
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153826-153856	7	0.774
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156100-156130	7	0.774
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156574-156604	7	0.774
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154558-154588	7	0.774
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154828-154858	7	0.774
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155794-155824	7	0.774
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	10-40	7	0.774
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3079-3109	7	0.774
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154414-154444	7	0.774
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1543-1573	7	0.774
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1597-1627	7	0.774
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1717-1747	7	0.774
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2353-2383	7	0.774
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3529-3559	7	0.774
AP018405_2	2.6\|1553347\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553347-1553376	30	MG641885	Salmonella phage PMBT28, complete genome	15494-15523	7	0.767
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1057-1111	8	0.855
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1735-1789	8	0.855
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3361-3415	8	0.855
AP018405_1	1.17\|476516\|49\|AP018405\|CRT	476516-476564	49	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16049-16097	8	0.837
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	8	0.742
AP018405_1	1.20\|476714\|31\|AP018405\|CRT	476714-476744	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157693-157723	8	0.742
AP018405_1	1.22\|476810\|31\|AP018405\|CRT	476810-476840	31	LC576631	Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence	61670-61700	8	0.742
AP018405_1	1.24\|476918\|31\|AP018405\|CRT	476918-476948	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1183-1213	8	0.742
AP018405_1	1.28\|477182\|31\|AP018405\|CRT	477182-477212	31	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154288-154318	8	0.742
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP028965	Burkholderia sp. IDO3 plasmid p1, complete sequence	395161-395190	8	0.733
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NC_019772	Anabaena cylindrica PCC 7122 plasmid pANACY.01, complete sequence	70678-70707	8	0.733
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP036181	Escherichia coli strain WCHEC025970 plasmid p2_025970, complete sequence	78344-78373	8	0.733
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	20693-20722	8	0.733
AP018405_2	2.5\|1553281\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553281-1553310	30	NZ_MG825377	Escherichia coli strain 1108 plasmid p1108-emrB, complete sequence	77161-77190	8	0.733
AP018405_2	2.7\|1553413\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553413-1553442	30	MG592596	Vibrio phage 1.232.O._10N.261.51.E11, partial genome	30763-30792	8	0.733
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	LR215718	Staphylococcus phage Stab20 genome assembly, chromosome: I	65331-65361	9	0.71
AP018405_1	1.46\|478466\|31\|AP018405\|CRT	478466-478496	31	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	9	0.71
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	NC_014633	Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence	881825-881854	9	0.7
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	NZ_CP047429	Spiroplasma citri strain BLH-13 plasmid pSciBLH13-1, complete sequence	16481-16510	9	0.7
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	NC_010182	Bacillus mycoides KBAB4 plasmid pBWB403, complete sequence	58269-58298	9	0.7
AP018405_2	2.1\|1553016\|30\|AP018405\|PILER-CR,CRISPRCasFinder,CRT	1553016-1553045	30	NZ_CP046373	Spiroplasma citri strain LB 319 plasmid pScpLB319-2, complete sequence	19849-19878	9	0.7
AP018405_1	1.30\|477284\|31\|AP018405\|CRT	477284-477314	31	MN450150	Pantoea phage vB_PagP-SK1, complete genome	1437-1467	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MG557618	Staphylococcus phage HSA30, complete genome	22710-22740	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MF001365	Staphylococcus phage SA3, partial genome	39651-39681	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MH159197	Staphylococcus phage VB_SavM_JYL01, complete genome	37876-37906	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MK250904	Staphylococcus phage VB-SavM-JYL02, complete genome	36448-36478	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	NC_025416	Staphylococcus phage MCE-2014, complete genome	66943-66973	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	KM216423	Staphylococcus phage P108, complete genome	2977-3007	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MT786458	Staphylococcus phage vB_SauH_SAP1, complete genome	121687-121717	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MG721208	Staphylococcus phage vB_SauM_LM12, complete genome	81901-81931	10	0.677
AP018405_1	1.44\|478340\|31\|AP018405\|CRT	478340-478370	31	MN304941	Staphylococcus phage vB_SauH_IME522, complete genome	114707-114737	10	0.677
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154204-154258	11	0.8
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156556-156610	11	0.8
AP018405_1	1.4\|475340\|55\|AP018405\|CRT	475340-475394	55	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154168-154222	12	0.782

1. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcagaa	Protospacer
*************************

2. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 0, identity: 1.0

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcagaa	Protospacer
*************************

3. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcagaa	Protospacer
*************************

4. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 0, identity: 1.0

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcagaa	Protospacer
*************************

5. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053341 (Lactobacillus paraplantarum strain CK401 plasmid pCK401D, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
caccctcgtggttcgacacagccttttcaa	Protospacer
******************************

6. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031786 (Lactobacillus paracasei strain 10266 plasmid pLP10266, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
caccctcgtggttcgacacagccttttcaa	Protospacer
******************************

7. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032461 (Lactobacillus plantarum strain ATG-K2 plasmid pK2-1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
caccctcgtggttcgacacagccttttcaa	Protospacer
******************************

8. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015860 (Lactobacillus plantarum strain LZ227 plasmid LZ227p2, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
caccctcgtggttcgacacagccttttcaa	Protospacer
******************************

9. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP042384 (Leuconostoc pseudomesenteroides strain CBA3630 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
caccctcgtggttcgacacagccttttcaa	Protospacer
******************************

10. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023773 (Lactobacillus plantarum strain PC520 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
caccctcgtggttcgacacagccttttcaa	Protospacer
******************************

11. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

12. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037432 (Lactobacillus plantarum strain EM plasmid pEM3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

13. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035575 (Lactobacillus plantarum strain SRCM103303 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

14. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021530 (Pediococcus acidilactici strain SRCM101189 plasmid pPL1189-1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

15. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013756 (Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

16. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013756 (Lactobacillus plantarum strain DF plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

17. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032745 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

18. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021475 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-4, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

19. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021475 (Pediococcus pentosaceus strain SRCM100892 plasmid pPC892-4, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

20. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023492 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

21. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017364 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

22. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020096 (Lactobacillus plantarum strain K25 plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

23. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020097 (Lactobacillus plantarum strain K25 plasmid unnamed4, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

24. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018765 (Pediococcus acidilactici strain BCC1 plasmid pbcp2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

25. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023007 (Pediococcus pentosaceus strain SS1-3 plasmid pSS1301, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

26. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026507 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

27. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047124 (Lactobacillus hilgardii strain FLUB plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

28. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047124 (Lactobacillus hilgardii strain FLUB plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

29. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013155 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-5, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

30. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053338 (Lactobacillus paraplantarum strain CK401 plasmid pCK401A, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

31. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021485 (Pediococcus acidilactici strain SRCM100424 plasmid pPl424-1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

32. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035561 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed5) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

33. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035561 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed5) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

34. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035177 (Lactobacillus plantarum strain SRCM103426 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

35. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028248 (Pediococcus acidilactici strain SRCM102731 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

36. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028270 (Pediococcus pentosaceus strain SRCM102740 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

37. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028267 (Pediococcus pentosaceus strain SRCM102739 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

38. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028265 (Pediococcus pentosaceus strain SRCM102738 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

39. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028250 (Pediococcus acidilactici strain SRCM102732 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

40. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023493 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

41. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017357 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

42. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035155 (Pediococcus acidilactici strain SRCM103387 plasmid unnamed1) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

43. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013752 (Lactobacillus plantarum strain KP plasmid unnamed3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

44. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017381 (Lactobacillus plantarum strain TMW 1.1623 plasmid pL11623-2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

45. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012652 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK04, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

46. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023177 (Lactobacillus plantarum strain BDGP2 plasmid pLtBDGP2C, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

47. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026509 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed4, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

48. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047125 (Lactobacillus hilgardii strain FLUB plasmid unnamed4) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

49. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP048923 (Lactobacillus plantarum strain X7022 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

50. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028336 (Lactobacillus plantarum strain SRCM101167 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

51. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028231 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

52. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_020826 (Lactobacillus brevis KB290 plasmid pKB290-3, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

53. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021488 (Pediococcus acidilactici strain SRCM100313 plasmid pPl313-1, complete sequence) position: , mismatch: 0, identity: 1.0

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcagaactagaaa	Protospacer
******************************

54. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcggaa	Protospacer
*********************.***

55. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcggaa	Protospacer
*********************.***

56. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtccgaa	Protospacer
********************* ***

57. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagaa	Protospacer
********* ***************

58. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtcagaa	Protospacer
************.************

59. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtccgaa	Protospacer
********************* ***

60. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtccgaa	Protospacer
********************* ***

61. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcactgtcagaa	Protospacer
***************.*********

62. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcggaa	Protospacer
*********************.***

63. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcagaa	Protospacer
***.*********************

64. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcagag	Protospacer
************************.

65. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagaa	Protospacer
********* ***************

66. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 1, identity: 0.96

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcactgtcagaa	Protospacer
***************.*********

67. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggagtccgaatcactgtcagagtcggaa	Protospacer
******.************************

68. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.968

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggagtccgaatcactgtcagagtcggaa	Protospacer
******.************************

69. spacer 2.3|1553149|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to AY682195 (Lactobacillus plantarum bacteriophage LP65, complete genome) position: , mismatch: 1, identity: 0.967

gtaattgtggctacggcattcttaatttga	CRISPR spacer
gtaattgtggctacggtattcttaatttga	Protospacer
****************.*************

70. spacer 2.3|1553149|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_006565 (Lactobacillus phage LP65, complete genome) position: , mismatch: 1, identity: 0.967

gtaattgtggctacggcattcttaatttga	CRISPR spacer
gtaattgtggctacggtattcttaatttga	Protospacer
****************.*************

71. spacer 2.4|1553215|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to AY682195 (Lactobacillus plantarum bacteriophage LP65, complete genome) position: , mismatch: 1, identity: 0.967

gtaattgtggctacggcattcttaatttga	CRISPR spacer
gtaattgtggctacggtattcttaatttga	Protospacer
****************.*************

72. spacer 2.4|1553215|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_006565 (Lactobacillus phage LP65, complete genome) position: , mismatch: 1, identity: 0.967

gtaattgtggctacggcattcttaatttga	CRISPR spacer
gtaattgtggctacggtattcttaatttga	Protospacer
****************.*************

73. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014913 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

74. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022131 (Lactobacillus pentosus strain SLC13 plasmid pSLC13, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

75. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017068 (Lactobacillus plantarum strain LP3 plasmid pLB302, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

76. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017375 (Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

77. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014931 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-7, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

78. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027192 (Lactobacillus sp. CBA3605 plasmid pCBA3605-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

79. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LT960786 (Lactobacillus sakei isolate MFPB19 plasmid 3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

80. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019984 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

81. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019984 (Pediococcus inopinatus strain DSM 20285 plasmid pLDW-14, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

82. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_008498 (Lactobacillus brevis ATCC 367 plasmid 1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgctgctgcaacaaacgt	Protospacer
********************* ********

83. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgctgctgcaacaaacgt	Protospacer
********************* ********

84. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017960 (Lactobacillus plantarum strain C410L1 plasmid unnamed6, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgctgctgcaacaaacgt	Protospacer
********************* ********

85. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020461 (Lactobacillus sakei strain FAM18311 plasmid pFAM18311_2) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

86. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031176 (Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_B, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

87. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035146 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed3) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

88. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028262 (Lactobacillus plantarum strain SRCM102737 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

89. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022293 (Lactobacillus plantarum strain DSR_M2 plasmid pDSRM202, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

90. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to AP018702 (Lactobacillus curvatus NFH-Km12 plasmid NFH-Km12_plasmid3 DNA, complete genome) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

91. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032655 (Lactobacillus pentosus strain ZFM222 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

92. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053339 (Lactobacillus paraplantarum strain CK401 plasmid pCK401B, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

93. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

94. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021502 (Lactobacillus plantarum strain SRCM102022 plasmid pPL2022-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

95. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035560 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed4) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

96. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032748 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

97. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032758 (Lactobacillus pentosus strain DSM 20314 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

98. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016271 (Lactobacillus plantarum subsp. plantarum strain CGMCC 1.557 plasmid pLp1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

99. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016800 (Lactobacillus brevis strain TMW 1.2112 plasmid pl12112-3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

100. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019752 (Lactobacillus brevis strain TMW 1.2113 plasmid pl12113-2, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

101. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017957 (Lactobacillus plantarum strain C410L1 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

102. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014934 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

103. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032660 (Lactobacillus pentosus strain ZFM94 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

104. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014937 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

105. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to MK994179 (Lactobacillus plantarum strain PC518 plasmid plp75TA, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

106. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028223 (Lactobacillus plantarum strain SRCM101105 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

107. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_MF383377 (Lactobacillus curvatus strain CRL 705 plasmid pRC12, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

108. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028233 (Lactobacillus plantarum strain SRCM101222 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.967

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgccacaaacgt	Protospacer
*************** **************

109. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttctcaccagcagaactagaaa	Protospacer
******* **********************

110. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP037431 (Lactobacillus plantarum strain EM plasmid pEM2, complete sequence) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttctcaccagcagaactagaaa	Protospacer
******* **********************

111. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035145 (Lactobacillus plantarum strain SRCM103357 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttctcaccagcagaactagaaa	Protospacer
******* **********************

112. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028280 (Lactobacillus plantarum strain SRCM100995 plasmid unnamed5, complete sequence) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cggcccaattctcaccagcagaactagaaa	Protospacer
*.****************************

113. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032360 (Lactobacillus plantarum strain ZFM55 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcggaactagaaa	Protospacer
*******************.**********

114. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032643 (Lactobacillus plantarum strain ZFM9 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcggaactagaaa	Protospacer
*******************.**********

115. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028244 (Lactobacillus plantarum strain SRCM101518 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcggaactagaaa	Protospacer
*******************.**********

116. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054261 (Lactobacillus plantarum strain TCI507 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccaattctcaccagcggaactagaaa	Protospacer
*******************.**********

117. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 2, identity: 0.935

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
gtctgagtctgaatcactgtctgaatcggag	Protospacer
********* ***************** ***

118. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
gtctgagtctgaatcactgtctgaatcggag	Protospacer
********* ***************** ***

119. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
gtctgagtctgaatcactgtctgaatcggag	Protospacer
********* ***************** ***

120. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.935

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
gtctgagtctgaatcactgtctgaatcggag	Protospacer
********* ***************** ***

121. spacer 1.22|476810|31|AP018405|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 2, identity: 0.935

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
gtctgagtctgaatcactgtctgaatcggag	Protospacer
********* ***************** ***

122. spacer 1.23|476864|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gtctgagtccgaatcactatcggaatccgaa	CRISPR spacer
gtccgagtccgaatcactgtcggaatccgaa	Protospacer
***.**************.************

123. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgaa	Protospacer
.**************************.***

124. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
atccgaatcggagtcactgtcggaatccgag	Protospacer
***************.**************.

125. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
atccgaatcggagtcactgtccgaatccgaa	Protospacer
***************.***** *********

126. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcagag	Protospacer
***.********************.

127. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcagag	Protospacer
***.********************.

128. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcacta	Protospacer
**********************  *

129. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcacta	Protospacer
**********************  *

130. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

131. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcagag	Protospacer
***.********************.

132. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcgctgtcacta	Protospacer
**********************  *

133. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

134. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

135. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

136. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

137. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtccgaa	Protospacer
********* *********** ***

138. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtccgaa	Protospacer
********* *********** ***

139. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

140. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcggaa	Protospacer
********* ***********.***

141. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagaa	Protospacer
***.***********.*********

142. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagaa	Protospacer
***.***********.*********

143. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcactgtcagaa	Protospacer
********* *****.*********

144. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

145. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagaa	Protospacer
***.***********.*********

146. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

147. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

148. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

149. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtccgaa	Protospacer
********* *********** ***

150. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

151. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtccgaa	Protospacer
********* *********** ***

152. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtccgaa	Protospacer
***.***************** ***

153. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtccgagtccgaatcgctgtcagaa	Protospacer
*** ***** ***************

154. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

155. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

156. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcggaa	Protospacer
***.*****************.***

157. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtctgagtcggaatcgctgtccgaa	Protospacer
*** ***************** ***

158. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagaatcggaatcgctgtcagaa	Protospacer
***.**.******************

159. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagaatcggaatcgctgtcagaa	Protospacer
***.**.******************

160. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagaatcggaatcgctgtcagaa	Protospacer
***.**.******************

161. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcactgtcagaa	Protospacer
********* *****.*********

162. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcggaa	Protospacer
***.*****************.***

163. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagaa	Protospacer
********* **.************

164. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtccgaa	Protospacer
***.***************** ***

165. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

166. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtcagag	Protospacer
************.***********.

167. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

168. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtcagag	Protospacer
************.***********.

169. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

170. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagag	Protospacer
********* **************.

171. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcagagtcgctgtcagaa	Protospacer
*********.**.************

172. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtccgaa	Protospacer
************.******** ***

173. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtccgaa	Protospacer
************.******** ***

174. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagaa	Protospacer
********* **.************

175. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtcagca	Protospacer
************.********** *

176. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagaa	Protospacer
***.***** ***************

177. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggagtcgctgtcagaa	Protospacer
******.*****.************

178. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcagaatcgctgtcagaa	Protospacer
***.*****.***************

179. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtctgagtcgctgtcagaa	Protospacer
********* **.************

180. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcactgtcagaa	Protospacer
******.********.*********

181. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcagagtcgctgtcagaa	Protospacer
*********.**.************

182. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcagca	Protospacer
********* ************* *

183. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtccgaa	Protospacer
************.******** ***

184. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatccgaatcgctgtcagaa	Protospacer
******.** ***************

185. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtccgagtccgaatcgctgtcagaa	Protospacer
*** ***** ***************

186. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtccgagtcggagtcgctgtcagaa	Protospacer
*** ********.************

187. spacer 1.29|477236|25|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtcagag	Protospacer
************.***********.

188. spacer 1.29|477236|25|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcgctgtcagag	Protospacer
******.*****************.

189. spacer 1.29|477236|25|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.92

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcagagtcgctgtcagaa	Protospacer
*********.**.************

190. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggaatcactgtcggagtccgaa	Protospacer
******************.*****.******

191. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcgctatccgaatcgctgtcagaatccgag	Protospacer
***************.**.************

192. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcgctatccgaatcgctgtcagaatccgag	Protospacer
***************.**.************

193. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgagtcgctgtcagagtcggaa	Protospacer
************.**.***************

194. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgagtcgctgtcagagtcggaa	Protospacer
************.**.***************

195. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgagtcgctgtcagagtcggaa	Protospacer
************.**.***************

196. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgagtcgctgtcagagtcggaa	Protospacer
************.**.***************

197. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtccgaatccgaatcgctgtcagagtcggaa	Protospacer
*** ***********.***************

198. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatcggaatcactgtcggagtcggaa	Protospacer
********* ***********.*********

199. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgaatcactgtcggagtcggag	Protospacer
*********************.********.

200. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgaatcgctgtcagagtccgaa	Protospacer
***************.*********** ***

201. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggagtccgaatcgctgtcagagtcggaa	Protospacer
******.********.***************

202. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggagtccgaatcgctgtcagagtcggaa	Protospacer
******.********.***************

203. spacer 1.46|478466|31|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 2, identity: 0.935

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcagaatccgaatcgctgtcagagtcggaa	Protospacer
***.***********.***************

204. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to AY682195 (Lactobacillus plantarum bacteriophage LP65, complete genome) position: , mismatch: 2, identity: 0.933

tcctttccttatatatgtttatagtatagc	CRISPR spacer
tcctttccttatctatgtttatagtatacc	Protospacer
************ *************** *

205. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_006565 (Lactobacillus phage LP65, complete genome) position: , mismatch: 2, identity: 0.933

tcctttccttatatatgtttatagtatagc	CRISPR spacer
tcctttccttatctatgtttatagtatacc	Protospacer
************ *************** *

206. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014632 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-8, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ctttgcaagcaccgcagctgccacaaacgt	Protospacer
*.************* **************

207. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014333 (Weissella jogaejeotgali strain FOL01 plasmid pFOL01, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcatctgccacaaacgt	Protospacer
***************  *************

208. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033891 (Lactobacillus plantarum strain LMT1-48 plasmid p_3, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagcggccacaaacgt	Protospacer
*************** ** ***********

209. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031210 (Lactobacillus brevis strain UCCLB521 plasmid pUCCLB521_B, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagcggccacaaacgt	Protospacer
*************** ** ***********

210. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027197 (Lactobacillus sp. CBA3606 plasmid pCBA3606-3, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagcagccacaaacgt	Protospacer
*************** ** ***********

211. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013156 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-6, complete sequence) position: , mismatch: 2, identity: 0.933

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
cctttcaagcaccgcagctgccacaaacgt	Protospacer
**** ********** **************

212. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035016 (Lactobacillus plantarum strain 12_3 plasmid pldD, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

213. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

214. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032465 (Lactobacillus plantarum strain ATG-K6 plasmid pK6, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

215. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019723 (Lactobacillus plantarum strain CLP0611 plasmid pUnnamed, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

216. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053913 (Lactobacillus plantarum subsp. plantarum strain G1 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

217. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031319 (Lactobacillus plantarum strain DR7 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

218. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029350 (Lactobacillus plantarum strain HAC01 plasmid pLP-HAC01, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

219. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

220. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032467 (Lactobacillus plantarum strain ATG-K8 plasmid pK8, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

221. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046661 (Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagccaatttctcaccagcagaactagaaa	Protospacer
***** * **********************

222. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

223. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018868 (Lactobacillus alimentarius DSM 20249 plasmid pLDW-11, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagcccatttttcaccagcagaactagaaa	Protospacer
******* **.*******************

224. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012290 (Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-2, complete sequence) position: , mismatch: 2, identity: 0.933

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
cagccaatttctcaccagcagaactagaaa	Protospacer
***** * **********************

225. spacer 1.18|476588|31|AP018405|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.903

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
*** ***** ********************.

226. spacer 1.18|476588|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
*** ***** ********************.

227. spacer 1.18|476588|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
*** ***** ********************.

228. spacer 1.18|476588|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.903

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
*** ***** ********************.

229. spacer 1.18|476588|31|AP018405|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.903

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
*** ***** ********************.

230. spacer 1.20|476714|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
gtcggagtcggagtcactgtcagagtcggaa	Protospacer
.**.**************.************

231. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.**************************.**.

232. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.**************************.**.

233. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.**************************.**.

234. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.**************************.**.

235. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.**************************.**.

236. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgagtcgctgtcggaatcggaa	Protospacer
.***********.************** ***

237. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtccgaatccgaa	Protospacer
.******************** *****.***

238. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgagtccgaatcgctgtcggaatcggaa	Protospacer
.*****.******************** ***

239. spacer 1.24|476918|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcggaatccgaatcgctgtcggaatcggaa	Protospacer
.** *********************** ***

240. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggaatccgag	Protospacer
.**************.**************.

241. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggaatccgag	Protospacer
.**************.**************.

242. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcggagtccgaa	Protospacer
.******** **************.******

243. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtccgaatccgaa	Protospacer
.******** *********** *********

244. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcggaatcggaa	Protospacer
.******** ***************** ***

245. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcagaatccgaa	Protospacer
.******** ***********.*********

246. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggagtccgaa	Protospacer
.**************.********.******

247. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtccgaatccgaa	Protospacer
.**************.***** *********

248. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgaa	Protospacer
.******** **.******************

249. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcggagtccgaa	Protospacer
.******** **************.******

250. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcgctgtcagaatccgag	Protospacer
.********************.********.

251. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatcggagtcgctgtcagaatccgaa	Protospacer
.** *****************.*********

252. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatcggagtcactgtcggaatccgaa	Protospacer
.** ***********.***************

253. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgagtcggagtcgctgtcagaatccgaa	Protospacer
.*****.**************.*********

254. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagag	Protospacer
********* **.***********.

255. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcactgtcagag	Protospacer
******.********.********.

256. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcactgtcagag	Protospacer
******.********.********.

257. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcggag	Protospacer
********* ***********.**.

258. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcggag	Protospacer
********* ***********.**.

259. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcggag	Protospacer
********* ***********.**.

260. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

261. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

262. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

263. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagaatcggaatcgctgtcagag	Protospacer
***.**.*****************.

264. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

265. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

266. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

267. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

268. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

269. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

270. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

271. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcactgtcagag	Protospacer
********* *****.********.

272. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagag	Protospacer
********* **.***********.

273. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

274. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcactgtcagag	Protospacer
********* *****.********.

275. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtccgag	Protospacer
***.***************** **.

276. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggaatcactgtcggag	Protospacer
***************.*****.**.

277. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagag	Protospacer
********* **.***********.

278. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagag	Protospacer
********* **.***********.

279. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcggag	Protospacer
********* ***********.**.

280. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtcggag	Protospacer
********* ***********.**.

281. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

282. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

283. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

284. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggagtcgctgtcagag	Protospacer
******.*****.***********.

285. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcactgtcagag	Protospacer
******.********.********.

286. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagag	Protospacer
********* **.***********.

287. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcactgtcagag	Protospacer
******.********.********.

288. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

289. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggagtcgctgtcagag	Protospacer
******.*****.***********.

290. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggagtcgctgtcagag	Protospacer
******.*****.***********.

291. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtccgag	Protospacer
********* *********** **.

292. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcagagtcgctgtcagag	Protospacer
*********.**.***********.

293. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtccgagtcggagtcgctgtcagag	Protospacer
*** ********.***********.

294. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatcggaatcgctgtccgag	Protospacer
******.************** **.

295. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcactgtcagag	Protospacer
************.**.********.

296. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcgctgtcggag	Protospacer
***.*****************.**.

297. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgagtcgctgtcagag	Protospacer
********* **.***********.

298. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggaatccgaatcgctgtcagag	Protospacer
******.** **************.

299. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggagtcgctgtccgag	Protospacer
************.******** **.

300. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagca	Protospacer
***.***** ************* *

301. spacer 1.29|477236|25|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcagagtcgctgtcagca	Protospacer
*********.**.********** *

302. spacer 1.29|477236|25|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtccgaatcgctgtcagag	Protospacer
***.***** **************.

303. spacer 1.29|477236|25|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtccgaatcgctgtccgag	Protospacer
********* *********** **.

304. spacer 1.29|477236|25|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 3, identity: 0.88

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagag	Protospacer
***.***********.********.

305. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggaatccgag	Protospacer
************.*****.***********.

306. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggaatcactgtcggagtccgag	Protospacer
******************.*****.*****.

307. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggaatcactgtcggagtccgag	Protospacer
******************.*****.*****.

308. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggaatcactgtcggagtccgag	Protospacer
******************.*****.*****.

309. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggaatcactgtcggagtccgag	Protospacer
******************.*****.*****.

310. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggaatccgag	Protospacer
************.*****.***********.

311. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
gtccgaatcggaatcactgtcagaatccgag	Protospacer
******************.**.********.

312. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatcggaatcactgtcagagtccgag	Protospacer
********* ***************** **.

313. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatcggaatcactgtcagagtccgag	Protospacer
********* ***************** **.

314. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgagtcactgtcagagtccgag	Protospacer
************.************** **.

315. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatcggaatcactgtcagagtccgag	Protospacer
********* ***************** **.

316. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatcggaatcactgtcagagtccgag	Protospacer
********* ***************** **.

317. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcagaatccgagtcactgtcagagtcggag	Protospacer
***.********.*****************.

318. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggaatccgagtcactgtcagagtccgag	Protospacer
************.************** **.

319. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.903

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcagaatccgagtcactgtcagagtcggag	Protospacer
***.********.*****************.

320. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047124 (Lactobacillus hilgardii strain FLUB plasmid unnamed3) position: , mismatch: 3, identity: 0.9

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgtcacaaacgc	Protospacer
*************** ****.********.

321. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047124 (Lactobacillus hilgardii strain FLUB plasmid unnamed3) position: , mismatch: 3, identity: 0.9

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ccttgcaagcaccgcagctgtcacaaacgc	Protospacer
*************** ****.********.

322. spacer 1.18|476588|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
gtcggagtcggaatcactgtcggagtcggaa	Protospacer
.******************** ***** **.

323. spacer 1.18|476588|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
gtcggagtcggaatcgctgtcagagtctgaa	Protospacer
.**************.***** ********.

324. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.871

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
.******** **************.*****.

325. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
.******** **************.*****.

326. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
.******** **************.*****.

327. spacer 1.22|476810|31|AP018405|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.871

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
.******** **************.*****.

328. spacer 1.22|476810|31|AP018405|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 4, identity: 0.871

gtctgagtcagaatcactgtctgaatctgag	CRISPR spacer
atctgagtctgaatcactgtctgagtctgaa	Protospacer
.******** **************.*****.

329. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtccgaatccgag	Protospacer
.******************** *****.**.

330. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcagaatccgaatcgctgtcggaatccgag	Protospacer
.** ***********************.**.

331. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggagtccgag	Protospacer
.***********************.**.**.

332. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.******** **.*****************.

333. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtccgaatccgag	Protospacer
.**************.***** ********.

334. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcggagtccgag	Protospacer
.** ********************.*****.

335. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcagaatccgag	Protospacer
.******** ***********.********.

336. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtccgaatccgag	Protospacer
.******** *********** ********.

337. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtccgaatccgag	Protospacer
.******** *********** ********.

338. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcagaatccgag	Protospacer
.******** ***********.********.

339. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcggagtccgag	Protospacer
.** ********************.*****.

340. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.******** **.*****************.

341. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatccgagtcgctgtcggaatccgag	Protospacer
.** ***** ********************.

342. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatccgagtcgctgtcggaatccgag	Protospacer
.** ***** ********************.

343. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.******** **.*****************.

344. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatccgagtcgctgtcggaatccgag	Protospacer
.** ***** ********************.

345. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtcagaatccgag	Protospacer
.******** ***********.********.

346. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.******** **.*****************.

347. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatccgagtcgctgtcggaatccgag	Protospacer
.** ***** ********************.

348. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgaatcgctgtcggaatccgag	Protospacer
.******** **.*****************.

349. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatccgagtcgctgtcggaatccgag	Protospacer
.** ***** ********************.

350. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatccgagtcgctgtccgaatccgag	Protospacer
.******** *********** ********.

351. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggagtccgag	Protospacer
.**************.********.*****.

352. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgaatcggagtcactgtcggagtccgag	Protospacer
.**************.********.*****.

353. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggaatcgctgtcggaatccgag	Protospacer
.** ********.*****************.

354. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcggagtccgag	Protospacer
.** ********************.*****.

355. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcggagtccgag	Protospacer
.** ********************.*****.

356. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtccgagtcagagtcgctgtcggaatccgag	Protospacer
.*****.**.********************.

357. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcggaatccgagtcgctgtcggaatccgag	Protospacer
.** ***** ********************.

358. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcagaatccgag	Protospacer
.** *****************.********.

359. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtccgaatccgag	Protospacer
.** ***************** ********.

360. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcggaatctgca	Protospacer
.** ***********************.* *

361. spacer 1.28|477182|31|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.871

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcagaatcggagtcgctgtcggaatctgca	Protospacer
.** ***********************.* *

362. spacer 1.29|477236|25|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
atcggagtccgagtcgctgtcagag	Protospacer
.******** **.***********.

363. spacer 1.29|477236|25|AP018405|CRT matches to MH779514 (Mycobacterium phage Paito, complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
ttcggaatcggaatcgttgtcagat	Protospacer
 *****.*********.*******

364. spacer 1.29|477236|25|AP018405|CRT matches to NC_047816 (Ralstonia phage RS-PI-1, complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggcatcgctgtcggct	Protospacer
*********** *********.*

365. spacer 1.29|477236|25|AP018405|CRT matches to HG796221 (Burkholderia phage Bp-AMP4 complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggcatcgctgtcggct	Protospacer
*********** *********.*

366. spacer 1.29|477236|25|AP018405|CRT matches to HG796220 (Burkholderia phage Bp-AMP3 complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggcatcgctgtcggct	Protospacer
*********** *********.*

367. spacer 1.29|477236|25|AP018405|CRT matches to MN191861 (Burkholderia phage AMP1, complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggcatcgctgtcggct	Protospacer
*********** *********.*

368. spacer 1.29|477236|25|AP018405|CRT matches to HG796219 (Burkholderia phage Bp-AMP2 complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggcatcgctgtcggct	Protospacer
*********** *********.*

369. spacer 1.29|477236|25|AP018405|CRT matches to NC_047743 (Burkholderia phage Bp-AMP1 complete genome) position: , mismatch: 4, identity: 0.84

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
gtcggagtcggcatcgctgtcggct	Protospacer
*********** *********.*

370. spacer 1.30|477284|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
atccgaatcggagtcactgtcggaatccgag	Protospacer
.***********.*****.***********.

371. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.871

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcactatccgaatcgctgtcagagtcggaa	Protospacer
***.  *********.***************

372. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
aacagaatccgagtcgctgtcggagtccgag	Protospacer
* * ***** **************.*****.

373. spacer 1.29|477236|25|AP018405|CRT matches to NZ_CP053023 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-B-Sy, complete sequence) position: , mismatch: 5, identity: 0.8

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
atcggcgtcggaatcgctgtcaacc	Protospacer
.**** ****************.

374. spacer 1.29|477236|25|AP018405|CRT matches to NZ_CP013266 (Sphingobium baderi strain DE-13 plasmid pDE2, complete sequence) position: , mismatch: 5, identity: 0.8

gtcggagtcggaatcgctgtcagaa	CRISPR spacer
atcggcgtcggaatcgctgtcaacc	Protospacer
.**** ****************.

375. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcactgtcagaatccgaa	Protospacer
***.  ************.***********.

376. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgaatcggaatcactgtcagaatccgag	Protospacer
***   *** ********.************

377. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcactgtcagaatccgag	Protospacer
***   .***********.************

378. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcgctgtcagaatccgag	Protospacer
***.  *********.**.************

379. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.839

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcgctgtcagaatccgag	Protospacer
***.  *********.**.************

380. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcactatccgaatcgctgtcggagtcggaa	Protospacer
***.  *********.*****.*********

381. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.839

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcactatccgaatcgctgtcggagtcggaa	Protospacer
***.  *********.*****.*********

382. spacer 1.16|476462|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcggagtcggaatcactatcagagtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagagtcgctg	Protospacer
***.**************.********.  .

383. spacer 1.16|476462|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcggagtcggaatcactatcagagtcagaa	CRISPR spacer
gtcagagtcggaatcactgtcagagtcgctg	Protospacer
***.**************.********.  .

384. spacer 1.18|476588|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
gtcagagtcggaatcactgtcagagtcgctg	Protospacer
.**.***************** *****   *

385. spacer 1.18|476588|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atcggagtcggaatcactgtctgagtctgag	CRISPR spacer
gtcagagtcggaatcactgtcagagtcgctg	Protospacer
.**.***************** *****   *

386. spacer 1.20|476714|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
gtcagagtcggagtcactgtcggagtcgctg	Protospacer
.*****************.**.******  .

387. spacer 1.20|476714|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
gtcagagtcggaatcactgtcagagtcgctg	Protospacer
.***********.*****.*********  .

388. spacer 1.20|476714|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
gtcagagtcggaatcactgtcagagtcgctg	Protospacer
.***********.*****.*********  .

389. spacer 1.20|476714|31|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
gtcagaatcggagtcactgtcagagtcgctg	Protospacer
.*****.***********.*********  .

390. spacer 1.23|476864|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtctgagtccgaatcactatcggaatccgaa	CRISPR spacer
gtcgctgtccgaatcactgtcggaatcagag	Protospacer
***   ************.******** **.

391. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcactatccgaatcgctgtcggagtcggaa	Protospacer
.**   ******************.** ***

392. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcactatccgaatcgctgtcggagtcggaa	Protospacer
.**   ******************.** ***

393. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
atcgctgtcggagtcgctgtctgaatcggaa	Protospacer
***   .************** ***** ***

394. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
atcgctgtcggagtcgctgtctgaatcggaa	Protospacer
***   .************** ***** ***

395. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
atcgctgtcggagtcgctgtctgaatcggaa	Protospacer
***   .************** ***** ***

396. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
atccgaatcgctgtcgctgtcggaatcgctg	Protospacer
**********  ***************   .

397. spacer 1.42|478196|49|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.878

gtcgctatctgaatcgctgtccgagtccgagtcactgtcagaatcggag	CRISPR spacer
gtcagagtccgaatcgctgtccgaatccgagtcactgtcagaatcggag	Protospacer
***.  .**.**************.************************

398. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcgctgtcagaatccgaa	Protospacer
***.  *********.**.***********.

399. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcgctgtcagaatccgaa	Protospacer
***.  *********.**.***********.

400. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgag	Protospacer
***.  .********.**.************

401. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgag	Protospacer
***.  .********.**.************

402. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgag	Protospacer
***.  .********.**.************

403. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgag	Protospacer
***.  .********.**.************

404. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcgctgtcagaatccgag	Protospacer
***   .********.**.************

405. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgag	Protospacer
***.  .********.**.************

406. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgag	Protospacer
***.  .********.**.************

407. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcactgtccgaatccgag	Protospacer
***   .***********.** *********

408. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcactgtcagaatccgaa	Protospacer
***.  .***********.***********.

409. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtctgaatcactgtcagaatccgag	Protospacer
***.  .**.********.************

410. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcactgtcggaatccgaa	Protospacer
***.  ************.**.********.

411. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgagtcactgtcagaatccgaa	Protospacer
***.  ******.*****.***********.

412. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcactgtccgaatccgag	Protospacer
***   .***********.** *********

413. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagaatccgaatcactgtcggaatccgaa	Protospacer
***.  ************.**.********.

414. spacer 1.44|478340|31|AP018405|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.806

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcactgtcagaatcggag	Protospacer
***.  .***********.******** ***

415. spacer 1.46|478466|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.806

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
gtcggagtccgaatcgctgtcagagtcactg	Protospacer
******.********.***********.  .

416. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KX258624 (Bacillus thuringiensis strain INTA Fr7-4 plasmid pFR260, complete sequence) position: , mismatch: 6, identity: 0.8

tcctttccttatatatgtttatagtatagc	CRISPR spacer
tcaattccttttatatgtttatagttttgg	Protospacer
**  ****** ************** * *

417. spacer 1.4|475340|55|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.873

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtcagaatccgaatcgctgtcagagtccgaatcgctgtcagagtccgaatcactg	Protospacer
***.  *********.***********************************.  *

418. spacer 1.4|475340|55|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.873

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtcagaatccgaatcgctgtcagaatccgaatcgctgtcagagtccgaatcgctg	Protospacer
***.  *********.********.***************************  *

419. spacer 1.17|476516|49|AP018405|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.857

gtcggagtcggaatcactgtcgctatctgaatcgctgtcggaatccgaa	CRISPR spacer
gtctgagtctgaatcactgtcgctatctgaatcgctgtcgctgtctgag	Protospacer
*** ***** ******************************  .**.**.

420. spacer 1.17|476516|49|AP018405|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.857

gtcggagtcggaatcactgtcgctatctgaatcgctgtcggaatccgaa	CRISPR spacer
gtctgagtctgaatcactgtcgctatctgaatcgctgtcgctgtctgag	Protospacer
*** ***** ******************************  .**.**.

421. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcagaatccgaatcgctgtcggagtcgctg	Protospacer
.** ********************.**   .

422. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcagaatccgaatcgctgtcggagtcgctg	Protospacer
.** ********************.**   .

423. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcagaatccgaatcgctgtcggagtcgctg	Protospacer
.** ********************.**   .

424. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcgctatccgaatcgctgtccgaatcagag	Protospacer
.**   *************** ***** **.

425. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcgctatccgaatcgctgtcagaatccgag	Protospacer
.**   ***************.*****.**.

426. spacer 1.24|476918|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcgctatccgaatcgctgtcagaatccgag	Protospacer
.**   ***************.*****.**.

427. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcactgtcagagtcgctgtcagaatccgaa	Protospacer
.**   .**.***********.*********

428. spacer 1.28|477182|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcgctgtcggaatcgctgtccgaatccgaa	Protospacer
.**   .*****.******** *********

429. spacer 1.44|478340|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.774

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgaa	Protospacer
***.  .********.**.***********.

430. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcactgtcggaatccgaa	Protospacer
***   .***********.**.********.

431. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtcagagtccgaatcgctgtcagaatccgaa	Protospacer
***.  .********.**.***********.

432. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcactgtcagcatccgaa	Protospacer
***   .***********.**** ******.

433. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgagtcactgtcagaatccgaa	Protospacer
***   .*****.*****.***********.

434. spacer 1.44|478340|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.774

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
gtccgagtccgaatcgctgtcagaatccgaa	Protospacer
***   .********.**.***********.

435. spacer 2.6|1553347|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to MG641885 (Salmonella phage PMBT28, complete genome) position: , mismatch: 7, identity: 0.767

caccctcgtggttcgacacagccttttcaa	CRISPR spacer
gaccctcgtggttcgccccagcctccacag	Protospacer
 ************** * ******.. **.

436. spacer 1.4|475340|55|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.855

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtcagagtccgaatcactgtcagaatccgaatcgctgtcagagtccgagtcgctg	Protospacer
***.  .*****************.***********************.***  *

437. spacer 1.4|475340|55|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.855

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtcagcatccgaatcgctgtcggagtccgaatcgctgtcagagtccgaatcactg	Protospacer
***. .*********.*****.*****************************.  *

438. spacer 1.4|475340|55|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.855

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtccgaatccgaatcactgtcggagtccgaatcgctgtcagagtcggaatcactg	Protospacer
***   ***************.*********************** *****.  *

439. spacer 1.17|476516|49|AP018405|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.837

gtcggagtcggaatcactgtcgctatctgaatcgctgtcggaatccgaa	CRISPR spacer
gtctgagtctgaatcactgtcgctatctgaatcgctgtcttcatcaaag	Protospacer
*** ***** *****************************   *** .*.

440. spacer 1.20|476714|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
---agaatcggagtcactgtcagagtcgctg	Protospacer
   ***.***********.*********  .

441. spacer 1.20|476714|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

atcagagtcggagtcactatcagagtcggaa	CRISPR spacer
gccaagatcggagtcactgtcagagtccgag	Protospacer
..**...***********.******** **.

442. spacer 1.22|476810|31|AP018405|CRT matches to LC576631 (Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence) position: , mismatch: 8, identity: 0.742

gtctgagtcagaatcactgtctgaa---tctgag	CRISPR spacer
acctgagtcagaactactgtctgaaaggcct---	Protospacer
..***********..**********   .**

443. spacer 1.24|476918|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 8, identity: 0.742

atccgaatccgaatcgctgtcggaatctgaa	CRISPR spacer
gtcgctgtccgaatcactgtcggaatcagag	Protospacer
.**   .********.*********** **.

444. spacer 1.28|477182|31|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.742

atccgaatcggagtcgctgtcggaatccgaa	CRISPR spacer
gtcactgtcggagtcgctgtcagagtccgag	Protospacer
.**   .**************.**.*****.

445. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028965 (Burkholderia sp. IDO3 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ggccgcaagcgccgctgctgccacgaatgc	Protospacer
  ..******.*************.**.*.

446. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_019772 (Anabaena cylindrica PCC 7122 plasmid pANACY.01, complete sequence) position: , mismatch: 8, identity: 0.733

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
gaattcaagcaccgctgctgccagaatcaa	Protospacer
   * ****************** ** *.

447. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP036181 (Escherichia coli strain WCHEC025970 plasmid p2_025970, complete sequence) position: , mismatch: 8, identity: 0.733

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
aactgaaagcagcgctgctgccacaacagg	Protospacer
  .** ***** **************  *

448. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 8, identity: 0.733

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
ggccgcaagcgccgctgctgccacgaatgc	Protospacer
  ..******.*************.**.*.

449. spacer 2.5|1553281|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_MG825377 (Escherichia coli strain 1108 plasmid p1108-emrB, complete sequence) position: , mismatch: 8, identity: 0.733

ccttgcaagcaccgctgctgccacaaacgt	CRISPR spacer
aactgaaagcagcgctgctgccacaacagg	Protospacer
  .** ***** **************  *

450. spacer 2.7|1553413|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to MG592596 (Vibrio phage 1.232.O._10N.261.51.E11, partial genome) position: , mismatch: 8, identity: 0.733

cagcccaattctcaccagcagaactagaaa	CRISPR spacer
tagcccaatcctcaccagcggaaccgtcag	Protospacer
.********.*********.****..  *.

451. spacer 1.44|478340|31|AP018405|CRT matches to LR215718 (Staphylococcus phage Stab20 genome assembly, chromosome: I) position: , mismatch: 9, identity: 0.71

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagtccct	Protospacer
 .******* ***.*********** .*

452. spacer 1.46|478466|31|AP018405|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.71

gtcggaatccgaatcactgtcagagtcggaa	CRISPR spacer
---agaatcggagtcactgtcagagtcgctg	Protospacer
   .***** **.***************  .

453. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_014633 (Ilyobacter polytropus DSM 2926 plasmid pILYOP01, complete sequence) position: , mismatch: 9, identity: 0.7

tcctttccttatatatgtttatagtatagc	CRISPR spacer
aaatttccttatatttgtttattgtaccat	Protospacer
   *********** ******* ***. ..

454. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047429 (Spiroplasma citri strain BLH-13 plasmid pSciBLH13-1, complete sequence) position: , mismatch: 9, identity: 0.7

tcctttccttatatatgtttatagtatagc	CRISPR spacer
cagattcattatatatgtttctagtattat	Protospacer
.   *** ************ ****** ..

455. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NC_010182 (Bacillus mycoides KBAB4 plasmid pBWB403, complete sequence) position: , mismatch: 9, identity: 0.7

tcctttccttatatatgtttatagtatagc	CRISPR spacer
ctaaaggcgtatatatgtgtatagtatagc	Protospacer
..     * ********* ***********

456. spacer 2.1|1553016|30|AP018405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046373 (Spiroplasma citri strain LB 319 plasmid pScpLB319-2, complete sequence) position: , mismatch: 9, identity: 0.7

tcctttccttatatatgtttatagtatagc	CRISPR spacer
cagattcattatatatgtttctagtattat	Protospacer
.   *** ************ ****** ..

457. spacer 1.30|477284|31|AP018405|CRT matches to MN450150 (Pantoea phage vB_PagP-SK1, complete genome) position: , mismatch: 10, identity: 0.677

gtccgaatcggaatcactatcggaatccgaa	CRISPR spacer
actgctgtcggcatcactatcggaatcggat	Protospacer
...   .**** *************** **

458. spacer 1.44|478340|31|AP018405|CRT matches to MG557618 (Staphylococcus phage HSA30, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

459. spacer 1.44|478340|31|AP018405|CRT matches to MF001365 (Staphylococcus phage SA3, partial genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

460. spacer 1.44|478340|31|AP018405|CRT matches to MH159197 (Staphylococcus phage VB_SavM_JYL01, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

461. spacer 1.44|478340|31|AP018405|CRT matches to MK250904 (Staphylococcus phage VB-SavM-JYL02, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

462. spacer 1.44|478340|31|AP018405|CRT matches to NC_025416 (Staphylococcus phage MCE-2014, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

463. spacer 1.44|478340|31|AP018405|CRT matches to KM216423 (Staphylococcus phage P108, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

464. spacer 1.44|478340|31|AP018405|CRT matches to MT786458 (Staphylococcus phage vB_SauH_SAP1, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

465. spacer 1.44|478340|31|AP018405|CRT matches to MG721208 (Staphylococcus phage vB_SauM_LM12, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

466. spacer 1.44|478340|31|AP018405|CRT matches to MN304941 (Staphylococcus phage vB_SauH_IME522, complete genome) position: , mismatch: 10, identity: 0.677

gtcgctatccgaatcactatcagaatccgag	CRISPR spacer
tccgctatcagaaccactatcagaagttcct	Protospacer
 .******* ***.*********** ..

467. spacer 1.4|475340|55|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.8

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtcagagtcactgtcactgtcggagtccgaatcgctgtcagagtccgaatcgctg	Protospacer
***.  .**   .********.******************************  *

468. spacer 1.4|475340|55|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.8

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtcagaatccgaatcactgtcagaatccgaatcgctgtcggagtcgctgtctgaa	Protospacer
***.  ******************.**************.*****   .** **.

469. spacer 1.4|475340|55|AP018405|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 12, identity: 0.782

gtcgctatccgaatcactgtcagagtccgaatcgctgtcagagtccgaatcggag	CRISPR spacer
gtccgaatccgagtcgctgtcagagtccgaatcgctgtcagagtcactgtcactg	Protospacer
***   ******.**.*****************************   .**.  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

331472 : 341248

Lactobacillus_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA80708.1\|331472_332468_-	glycosyltransferase, family 2	S5FKN0	Shigella_phage	3.1e-52	38.8
BBA80709.1\|333327_333768_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
BBA80710.1\|333838_334399_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
BBA80711.1\|334486_336925_-	fumarate reductase	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.3
BBA80712.1\|336927_337542_-	NADPH-dependent FMN reductase family protein	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
BBA80713.1\|337885_338833_+	transcription regulator, LysR family	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
BBA80714.1\|339018_339861_+	nisin resistance protein	A0A2P0ZL68	Lactobacillus_phage	1.4e-154	99.3
BBA80715.1\|340078_341248_-	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	4.0e-216	97.2

DBSCAN-SWA_2

367411 : 432637

Lactobacillus_phage(90.74%)

portal,head,tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA80738.1\|367411_369100_-\|tRNA	arginyl-tRNA synthetase	A0A2I2L3K1	Orpheovirus	1.2e-75	32.9
BBA80739.1\|369371_369818_-	GNAT family acetyltransferase	NA	NA	NA	NA
BBA80740.1\|370206_370452_-	hypothetical protein	NA	NA	NA	NA
BBA80741.1\|370578_371970_-	Na+ driven multidrug efflux protein, MATE family	NA	NA	NA	NA
BBA80742.1\|372244_374020_-	sodium/sulfate symport protein	NA	NA	NA	NA
BBA80743.1\|374452_376192_-	arylsulfate sulfotransferase	NA	NA	NA	NA
BBA80744.1\|376404_377361_-	exopolyphosphatase	NA	NA	NA	NA
BBA80745.1\|377350_377974_-	adenylylsulfate kinase	A0A2K9L4R9	Tupanvirus	4.8e-27	40.6
BBA80746.1\|377976_379152_-	sulfate adenylyltransferase	A0A2P1ELS9	Moumouvirus	2.9e-49	31.9
BBA80747.1\|379129_380767_-	hypothetical protein	NA	NA	NA	NA
BBA80748.1\|381654_383961_+	5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase	NA	NA	NA	NA
BBA80749.1\|383974_385831_+	methylenetetrahydrofolate reductase	NA	NA	NA	NA
BBA80750.1\|385903_386263_+	UPF0344 protein	NA	NA	NA	NA
BBA80751.1\|386362_386884_-	teichoic acid glycosylation protein	NA	NA	NA	NA
BBA80752.1\|386989_388003_+	extracellular protein, membrane-anchored	NA	NA	NA	NA
BBA80753.1\|388167_388593_+	lipoprotein	NA	NA	NA	NA
BBA80754.1\|389157_390039_-	prophage protein	A0A2P0ZLG2	Lactobacillus_phage	2.7e-116	85.7
BBA80755.1\|390038_390323_-	hypothetical protein	A0A2P0ZLE8	Lactobacillus_phage	2.0e-41	96.8
BBA80756.1\|390322_390532_-	hypothetical protein	A0A2P0ZLG4	Lactobacillus_phage	1.3e-08	58.0
BBA80757.1\|390537_390918_-	hypothetical protein	A0A2P0ZLF7	Lactobacillus_phage	7.2e-50	75.2
BBA80758.1\|390934_391369_-	uncharacterized protein	A0A2P0ZLE9	Lactobacillus_phage	1.1e-57	79.9
BBA80759.1\|391370_391862_-	prophage protein	A0A2P0ZLE0	Lactobacillus_phage	1.6e-49	65.0
BBA80760.1\|391878_396648_-	prophage protein	A0A2P0ZLE1	Lactobacillus_phage	0.0e+00	62.8
BBA80761.1\|396667_397489_-	prophage protein	A0A2P0ZLE2	Lactobacillus_phage	1.3e-149	95.6
BBA80762.1\|397492_402040_-	prophage protein	A0A2P0ZLF1	Lactobacillus_phage	0.0e+00	81.0
BBA80763.1\|402058_402280_-\|tail	prophage protein, tail tape measure protein	A0A2P0ZLD9	Lactobacillus_phage	1.0e-32	100.0
BBA80764.1\|402303_402618_-	prophage protein	A0A2P0ZLF3	Lactobacillus_phage	2.4e-51	96.2
BBA80765.1\|402709_403321_-\|tail	major tail protein	A0A2P0ZLF5	Lactobacillus_phage	5.6e-105	96.1
BBA80766.1\|403335_403758_-	gp10 protein	A0A2P0ZLE4	Lactobacillus_phage	7.4e-72	98.6
BBA80767.1\|403754_404162_-	Gp9 protein	A0A2P0ZLD7	Lactobacillus_phage	1.0e-65	93.3
BBA80768.1\|404158_404548_-	Gp8 protein	A0A2P0ZLD1	Lactobacillus_phage	4.9e-62	87.6
BBA80769.1\|404528_404819_-	prophage protein	A0A2P0ZLD5	Lactobacillus_phage	1.3e-43	94.8
BBA80770.1\|404957_406130_-\|head	major head protein Cps	A0A2P0ZLD6	Lactobacillus_phage	1.7e-110	54.8
BBA80771.1\|406152_406875_-\|head	prophage protein, major head protein	A0A2P0ZLE3	Lactobacillus_phage	4.8e-95	75.0
BBA80772.1\|406861_407995_-\|portal	phage portal protein, HK97 family	A0A2P0ZLC9	Lactobacillus_phage	4.1e-210	96.8
BBA80773.1\|408013_409693_-\|portal	prophage protein, portal protein, HK97 family	A0A2P0ZLE5	Lactobacillus_phage	0.0e+00	97.9
BBA80774.1\|409689_409977_-	Gp1 protein	A0A2P0ZLC8	Lactobacillus_phage	4.4e-44	97.9
BBA80775.1\|410085_410328_-	prophage protein	A0A2P0ZLD2	Lactobacillus_phage	9.9e-37	92.5
BBA80776.1\|410345_410588_-	prophage protein	A0A2P0ZLD3	Lactobacillus_phage	4.7e-31	82.5
BBA80777.1\|410587_410926_-	Gp65 protein	A0A2P0ZLC6	Lactobacillus_phage	5.2e-60	93.8
BBA80778.1\|410909_411125_-	prophage protein	A0A2P0ZLC2	Lactobacillus_phage	1.8e-29	90.1
BBA80779.1\|411425_412109_-	hypothetical protein	Q20DE0	Lactobacillus_phage	3.0e-38	42.4
BBA80780.1\|412263_412965_-	uncharacterized protein	NA	NA	NA	NA
BBA80781.1\|413040_413454_-	prophage protein	A0A2P0ZLC0	Lactobacillus_phage	1.4e-70	99.3
BBA80782.1\|413465_413774_-	prophage protein	A0A2P0ZLD0	Lactobacillus_phage	6.6e-46	90.1
BBA80783.1\|413905_414391_-	prophage protein	A0A2P0ZLB8	Lactobacillus_phage	1.1e-18	40.9
BBA80784.1\|414402_414654_-	hypothetical protein	NA	NA	NA	NA
BBA80785.1\|414650_414827_-	hypothetical protein	A0A1S5RCW8	Lactobacillus_phage	6.3e-17	81.8
BBA80786.1\|414829_414997_-	prophage P2a protein 25	A0A2P0ZLB5	Lactobacillus_phage	6.6e-16	85.5
BBA80787.1\|414989_415238_-	uncharacterized protein	NA	NA	NA	NA
BBA80788.1\|415247_415583_-	prophage protein	A0A2P0ZLB6	Lactobacillus_phage	1.7e-58	96.4
BBA80789.1\|415835_417101_-	prophage Lp3 protein 8, helicase	A0A2P0ZLC4	Lactobacillus_phage	1.7e-228	93.8
BBA80790.1\|417097_417892_-	prophage protein	A0A2P0ZLB0	Lactobacillus_phage	6.0e-123	84.9
BBA80791.1\|417962_418595_-	prophage protein	A0A2P0ZLB9	Lactobacillus_phage	1.6e-102	98.4
BBA80792.1\|418597_419314_-	phage NTP-binding protein	A0A2P0ZLB2	Lactobacillus_phage	1.6e-114	99.5
BBA80793.1\|419310_420570_-	prophage protein, NTP-binding protein	A0A2P0ZLA5	Lactobacillus_phage	1.0e-233	98.1
BBA80794.1\|420721_421201_-	hypothetical protein	A0A2P0ZLB3	Lactobacillus_phage	8.4e-72	86.2
BBA80795.1\|421197_421317_-	hypothetical protein	A0A2P0ZLA8	Lactobacillus_phage	1.5e-14	97.4
BBA80796.1\|421304_421622_-	uncharacterized protein	A0A2P0ZLA7	Lactobacillus_phage	6.0e-58	99.0
BBA80797.1\|421624_421804_-	hypothetical protein	A0A2P0ZLA6	Lactobacillus_phage	8.9e-27	100.0
BBA80798.1\|421766_421952_-	hypothetical protein	A0A2P0ZLA3	Lactobacillus_phage	7.0e-27	88.5
BBA80799.1\|421944_422121_-	hypothetical protein	A0A2P0ZLB1	Lactobacillus_phage	6.5e-22	82.8
BBA80800.1\|422101_422383_-	hypothetical protein	NA	NA	NA	NA
BBA80801.1\|422497_422836_-	hypothetical protein	E9LUT3	Lactobacillus_phage	7.3e-30	66.7
BBA80802.1\|422835_423039_-	hypothetical protein	A0A2P0ZLA4	Lactobacillus_phage	5.5e-25	85.1
BBA80803.1\|423042_423252_-	hypothetical protein	A0A2P0ZL97	Lactobacillus_phage	1.6e-30	98.6
BBA80804.1\|423573_423948_+	putative prophage Lp1 protein 8	A0A2P0ZLA1	Lactobacillus_phage	1.1e-66	97.6
BBA80805.1\|423957_424389_+	prophage Lp2 protein 8	A0A2P0ZLA0	Lactobacillus_phage	7.6e-80	100.0
BBA80806.1\|424412_424853_+	hypothetical protein	NA	NA	NA	NA
BBA80807.1\|424940_425564_+	hypothetical protein	NA	NA	NA	NA
BBA80808.1\|425686_428479_+	hypothetical protein	Q6NE04	Leptospira_phage	9.4e-147	35.4
BBA80809.1\|428649_429780_+	hypothetical protein	A0A0M9JJ77	Lactobacillus_phage	1.2e-92	48.2
BBA80810.1\|430369_432637_-	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	5.1e-119	31.5

DBSCAN-SWA_3

764530 : 807718

unidentified_phage(27.27%)

integrase,transposase,bacteriocin,tRNA

attL 804128:804187|attR 807416:808119

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA81111.1\|764530_765199_-\|transposase	probable transposase for insertion-like sequence element IS1161	H7BW61	unidentified_phage	1.2e-20	32.3
BBA81112.1\|765692_766394_+	amino acid transport protein	NA	NA	NA	NA
BBA81113.1\|766390_766717_+	branched-chain amino acid transport protein	NA	NA	NA	NA
BBA81114.1\|767187_769089_+	asparagine synthase	R4TIC1	Phaeocystis_globosa_virus	3.0e-35	32.7
BBA81115.1\|769093_770296_+	aspartate kinase	NA	NA	NA	NA
BBA81116.1\|770490_771972_+	UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
BBA81117.1\|772315_773716_+	carbohydrate (isoprimoverose-like)/proton symporter, GPH family	NA	NA	NA	NA
BBA81118.1\|773699_774716_+	esterase	NA	NA	NA	NA
BBA81119.1\|774889_775189_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
BBA81120.1\|775397_776066_-	phosphoglycerate mutase family protein	NA	NA	NA	NA
BBA81121.1\|776197_776764_-	acetyltransferase, GNAT family	NA	NA	NA	NA
BBA81122.1\|776817_777582_-	integral membrane protein	NA	NA	NA	NA
BBA81123.1\|777578_778718_-	integral membrane protein	NA	NA	NA	NA
BBA81124.1\|778792_779794_-	hypothetical protein	NA	NA	NA	NA
BBA81125.1\|780213_780978_-	integral membrane protein	NA	NA	NA	NA
BBA81126.1\|781331_781658_+	transcription regulator, ArsR family	NA	NA	NA	NA
BBA81127.1\|781849_782731_-	pseudouridylate synthase	NA	NA	NA	NA
BBA81128.1\|782773_784582_-	ATP-dependent DNA helicase RecQ	M1PGQ0	Moumouvirus	6.6e-77	35.9
BBA81129.1\|784839_785037_-\|transposase	transposase	NA	NA	NA	NA
BBA81130.1\|785256_785523_+	hypothetical protein	NA	NA	NA	NA
BBA81131.1\|785573_786806_+	hypothetical protein	NA	NA	NA	NA
BBA81132.1\|786841_788248_+	dipeptidase	NA	NA	NA	NA
BBA81133.1\|788700_789708_+	asparagine synthetase AsnA	A0A1C9C5F0	Heterosigma_akashiwo_virus	1.4e-63	43.0
BBA81134.1\|789746_791042_+\|tRNA	asparaginyl-tRNA synthetase	A0A2P1EMB4	Moumouvirus	2.7e-56	31.0
BBA81135.1\|791211_791841_+	ACP phosphodieterase	NA	NA	NA	NA
BBA81136.1\|791949_792423_+	transcription regulator	NA	NA	NA	NA
BBA81137.1\|792698_794564_-	fumarate reductase, flavoprotein subunit precursor	A0A2P0ZL82	Lactobacillus_phage	5.2e-16	26.2
BBA81138.1\|794774_795701_+	transcription regulator	A0A2P0ZL89	Lactobacillus_phage	3.2e-19	25.8
BBA81139.1\|795771_796323_-	cro/CI family transcriptional regulator	X2CXD8	Lactobacillus_phage	3.7e-07	48.4
BBA81140.1\|796422_797175_-	cro/CI family transcriptional regulator	NA	NA	NA	NA
BBA81141.1\|797243_797738_-	uncharacterized protein	NA	NA	NA	NA
BBA81142.1\|797825_797945_-	hypothetical protein	NA	NA	NA	NA
BBA81143.1\|798867_801912_+	mucus-binding protein, LPXTG-motif cell wall anchor	NA	NA	NA	NA
BBA81144.1\|802026_802557_+	histidine phosphatase superfamily protein	NA	NA	NA	NA
BBA81145.1\|802870_803236_-	uncharacterized protein	NA	NA	NA	NA
BBA81146.1\|803495_803837_+	type I restriction modification DNA specificity domain protein	NA	NA	NA	NA
804128:804187	attL	NA	NA	NA	NA
BBA81147.1\|804145_804814_+\|transposase	probable transposase for insertion-like sequence element IS1161	H7BW61	unidentified_phage	1.2e-20	32.3
BBA81148.1\|804816_805041_+	type I restriction modification system S subunit HsdS1	NA	NA	NA	NA
BBA81149.1\|805051_805969_-\|integrase	integrase	A8ATM2	Listeria_phage	5.9e-74	44.7
BBA81150.1\|806120_806630_-	hypothetical protein	NA	NA	NA	NA
BBA81151.1\|806788_807718_-\|transposase	transposase, IS30 family	H7BW61	unidentified_phage	1.3e-20	30.2
807416:808119	attR	NA	NA	NA	NA

DBSCAN-SWA_4

826981 : 870433

Lactobacillus_phage(14.29%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA81168.1\|826981_827674_-\|protease	CAAX family protease	NA	NA	NA	NA
BBA81169.1\|827975_830939_-	superfamily I DNA/RNA helicase	NA	NA	NA	NA
BBA81170.1\|831475_831844_+	transcription regulator	E9LUL4	Lactobacillus_phage	5.9e-17	42.7
BBA81171.1\|832077_832446_+	integral membrane protein	NA	NA	NA	NA
BBA81172.1\|832771_834328_-	GMP synthase	A0A1V0SH76	Hokovirus	5.6e-16	29.2
BBA81173.1\|834421_835351_-	pantothenate kinase	NA	NA	NA	NA
BBA81174.1\|835519_836449_-	enoyl-ACP reductase	NA	NA	NA	NA
BBA81175.1\|836743_839050_-	DNA helicase	NA	NA	NA	NA
BBA81176.1\|839281_839929_+	DedA family protein	NA	NA	NA	NA
BBA81177.1\|840062_841016_+	7,8-dihydro-8-oxoguanine-triphosphatase	NA	NA	NA	NA
BBA81178.1\|841037_842894_+	Na(+)/H(+) antiporter	NA	NA	NA	NA
BBA81179.1\|842964_843621_+	phosphoglycerate mutase family protein	NA	NA	NA	NA
BBA81180.1\|843635_844313_+	phosphoglycerate mutase	NA	NA	NA	NA
BBA81181.1\|844502_845678_+\|transposase	transposase	NA	NA	NA	NA
BBA81182.1\|845989_846190_-	membrane protein	NA	NA	NA	NA
BBA81183.1\|846496_846811_-	molecular chaperone GroEL	NA	NA	NA	NA
BBA81184.1\|846952_847390_-	MutT/nudix family protein	A0A1V0SJK7	Klosneuvirus	3.6e-05	40.6
BBA81185.1\|847478_848774_+	GTP-binding protein HflX	NA	NA	NA	NA
BBA81186.1\|848886_849447_-	transcription regulator, TetR family	NA	NA	NA	NA
BBA81187.1\|849774_850266_+	transport protein	NA	NA	NA	NA
BBA81188.1\|850385_851543_-	multidrug transport protein, major facilitator superfamily	NA	NA	NA	NA
BBA81189.1\|851539_851971_-	MarR family transcriptional regulator	NA	NA	NA	NA
BBA81190.1\|852115_852994_-	integral membrane protein	NA	NA	NA	NA
BBA81191.1\|853267_853708_+	transcription regulator, MarR family	NA	NA	NA	NA
BBA81192.1\|853740_853941_-	hypothetical protein	NA	NA	NA	NA
BBA81193.1\|853978_855310_+	amino acid permease	NA	NA	NA	NA
BBA81194.1\|855443_856202_-	PTS-related protein	NA	NA	NA	NA
BBA81195.1\|856208_857660_-	beta-glucosides PTS, EIIBC	NA	NA	NA	NA
BBA81196.1\|857687_858530_-	transcription antiterminator	NA	NA	NA	NA
BBA81197.1\|858555_859047_-	PTS system transporter subunit IIA	NA	NA	NA	NA
BBA81198.1\|859390_859621_+\|transposase	transposase	NA	NA	NA	NA
BBA81199.1\|859583_860306_+\|transposase	transposase	A0A146ICT8	Staphylococcus_phage	3.5e-29	37.4
BBA81200.1\|860345_861041_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	1.0e-41	51.1
BBA81201.1\|861071_861725_-	ABC-type amino acid transport system, permease component	NA	NA	NA	NA
BBA81202.1\|861741_862383_-	ABC-type amino acid transport system, permease component	NA	NA	NA	NA
BBA81203.1\|862382_863219_-	glutamine ABC transporter, substrate binding protein	NA	NA	NA	NA
BBA81204.1\|863239_863980_-	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-35	40.0
BBA81205.1\|864299_864455_-	hypothetical protein	NA	NA	NA	NA
BBA81206.1\|864512_864764_+	hypothetical protein	NA	NA	NA	NA
BBA81207.1\|864997_865990_-	bifunctional protein: amino acid aminotransferase; 2-hydroxyacid dehydrogenase	M1HI29	Paramecium_bursaria_Chlorella_virus	1.4e-41	34.3
BBA81208.1\|865992_867183_-	aspartate transaminase	NA	NA	NA	NA
BBA81209.1\|867588_868215_+	phosphohydrolase	NA	NA	NA	NA
BBA81210.1\|868157_868382_-	uncharacterized protein	NA	NA	NA	NA
BBA81211.1\|868407_869226_-	membrane protein	NA	NA	NA	NA
BBA81212.1\|869229_869718_-	extracellular protein, Ser/Thr-rich	NA	NA	NA	NA
BBA81213.1\|869902_870433_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_5

1027787 : 1036412

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA81350.1\|1027787_1028783_-	UDP-glucose 4-epimerase	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9
BBA81351.1\|1028921_1029707_-	acyl-[acyl-carrier protein] thioesterase	NA	NA	NA	NA
BBA81352.1\|1029710_1030607_-	methyltransferase	M1PLC5	Streptococcus_phage	1.7e-81	55.7
BBA81353.1\|1030705_1031053_-	initiation-control protein yabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
BBA81354.1\|1031077_1032097_-	DNA-directed DNA polymerase III delta' subunit	M1NSC1	Streptococcus_phage	2.1e-32	33.5
BBA81355.1\|1032113_1032443_-	hypothetical protein	NA	NA	NA	NA
BBA81356.1\|1032439_1033105_-	thymidylate kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
BBA81357.1\|1033503_1033755_-	hypothetical protein	NA	NA	NA	NA
BBA81358.1\|1033769_1034369_-	recombination protein RecR	NA	NA	NA	NA
BBA81359.1\|1034384_1034693_-	nucleoid-associated protein	NA	NA	NA	NA
BBA81360.1\|1034714_1036412_-	DNA-directed DNA polymerase III gamma/tau subunit	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0

DBSCAN-SWA_6

1048197 : 1061272

Lactobacillus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA81370.1\|1048197_1048569_-	prophage Lp2 protein 58	A0A2K9VCG4	Lactobacillus_phage	9.2e-18	71.2
BBA81371.1\|1048580_1048844_-	hypothetical protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
BBA81372.1\|1048843_1050007_-	prophage Lp1 protein 58, lysin	E9LUR8	Lactobacillus_phage	2.0e-191	86.7
BBA81373.1\|1050020_1050236_-	prophage P2a protein 54	A0A0A1ENR9	Lactobacillus_phage	2.0e-17	76.1
BBA81374.1\|1050232_1051318_-	prophage Lp2 protein 53	A0A2P0ZLF6	Lactobacillus_phage	1.3e-32	49.0
BBA81375.1\|1051332_1051479_-	prophage P1 protein 57	NA	NA	NA	NA
BBA81376.1\|1051475_1051796_-	uncharacterized protein	NA	NA	NA	NA
BBA81377.1\|1051807_1052551_-	uncharacterized protein	NA	NA	NA	NA
BBA81378.1\|1052564_1054406_-	uncharacterized protein	A0A2P0ZKZ2	Lactobacillus_phage	2.5e-140	51.2
BBA81379.1\|1054406_1054700_-	uncharacterized protein	NA	NA	NA	NA
BBA81380.1\|1054689_1054956_-	prophage P2a protein 51	NA	NA	NA	NA
BBA81381.1\|1054952_1056074_-	prophage P2a protein 50	A0A0M7RDS2	Lactobacillus_phage	2.0e-23	32.7
BBA81382.1\|1056130_1057027_-	prophage P2a protein 49	A8ATA8	Listeria_phage	2.0e-18	28.9
BBA81383.1\|1057036_1061272_-	prophage Lp1 protein 50	E9LUR1	Lactobacillus_phage	6.1e-65	33.3

DBSCAN-SWA_7

1064333 : 1087507

Lactobacillus_phage(62.5%)

integrase,terminase,capsid,portal

attL 1063417:1063430|attR 1091825:1091838

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1063417:1063430	attL	NA	NA	NA	NA
BBA81391.1\|1064333_1065404_-\|capsid	prophage P1 protein 42, major capsid protein	A0A0P0HSG2	Acinetobacter_phage	1.7e-40	32.6
BBA81392.1\|1065417_1066065_-	prophage P2a protein 39	NA	NA	NA	NA
BBA81393.1\|1066173_1067118_-	prophage P2a protein 38	NA	NA	NA	NA
BBA81394.1\|1067131_1068808_-\|portal	prophage P1 protein 39, portal protein	D2IYW2	Enterococcus_phage	1.7e-66	33.0
BBA81395.1\|1068797_1070084_-	prophage P2a protein 36	B7T0C6	Staphylococcus_virus	1.8e-113	49.9
BBA81396.1\|1070067_1070595_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	2.5e-48	70.1
BBA81397.1\|1070634_1070898_-	uncharacterized protein	A0A1S5RCN3	Lactobacillus_phage	2.4e-28	69.8
BBA81398.1\|1070884_1071049_-	prophage P2a protein 32	E9LUP6	Lactobacillus_phage	2.5e-07	58.7
BBA81399.1\|1071273_1071441_-	uncharacterized protein	NA	NA	NA	NA
BBA81400.1\|1071632_1072250_+	hypothetical protein	NA	NA	NA	NA
BBA81401.1\|1072254_1072425_-	hypothetical protein	NA	NA	NA	NA
BBA81402.1\|1072514_1072976_-	prophage P1 protein 33, phage transcription regulator, ArpU family	D6PSV8	Lactobacillus_phage	6.3e-40	57.0
BBA81403.1\|1073054_1073192_-	uncharacterized protein	NA	NA	NA	NA
BBA81404.1\|1073219_1073480_-	uncharacterized protein	A0A2H4PB64	Lactobacillus_phage	4.3e-14	54.1
BBA81405.1\|1073483_1073807_-	putative uncharacterized protein	Q8LTB5	Lactobacillus_phage	8.3e-31	86.3
BBA81406.1\|1073796_1074015_-	hypothetical protein	B4XYT5	Lactobacillus_phage	7.5e-20	63.4
BBA81407.1\|1074089_1074407_-	uncharacterized protein	O03921	Lactobacillus_phage	1.9e-27	56.1
BBA81408.1\|1074399_1074579_-	uncharacterized protein	K4HZV9	Lactobacillus_phage	1.9e-16	66.1
BBA81409.1\|1074716_1074848_-	prophage P1 protein 26	O03917	Lactobacillus_phage	3.0e-16	95.3
BBA81410.1\|1074850_1075081_-	prophage P1 protein 25	O03916	Lactobacillus_phage	3.5e-23	61.8
BBA81411.1\|1075080_1075515_-	uncharacterized protein	A0A288TZS1	Enterococcus_phage	3.6e-29	47.9
BBA81412.1\|1075511_1075889_-	prophage Lp2 protein 24	NA	NA	NA	NA
BBA81413.1\|1075885_1076404_-	prophage Lp2 protein 23	O03915	Lactobacillus_phage	2.9e-41	55.3
BBA81414.1\|1076408_1077131_-	bacteriophage antirepressor	A0A141E1D3	Streptococcus_phage	2.5e-51	46.4
BBA81415.1\|1077127_1077415_-	prophage P2a protein 21	NA	NA	NA	NA
BBA81416.1\|1077411_1078365_-	DnaD domain protein	NA	NA	NA	NA
BBA81417.1\|1078446_1079319_-	prophage Lp1 protein 19	A0A0P0IZH9	Lactobacillus_phage	2.8e-73	49.6
BBA81418.1\|1079230_1080130_-	recombination protein RecT	E9LUM3	Lactobacillus_phage	1.0e-62	47.7
BBA81419.1\|1080132_1080513_-	prophage Lp1 protein 17	NA	NA	NA	NA
BBA81420.1\|1080509_1080686_-	uncharacterized protein	NA	NA	NA	NA
BBA81421.1\|1080654_1080783_-	prophage P1 protein 16	NA	NA	NA	NA
BBA81422.1\|1080892_1081180_-	prophage P1 protein 15	NA	NA	NA	NA
BBA81423.1\|1081185_1081740_-	prophage P1 protein 14	O03909	Lactobacillus_phage	1.6e-95	97.3
BBA81424.1\|1081800_1081983_-	prophage P1 protein 13	NA	NA	NA	NA
BBA81425.1\|1082062_1082284_+	hypothetical protein	E8ZD70	Streptococcus_phage	5.0e-19	66.2
BBA81426.1\|1082280_1082481_-	uncharacterized protein	NA	NA	NA	NA
BBA81427.1\|1082477_1082732_-	uncharacterized protein	A0A2H4JFN1	uncultured_Caudovirales_phage	1.1e-06	42.9
BBA81428.1\|1082873_1083392_+	immunity repressor protein	S6C481	Thermus_phage	1.6e-15	34.1
BBA81429.1\|1083406_1083829_+	hypothetical protein	NA	NA	NA	NA
BBA81430.1\|1083933_1084776_+	hypothetical protein	NA	NA	NA	NA
BBA81431.1\|1084796_1085726_+	uncharacterized protein	NA	NA	NA	NA
BBA81432.1\|1085708_1085900_-	kinase domain protein	NA	NA	NA	NA
BBA81433.1\|1086304_1087507_+\|integrase	prophage P1 protein 1, integrase	A0A1S5SA16	Streptococcus_phage	9.9e-37	29.5
1091825:1091838	attR	NA	NA	NA	NA

DBSCAN-SWA_8

1106548 : 1176084

unidentified_phage(20.0%)

integrase,transposase,protease,tRNA

attL 1145968:1145992|attR 1161044:1161068

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA81457.1\|1106548_1107472_+\|transposase	transposase, IS30 family	H7BVY4	unidentified_phage	6.7e-33	31.9
BBA81458.1\|1107539_1108217_-	2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1	NA	NA	NA	NA
BBA81459.1\|1108366_1109392_-	permease, drug/metabolite transporter (DMT) superfamily	NA	NA	NA	NA
BBA81460.1\|1109824_1110787_-	malate transport protein	NA	NA	NA	NA
BBA81461.1\|1111096_1112290_+	transcriptional attenuator, cell envelope-related, LytR family	NA	NA	NA	NA
BBA81462.1\|1112357_1113131_-	acetyl-CoA carboxylase, carboxyl transferase subunit alpha	NA	NA	NA	NA
BBA81463.1\|1113123_1113927_-	acetyl-CoA carboxylase, carboxyl transferase subunit beta	NA	NA	NA	NA
BBA81464.1\|1113923_1115246_-	acetyl-CoA carboxylase, biotin carboxylase subunit	NA	NA	NA	NA
BBA81465.1\|1115248_1115650_-	acetyl-CoA carboxylase, biotin carboxyl carrier protein	NA	NA	NA	NA
BBA81466.1\|1115660_1116632_-	3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1	NA	NA	NA	NA
BBA81467.1\|1116795_1117314_-	PTS system, mannose-specific EIIB component	NA	NA	NA	NA
BBA81468.1\|1117310_1117730_-	PTS system, mannose-specific EIIAcomponent	NA	NA	NA	NA
BBA81469.1\|1117800_1120650_-	transcription regulator	NA	NA	NA	NA
BBA81470.1\|1120955_1121342_-	hypothetical protein	NA	NA	NA	NA
BBA81471.1\|1121470_1122403_-	PTS mannose transporter subunit IID	NA	NA	NA	NA
BBA81472.1\|1122421_1123228_-	PTS alpha-glucoside transporter subunit IIBC	NA	NA	NA	NA
BBA81473.1\|1123263_1124238_-	mannose PTS, EIIAB	NA	NA	NA	NA
BBA81474.1\|1124528_1125350_-	extracellular protein	NA	NA	NA	NA
BBA81475.1\|1125754_1126630_-	homoserine kinase	NA	NA	NA	NA
BBA81476.1\|1126638_1127925_-	homoserine dehydrogenase	NA	NA	NA	NA
BBA81477.1\|1127990_1128437_-	SprT family metallopeptidase	NA	NA	NA	NA
BBA81478.1\|1128436_1130608_-	transcription accessory protein, contains S1 RNA binding domain	NA	NA	NA	NA
BBA81479.1\|1130901_1131336_-	hypothetical protein	NA	NA	NA	NA
BBA81480.1\|1131390_1134066_-	E1-E2 family cation-transporting ATPase	M1I547	Acanthocystis_turfacea_Chlorella_virus	8.9e-70	28.9
BBA81481.1\|1134500_1135328_-	NH(3)-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.5e-72	54.0
BBA81482.1\|1135327_1136806_-	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	2.5e-106	44.1
BBA81483.1\|1136962_1137700_+	teichoic acid biosynthesis protein A	NA	NA	NA	NA
BBA81484.1\|1137869_1138571_-	transcriptional regulator	NA	NA	NA	NA
BBA81485.1\|1138594_1139731_-	N-acetylglucosamine-6-phosphate deacetylase	NA	NA	NA	NA
BBA81486.1\|1139809_1140601_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.5e-30	36.1
BBA81487.1\|1140961_1141783_+	ribosyl nicotinamide transporter, PnuC-like protein	A0A2K9VCL6	Lactobacillus_phage	2.6e-52	42.2
BBA81488.1\|1141975_1143082_+	di-and tricarboxylate transporter	NA	NA	NA	NA
BBA81489.1\|1143240_1144083_-	serine/threonine protein phosphatase	NA	NA	NA	NA
BBA81490.1\|1144117_1144453_-	hypothetical protein	NA	NA	NA	NA
BBA81491.1\|1144483_1144801_-	hypothetical protein	NA	NA	NA	NA
BBA81492.1\|1145187_1145646_-	hypothetical protein	NA	NA	NA	NA
1145968:1145992	attL	NA	NA	NA	NA
BBA81493.1\|1146254_1146461_+	uncharacterized protein	NA	NA	NA	NA
BBA81494.1\|1146772_1147309_+	uncharacterized protein	NA	NA	NA	NA
BBA81495.1\|1147393_1147834_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-19	43.0
BBA81496.1\|1147814_1148438_-\|transposase	probable transposase for insertion-like sequence element IS1161	NA	NA	NA	NA
BBA81497.1\|1148805_1150404_+	putative amino acid transporter	NA	NA	NA	NA
BBA81498.1\|1150611_1151535_+\|transposase	transposase, IS30 family	H7BVY4	unidentified_phage	6.7e-33	31.9
BBA81499.1\|1152013_1152340_-	uncharacterized protein	NA	NA	NA	NA
BBA81500.1\|1153372_1153786_-	prophage P3 protein 12	NA	NA	NA	NA
BBA81501.1\|1153787_1154162_-	prophage P3 protein 11, DNA replication	NA	NA	NA	NA
BBA81502.1\|1154772_1156191_-	virulence-Associated E family protein	A0A0A7RTG3	Clostridium_phage	1.2e-73	36.1
BBA81503.1\|1156202_1156982_-	prophage P3 protein 7, DNA replication	A0A060ADS5	Enterococcus_phage	1.3e-21	31.3
BBA81504.1\|1156994_1157216_-	prophage P3 protein 6	NA	NA	NA	NA
BBA81505.1\|1157208_1157631_-	prophage P3 protein 5	NA	NA	NA	NA
BBA81506.1\|1157943_1158237_-	prophage P3 protein 4	NA	NA	NA	NA
BBA81507.1\|1158263_1158950_-	prophage Lp4 protein 3, phage-like repressor	A0A192Y918	Salmonella_phage	9.1e-11	30.9
BBA81508.1\|1158962_1159157_-	uncharacterized protein	NA	NA	NA	NA
BBA81509.1\|1159279_1159696_+	prophage P3 protein 2, CI-like repressor	NA	NA	NA	NA
BBA81510.1\|1159745_1160891_+\|integrase	prophage P3 protein 1, integrase	S5MBZ0	Brevibacillus_phage	4.0e-43	31.7
BBA81511.1\|1161283_1162117_-	phosphoesterase	NA	NA	NA	NA
1161044:1161068	attR	NA	NA	NA	NA
BBA81512.1\|1162180_1163653_-	dipeptide/tripeptide transport protein	A0A0P0IY73	Acinetobacter_phage	2.1e-68	34.3
BBA81513.1\|1170200_1171700_-\|tRNA	lysyl-tRNA synthetase	A0A2K9L3L6	Tupanvirus	1.6e-89	37.5
BBA81514.1\|1171803_1172811_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
BBA81515.1\|1172810_1173698_-	33 kDa chaperonin	NA	NA	NA	NA
BBA81516.1\|1173846_1176084_-\|protease	ATP-dependent Zn protease	G8DDJ2	Micromonas_pusilla_virus	6.0e-104	47.8

DBSCAN-SWA_9

1226080 : 1286963

uncultured_Mediterranean_phage(20.0%)

transposase,bacteriocin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA81558.1\|1226080_1227352_-\|tRNA	seryl-tRNA synthetase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.5e-96	43.7
BBA81559.1\|1227818_1229432_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.2e-143	49.9
BBA81560.1\|1229604_1230213_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
BBA81561.1\|1230257_1230698_-	hypothetical protein	NA	NA	NA	NA
BBA81562.1\|1231183_1231993_+	lipoate-protein ligase A	NA	NA	NA	NA
BBA81563.1\|1232007_1233360_+	hydrolase	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
BBA81564.1\|1233379_1234189_+	hydrolase, HAD superfamily, Cof family	NA	NA	NA	NA
BBA81565.1\|1234358_1235345_-	lipoprotein precursor	NA	NA	NA	NA
BBA81566.1\|1235427_1236450_-	hypothetical membrane protein	NA	NA	NA	NA
BBA81567.1\|1236738_1237719_-	ribose-phosphate pyrophosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
BBA81568.1\|1238084_1238909_-	beta-lactamase	NA	NA	NA	NA
BBA81569.1\|1239144_1240527_-	bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase	A0A2K9L140	Tupanvirus	7.4e-28	33.2
BBA81570.1\|1240595_1241432_-	purine operon repressor	NA	NA	NA	NA
BBA81571.1\|1241787_1242591_-	zinc/iron ABC transporter, permease protein	NA	NA	NA	NA
BBA81572.1\|1242577_1243276_-	zinc/iron ABC transporter, ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
BBA81573.1\|1243544_1244489_-	family S9 peptidase	NA	NA	NA	NA
BBA81574.1\|1244798_1245665_-	4-diphosphocytidyl-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
BBA81575.1\|1245797_1246049_-	Veg protein	NA	NA	NA	NA
BBA81576.1\|1246153_1247041_-	dimethyladenosine transferase	NA	NA	NA	NA
BBA81577.1\|1247040_1247580_-	ribonuclease M5	NA	NA	NA	NA
BBA81578.1\|1247590_1248367_-	DNase, TatD family	NA	NA	NA	NA
BBA81579.1\|1248489_1249674_-	drug resistance transporter	NA	NA	NA	NA
BBA81580.1\|1249906_1251958_-\|tRNA	methionyl-tRNA synthetase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
BBA81581.1\|1252125_1252317_-	uncharacterized protein	NA	NA	NA	NA
BBA81582.1\|1252279_1252669_-	phosphohydrolase	NA	NA	NA	NA
BBA81583.1\|1253263_1254106_-	hypothetical protein	NA	NA	NA	NA
BBA81584.1\|1254105_1254810_-	NAD-dependent deacetylase	NA	NA	NA	NA
BBA81585.1\|1254831_1255791_-	hypothetical protein	NA	NA	NA	NA
BBA81586.1\|1255783_1257058_-	hydroxymethylglutaryl-CoA reductase	NA	NA	NA	NA
BBA81587.1\|1257103_1257961_-	exopolyphosphatase	NA	NA	NA	NA
BBA81588.1\|1258462_1259476_-\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
BBA81589.1\|1259588_1260335_-	transcription regulator	NA	NA	NA	NA
BBA81590.1\|1260484_1261381_-	sugar kinase and transcription regulator	NA	NA	NA	NA
BBA81591.1\|1261461_1262898_-	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.3e-30	25.5
BBA81592.1\|1262915_1264274_-	cellobiose PTS, EIIC	NA	NA	NA	NA
BBA81593.1\|1264493_1264916_-	hypothetical protein	NA	NA	NA	NA
BBA81594.1\|1264905_1265094_-	hypothetical protein	NA	NA	NA	NA
BBA81595.1\|1265100_1266462_-	PTS system cellobiose-specific transporter subunit IIC	NA	NA	NA	NA
BBA81596.1\|1266534_1267245_-	transcription regulator	NA	NA	NA	NA
BBA81597.1\|1267650_1268667_-\|tRNA	tryptophanyl-tRNA synthetase	NA	NA	NA	NA
BBA81598.1\|1269105_1269882_-	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
BBA81599.1\|1270140_1272450_+	DNA helicase	NA	NA	NA	NA
BBA81600.1\|1272544_1272748_-	putative peptide	NA	NA	NA	NA
BBA81601.1\|1272885_1273572_-	integral membrane protein PlnW	NA	NA	NA	NA
BBA81602.1\|1273665_1274346_-	integral membrane protein PlnV	NA	NA	NA	NA
BBA81603.1\|1274432_1275101_-	membrane protein PlnU	NA	NA	NA	NA
BBA81604.1\|1275168_1275858_-	integral membrane protein PlnT	NA	NA	NA	NA
BBA81605.1\|1275895_1276825_-\|transposase	transposase, IS30 family	H7BW61	unidentified_phage	3.5e-21	30.2
BBA81606.1\|1276994_1278371_-\|bacteriocin	bacteriocin ABC transporter, accessory factor PlnH	NA	NA	NA	NA
BBA81607.1\|1278387_1280538_-\|bacteriocin	bacteriocin ABC-transporter, ATP-binding and permease protein PlnG	W8CYL7	Bacillus_phage	3.6e-45	27.9
BBA81608.1\|1280803_1280974_+\|bacteriocin	bacteriocin precursor peptide PlnE	NA	NA	NA	NA
BBA81609.1\|1280998_1281157_+\|bacteriocin	bacteriocin precursor peptide PlnF	NA	NA	NA	NA
BBA81610.1\|1281356_1281647_-	hypothetical protein	NA	NA	NA	NA
BBA81611.1\|1282322_1283066_-	response regulator PlnD, repressor	NA	NA	NA	NA
BBA81612.1\|1283066_1284407_-	histidine protein kinase PlnB; sensor protein	NA	NA	NA	NA
BBA81613.1\|1284424_1284592_-	putative peptide pheromone/induction peptide	NA	NA	NA	NA
BBA81614.1\|1285184_1285853_+	immunity protein PlnL	NA	NA	NA	NA
BBA81615.1\|1286435_1286657_-	uncharacterized protein	NA	NA	NA	NA
BBA81616.1\|1286783_1286963_-\|bacteriocin	putative bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_10

1673057 : 1734318

Staphylococcus_phage(11.11%)

protease,transposase,tRNA,lysis,integrase

attL 1667374:1667388|attR 1683743:1683757

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1667374:1667388	attL	NA	NA	NA	NA
BBA81976.1\|1673057_1674449_+\|tRNA	tRNA modification GTPase mnmE	NA	NA	NA	NA
BBA81977.1\|1674467_1676378_+\|tRNA	tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA	NA	NA	NA	NA
BBA81978.1\|1676636_1677371_+	cell surface protein, CscB family	NA	NA	NA	NA
BBA81979.1\|1677523_1678579_+	cell surface protein precursor	NA	NA	NA	NA
BBA81980.1\|1678598_1678940_+	cell surface protein	NA	NA	NA	NA
BBA81981.1\|1678959_1680417_+	extracellular protein	NA	NA	NA	NA
BBA81982.1\|1680487_1681486_+\|integrase	integrase catalytic subunit	W5R8L2	Staphylococcus_phage	9.1e-52	37.5
BBA81983.1\|1681828_1682416_+	signal peptidase I	NA	NA	NA	NA
BBA81984.1\|1682492_1682654_+	hypothetical protein	NA	NA	NA	NA
BBA81985.1\|1682643_1683960_+	cysteine aminopeptidase	R4TV59	Phaeocystis_globosa_virus	2.3e-58	30.4
1683743:1683757	attR	NA	NA	NA	NA
BBA81986.1\|1683972_1684395_+	transcription regulator, Xre family	Q9G039	Staphylococcus_virus	1.2e-10	53.1
BBA81987.1\|1684493_1685360_-	DegV family protein	NA	NA	NA	NA
BBA81988.1\|1685517_1686000_+	acetyltransferase, GNAT family	NA	NA	NA	NA
BBA81989.1\|1686794_1687589_+	2-oxo-hept-3-ene-1,7-dioate hydratase; 2-oxo-hept-4-ene-1,7-dioate hydratase	NA	NA	NA	NA
BBA81990.1\|1687750_1688287_-	phenolic acid decarboxylase	NA	NA	NA	NA
BBA81991.1\|1688402_1688948_+	transcriptional regulator of phenolic acid metabolism, PadR family	NA	NA	NA	NA
BBA81992.1\|1689138_1689600_+	nucleotide-binding protein, universal stress protein UspA family	NA	NA	NA	NA
BBA81993.1\|1689888_1692492_+	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
BBA81994.1\|1692751_1693750_+	transcription regulator, LacI family, ribose	NA	NA	NA	NA
BBA81995.1\|1693853_1694774_+	ribokinase	NA	NA	NA	NA
BBA81996.1\|1694776_1695172_+	D-ribose pyranase	NA	NA	NA	NA
BBA81997.1\|1695201_1696086_+	putative ribose uptake protein rbsU	NA	NA	NA	NA
BBA81998.1\|1696390_1697194_+	sorbitol-6-phosphate 2-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	7.6e-09	28.1
BBA81999.1\|1697227_1699093_+	sorbitol operon transcription antiterminator, BglG family	NA	NA	NA	NA
BBA82000.1\|1699092_1699599_+	sorbitol operon activator	NA	NA	NA	NA
BBA82001.1\|1699603_1700155_+	PTS system, glucitol/sorbitol-specific EIIC component	NA	NA	NA	NA
BBA82002.1\|1700178_1701198_+	PTS system, glucitol/sorbitol-specific EIIB component and second of two IIC components	NA	NA	NA	NA
BBA82003.1\|1701225_1701603_+	PTS system, glucitol/sorbitol-specific EIIA component	NA	NA	NA	NA
BBA82004.1\|1701973_1703785_+	pyruvate oxidase	NA	NA	NA	NA
BBA82005.1\|1703957_1704383_+	transcription regulator, Rrf2 family	NA	NA	NA	NA
BBA82006.1\|1704470_1706219_+	pyruvate oxidase	NA	NA	NA	NA
BBA82007.1\|1706245_1707346_+	NAD-independent L-lactate dehydrogenase	NA	NA	NA	NA
BBA82008.1\|1707982_1708216_+	hypothetical protein	NA	NA	NA	NA
BBA82009.1\|1708606_1710721_+\|protease	ATP-dependent Clp protease ATP-binding protein	K4FB40	Cronobacter_phage	1.8e-118	38.9
BBA82010.1\|1710908_1711280_+\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-28	54.1
BBA82011.1\|1711252_1711684_+\|transposase	transposase	NA	NA	NA	NA
BBA82012.1\|1711943_1712540_+	putative AgrB-like protein	NA	NA	NA	NA
BBA82013.1\|1712520_1712649_+	auto-inducing peptide (AIP) precursor	NA	NA	NA	NA
BBA82014.1\|1713198_1713921_+	two-component system histidine protein kinase	NA	NA	NA	NA
BBA82015.1\|1713913_1714657_+	two-component system response regulator	NA	NA	NA	NA
BBA82016.1\|1715012_1715450_+\|lysis	negative regulator of proteolysis	NA	NA	NA	NA
BBA82017.1\|1715607_1717062_-	catalase	A0A2K9L572	Tupanvirus	5.1e-104	46.7
BBA82018.1\|1717407_1717653_+	transglycosylase	NA	NA	NA	NA
BBA82019.1\|1717669_1717804_+	hypothetical protein	NA	NA	NA	NA
BBA82020.1\|1717998_1718547_+	integral membrane protein	NA	NA	NA	NA
BBA82021.1\|1718583_1718778_+	uncharacterized protein	NA	NA	NA	NA
BBA82022.1\|1718742_1719114_-	pyrimidine dimer DNA glycosylase	NA	NA	NA	NA
BBA82023.1\|1719581_1720787_+	NAD(FAD)-dependent dehydrogenase	NA	NA	NA	NA
BBA82024.1\|1720925_1721612_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
BBA82025.1\|1722014_1723091_+	arabinose operon repressor	NA	NA	NA	NA
BBA82026.1\|1723385_1724786_+	arabinose transport protein	O13311	Aichi_virus	5.9e-33	30.2
BBA82027.1\|1724802_1726404_+	carbohydrate kinase FGGY	NA	NA	NA	NA
BBA82028.1\|1726421_1727150_+	L-ribulose-5-phosphate 4-epimerase	NA	NA	NA	NA
BBA82029.1\|1727201_1728626_+	L-arabinose isomerase	NA	NA	NA	NA
BBA82030.1\|1728706_1729267_+	arabinose O-acetyltransferase	NA	NA	NA	NA
BBA82031.1\|1729348_1729747_+	uncharacterized protein	NA	NA	NA	NA
BBA82032.1\|1729826_1732217_-	phosphoketolase	NA	NA	NA	NA
BBA82033.1\|1732385_1733153_-	transcription regulator	NA	NA	NA	NA
BBA82034.1\|1733286_1734318_-\|transposase	putative transposase	H7BUM7	unidentified_phage	3.6e-43	34.7

DBSCAN-SWA_11

2069097 : 2090355

Lactobacillus_phage(33.33%)

integrase,transposase

attL 2089125:2089139|attR 2092530:2092544

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82343.1\|2069097_2069934_+\|transposase	transposase	A0A146ICT8	Staphylococcus_phage	2.9e-27	36.4
BBA82344.1\|2069816_2070758_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	2.1e-66	54.1
BBA82345.1\|2071268_2071892_-\|transposase	transposase insF for insertion sequence IS3	Q6J1X2	Lactobacillus_phage	1.4e-114	99.5
BBA82346.1\|2071871_2072051_+	uncharacterized protein	NA	NA	NA	NA
BBA82347.1\|2072164_2072416_-\|transposase	transposase	Q6J1X3	Lactobacillus_phage	9.2e-38	96.4
BBA82348.1\|2072502_2072736_+	transcription regulator, GntR family	NA	NA	NA	NA
BBA82349.1\|2072992_2075143_+	hypothetical protein	NA	NA	NA	NA
BBA82350.1\|2075142_2076471_+	Dnd system-associated protein 1	NA	NA	NA	NA
BBA82351.1\|2076451_2081725_+	uncharacterized protein	NA	NA	NA	NA
BBA82352.1\|2081927_2083193_-	hypothetical membrane protein	Q9AZW5	Lactococcus_phage	2.8e-21	41.0
BBA82353.1\|2083364_2083700_+\|transposase	transposase	NA	NA	NA	NA
BBA82354.1\|2083649_2083928_-	uncharacterized protein	NA	NA	NA	NA
BBA82355.1\|2083888_2084050_-	uncharacterized protein	NA	NA	NA	NA
BBA82356.1\|2084373_2084649_+	hypothetical protein	NA	NA	NA	NA
BBA82357.1\|2084653_2084914_+	uncharacterized protein	NA	NA	NA	NA
BBA82358.1\|2085070_2085448_+	membrane protein	NA	NA	NA	NA
BBA82359.1\|2085473_2085731_+	uncharacterized protein	NA	NA	NA	NA
BBA82360.1\|2085766_2086165_+	membrane protein	NA	NA	NA	NA
BBA82361.1\|2086236_2086506_+	uncharacterized protein	NA	NA	NA	NA
BBA82362.1\|2086521_2087322_+	uncharacterized protein	NA	NA	NA	NA
BBA82363.1\|2087341_2087860_+	lipoprotein	NA	NA	NA	NA
BBA82364.1\|2088003_2088438_+	uncharacterized protein	NA	NA	NA	NA
BBA82365.1\|2088605_2089232_+	uncharacterized protein	NA	NA	NA	NA
2089125:2089139	attL	NA	NA	NA	NA
BBA82366.1\|2089224_2090355_+\|integrase	prophage Lp2 protein 2, integrase	A0A0M5M609	Bacillus_phage	2.0e-23	26.4
BBA82366.1\|2089224_2090355_+\|integrase	prophage Lp2 protein 2, integrase	A0A0M5M609	Bacillus_phage	2.0e-23	26.4
2092530:2092544	attR	NA	NA	NA	NA

DBSCAN-SWA_12

2094999 : 2110431

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82371.1\|2094999_2095212_+\|transposase	transposase, fragment	NA	NA	NA	NA
BBA82372.1\|2095272_2095488_+\|transposase	transposase, fragment	NA	NA	NA	NA
BBA82373.1\|2095626_2095791_+\|transposase	transposase	NA	NA	NA	NA
BBA82374.1\|2096472_2097201_-	short-chain dehydrogenase/oxidoreductase	NA	NA	NA	NA
BBA82375.1\|2097333_2097699_+	transcription regulator, MarR family	NA	NA	NA	NA
BBA82376.1\|2097982_2098267_-	hypothetical protein	NA	NA	NA	NA
BBA82377.1\|2098552_2099035_+	lysozyme/muramidase, glycoside hydrolase family 25	NA	NA	NA	NA
BBA82378.1\|2099271_2101134_+	muramidase	NA	NA	NA	NA
BBA82379.1\|2101404_2102817_-	succinate-semialdehyde dehydrogenase NADP+	NA	NA	NA	NA
BBA82380.1\|2102856_2103771_-	short-chain dehydrogenase/oxidoreductase, atypical SDR family, subgroup 1	NA	NA	NA	NA
BBA82381.1\|2103920_2104487_+	transcription regulator	NA	NA	NA	NA
BBA82382.1\|2104956_2106093_+	two-component system histidine protein kinase	NA	NA	NA	NA
BBA82383.1\|2106097_2106844_+	two-component system response regulator	NA	NA	NA	NA
BBA82384.1\|2106974_2107346_+\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-28	54.1
BBA82385.1\|2107318_2107750_+\|transposase	transposase	NA	NA	NA	NA
BBA82386.1\|2108193_2109609_+	asparagine synthase	R4TIC1	Phaeocystis_globosa_virus	4.6e-33	29.6
BBA82387.1\|2109646_2109964_+\|transposase	transposase	NA	NA	NA	NA
BBA82388.1\|2110134_2110431_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_13

2270302 : 2318303

Staphylococcus_phage(27.27%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82538.1\|2270302_2271508_+\|protease	CAAX family membrane-bound protease	NA	NA	NA	NA
BBA82539.1\|2271975_2272806_+	uncharacterized protein	NA	NA	NA	NA
BBA82540.1\|2272882_2273410_+	acetyltransferase	NA	NA	NA	NA
BBA82541.1\|2273672_2274218_+	GNAT family acetyltransferase	NA	NA	NA	NA
BBA82542.1\|2274366_2275230_+	DNA-entry nuclease	NA	NA	NA	NA
BBA82543.1\|2275769_2277473_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	4.8e-93	41.5
BBA82544.1\|2277516_2277846_+	transcription regulator, ArsR family	NA	NA	NA	NA
BBA82545.1\|2277944_2278499_+	transcription regulator	NA	NA	NA	NA
BBA82546.1\|2278523_2281844_+	membrane protein	NA	NA	NA	NA
BBA82547.1\|2281995_2282547_-	membrane protein	NA	NA	NA	NA
BBA82548.1\|2283036_2284431_-	transport protein	NA	NA	NA	NA
BBA82549.1\|2284700_2286452_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	4.5e-54	30.6
BBA82550.1\|2286451_2288239_+	ABC transporter, ATP-binding and permease protein	W8CYL7	Bacillus_phage	2.5e-44	25.0
BBA82551.1\|2288280_2288409_+	hypothetical protein	NA	NA	NA	NA
BBA82552.1\|2288876_2289905_+	oxidoreductase	NA	NA	NA	NA
BBA82553.1\|2290007_2290874_+	hypothetical protein	NA	NA	NA	NA
BBA82554.1\|2290863_2292036_+	cystathionine beta-lyase	NA	NA	NA	NA
BBA82555.1\|2292184_2292778_+	NADP oxidoreductase	NA	NA	NA	NA
BBA82556.1\|2293988_2294165_+	membrane protein	NA	NA	NA	NA
BBA82557.1\|2294548_2295232_-	hydrolase, HAD superfamily, subfamily IA	NA	NA	NA	NA
BBA82558.1\|2295328_2295898_+	maltose O-acetyltransferase	NA	NA	NA	NA
BBA82559.1\|2295969_2296413_+	nucleotide-binding protein, universal stress protein UspA family	NA	NA	NA	NA
BBA82560.1\|2296668_2296890_+	hypothetical protein	NA	NA	NA	NA
BBA82561.1\|2297095_2297992_-	transcriptional regulator	NA	NA	NA	NA
BBA82562.1\|2298112_2299042_+	transporter, major facilitator family protein	NA	NA	NA	NA
BBA82563.1\|2299028_2299292_+	macrolide-efflux protein	NA	NA	NA	NA
BBA82564.1\|2299878_2300517_+	oxidoreductase	NA	NA	NA	NA
BBA82565.1\|2300684_2301116_-\|transposase	transposase	NA	NA	NA	NA
BBA82566.1\|2301088_2301460_-\|transposase	putative transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-28	54.1
BBA82567.1\|2301464_2302787_+	transmembrane efflux protein	NA	NA	NA	NA
BBA82568.1\|2302897_2303755_+	2,5-diketo-D-gluconate reductase	A0A2H4PQR8	Staphylococcus_phage	1.4e-53	42.1
BBA82569.1\|2303772_2304624_+	oxidoreductase	A0A1V0SKP9	Klosneuvirus	1.2e-31	28.7
BBA82570.1\|2304642_2305386_+	short-chain dehydrogenase	A0A2P0VP75	Tetraselmis_virus	9.9e-11	33.5
BBA82571.1\|2305789_2306134_+	uncharacterized protein	NA	NA	NA	NA
BBA82572.1\|2306215_2306686_+	twin-arginine translocation pathway signal	NA	NA	NA	NA
BBA82573.1\|2306724_2306913_+	hypothetical protein	NA	NA	NA	NA
BBA82574.1\|2307067_2307958_-	LysR family transcriptional regulator	NA	NA	NA	NA
BBA82575.1\|2308072_2308957_+	organophosphate reductase	A0A2H4PQR8	Staphylococcus_phage	7.0e-48	39.5
BBA82576.1\|2309029_2309668_+	oxidoreductase	NA	NA	NA	NA
BBA82577.1\|2309735_2310590_+	glucose uptake protein	NA	NA	NA	NA
BBA82578.1\|2311193_2311886_+	glucose 1-dehydrogenase	A0A0M4JSW6	Mollivirus	1.2e-10	35.2
BBA82579.1\|2311960_2312650_+	probable flavodoxin	NA	NA	NA	NA
BBA82580.1\|2312743_2313322_+	ferrochelatase	NA	NA	NA	NA
BBA82581.1\|2313335_2314187_+	2,5-diketo-D-gluconic acid reductase	A0A2H4PQR8	Staphylococcus_phage	1.6e-44	37.6
BBA82582.1\|2314394_2315246_+	short-chain dehydrogenase/oxidoreductase	NA	NA	NA	NA
BBA82583.1\|2315266_2316235_+	alcohol dehydrogenase	NA	NA	NA	NA
BBA82584.1\|2316243_2316840_+	oxidoreductase	NA	NA	NA	NA
BBA82585.1\|2316888_2317776_-\|transposase	transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.3e-33	41.8
BBA82586.1\|2317772_2318303_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2448449 : 2456960

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82714.1\|2448449_2448932_+	N5-carboxyaminoimidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
BBA82715.1\|2448915_2450046_+	phosphoribosylaminoimidazole carboxylase ATPase subunit	NA	NA	NA	NA
BBA82716.1\|2450048_2450780_+	phosphoribosylaminoimidazole-succinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
BBA82717.1\|2450781_2451036_+	phosphoribosylformylglycinamidine synthase PurS component	NA	NA	NA	NA
BBA82718.1\|2451035_2451716_+	phosphoribosylformylglycinamidine synthase	NA	NA	NA	NA
BBA82719.1\|2451708_2453928_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	2.7e-144	39.1
BBA82720.1\|2453912_2455367_+	glutamine phosphoribosylpyrophosphate amidotransferase	A0A0M3SGR2	Mollivirus	1.9e-50	34.0
BBA82721.1\|2455363_2456389_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	9.3e-60	41.3
BBA82722.1\|2456381_2456960_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_15

2612640 : 2666111

Streptococcus_phage(15.38%)

transposase,portal,tail,integrase,terminase,head

attL 2653276:2653297|attR 2667116:2667137

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82863.1\|2612640_2613816_+\|transposase	transposase	NA	NA	NA	NA
BBA82864.1\|2613905_2614751_+	PTS system, N-acetylglucosamine and glucose-specific EIICBA component	NA	NA	NA	NA
BBA82865.1\|2615019_2615289_+	hypothetical protein	NA	NA	NA	NA
BBA82866.1\|2615375_2615756_-	lactoylglutathione lyase family protein	NA	NA	NA	NA
BBA82867.1\|2616793_2617381_+	acetyltransferase	NA	NA	NA	NA
BBA82868.1\|2617465_2619019_+	ABC superfamily ATP binding cassette transporter, ABC protein	Q6DMX7	Streptococcus_phage	1.2e-39	27.0
BBA82869.1\|2619279_2620470_-	diguanylate cyclase/phosphodiesterase GGDEF domain	NA	NA	NA	NA
BBA82870.1\|2620693_2620924_+	hypothetical protein	NA	NA	NA	NA
BBA82871.1\|2620949_2621171_+	hypothetical protein	NA	NA	NA	NA
BBA82872.1\|2621317_2621782_-	transcription regulator, AsnC-type	NA	NA	NA	NA
BBA82873.1\|2622003_2622897_+	cell wall-associated hydrolase	NA	NA	NA	NA
BBA82874.1\|2622963_2623827_+	cell surface hydrolase	NA	NA	NA	NA
BBA82875.1\|2624388_2624553_+	hypothetical protein	NA	NA	NA	NA
BBA82876.1\|2624611_2625355_+	phosphohydrolase, MutT/nudix family	NA	NA	NA	NA
BBA82877.1\|2625460_2626648_+	carbohydrate transporter, major facilitator superfamily	NA	NA	NA	NA
BBA82878.1\|2626861_2627179_+	hypothetical protein	NA	NA	NA	NA
BBA82879.1\|2627254_2627815_+	hypothetical membrane protein	NA	NA	NA	NA
BBA82880.1\|2628571_2629510_-	transport protein	NA	NA	NA	NA
BBA82881.1\|2629706_2629976_+	ACT domain protein	NA	NA	NA	NA
BBA82882.1\|2629985_2631329_+	UPF0210 protein	NA	NA	NA	NA
BBA82883.1\|2631701_2632430_+	two-component response regulator	W8CYM9	Bacillus_phage	2.1e-34	37.1
BBA82884.1\|2632426_2633950_+	sensor protein	NA	NA	NA	NA
BBA82885.1\|2634245_2635427_+	SAM-dependent methyltransferase	W6LLI2	Streptococcus_phage	3.9e-46	29.9
BBA82886.1\|2635661_2636519_+	putative sugar uptake protein	NA	NA	NA	NA
BBA82887.1\|2636739_2638092_+	glucose-6-phosphate isomerase	NA	NA	NA	NA
BBA82888.1\|2638517_2638709_+	hypothetical protein	NA	NA	NA	NA
BBA82889.1\|2639113_2641108_+	ABC superfamily ATP binding cassette transporter, ATP-binding and permease	G9BWD6	Planktothrix_phage	7.2e-32	41.3
BBA82890.1\|2641125_2642703_+	poly(glycerol-phosphate) alpha-glucosyltransferase	NA	NA	NA	NA
BBA82891.1\|2642674_2644438_+	efflux ABC transporter, ATP-binding and permease protein	W8CYL7	Bacillus_phage	4.8e-96	40.9
BBA82892.1\|2645074_2645206_+	hypothetical protein	NA	NA	NA	NA
BBA82893.1\|2645377_2645521_+	hypothetical protein	NA	NA	NA	NA
BBA82894.1\|2645551_2645683_+	hypothetical protein	NA	NA	NA	NA
BBA82895.1\|2645715_2645847_+	hypothetical protein	NA	NA	NA	NA
BBA82896.1\|2645879_2646011_+	hypothetical protein	NA	NA	NA	NA
BBA82897.1\|2646043_2646175_+	hypothetical protein	NA	NA	NA	NA
BBA82898.1\|2646207_2646351_+	hypothetical protein	NA	NA	NA	NA
BBA82899.1\|2646382_2646514_+	hypothetical protein	NA	NA	NA	NA
BBA82900.1\|2647115_2647541_-	uncharacterized protein	NA	NA	NA	NA
BBA82901.1\|2647641_2649789_+	mucus-binding protein, LPXTG-motif cell wall anchor	NA	NA	NA	NA
BBA82902.1\|2649888_2651865_+	hypothetical protein	NA	NA	NA	NA
BBA82903.1\|2651919_2652405_+	transcription regulator, MarR family	NA	NA	NA	NA
BBA82904.1\|2652453_2652726_-	hypothetical protein	NA	NA	NA	NA
BBA82905.1\|2652750_2652978_-	hypothetical protein	NA	NA	NA	NA
2653276:2653297	attL	NA	NA	NA	NA
BBA82906.1\|2653474_2654632_-\|integrase	prophage P2b protein 1, integrase	Q938N9	Temperate_phage	1.3e-54	34.8
BBA82907.1\|2654684_2655251_-	prophage P2b protein 2, phage cro/CI family transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	1.9e-06	47.5
BBA82908.1\|2655383_2655587_+	uncharacterized protein	NA	NA	NA	NA
BBA82909.1\|2655570_2655756_+	prophage P2b protein 4	NA	NA	NA	NA
BBA82910.1\|2656024_2656279_+	prophage P2b protein 6	NA	NA	NA	NA
BBA82911.1\|2656275_2657076_+	prophage Lp3 protein 7	NA	NA	NA	NA
BBA82912.1\|2657075_2658470_+	prophage P2b protein 8, helicase	A0A0A7RTG3	Clostridium_phage	1.9e-68	33.9
BBA82913.1\|2658628_2658820_+	prophage P2b protein 10	NA	NA	NA	NA
BBA82914.1\|2658806_2659145_+	prophage Lp3 protein 11	A0A2P0ZLF0	Lactobacillus_phage	1.2e-08	36.6
BBA82915.1\|2659137_2659527_+	prophage Lp3 protein 12	A0A1J0MFT4	Staphylococcus_phage	6.7e-19	44.7
BBA82916.1\|2660429_2660903_+\|terminase	prophage P2b protein 14, terminase small subunit	NA	NA	NA	NA
BBA82917.1\|2660899_2662603_+\|terminase	prophage P2b protein 15, terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	4.9e-122	40.5
BBA82918.1\|2662556_2662757_+	uncharacterized protein	NA	NA	NA	NA
BBA82919.1\|2662757_2663864_+\|portal	prophage P2b protein 17, portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.1e-50	33.9
BBA82920.1\|2663853_2665434_+	prophage Lp3 protein 18	B8R651	Lactobacillus_phage	1.6e-39	26.5
BBA82921.1\|2665841_2666111_+\|head,tail	prophage P2b protein 19, head-to-tail joining	NA	NA	NA	NA
2667116:2667137	attR	NA	NA	NA	NA

DBSCAN-SWA_16

2670046 : 2691061

Lactobacillus_phage(54.55%)

capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82927.1\|2670046_2670484_-	uncharacterized protein	Q4ZCB9	Staphylococcus_virus	2.3e-15	36.3
BBA82928.1\|2670688_2670865_-	prophage P1 protein 4	A0A2P0ZL93	Lactobacillus_phage	2.6e-10	51.7
BBA82929.1\|2671138_2671858_-	prophage Lp1 protein 2	NA	NA	NA	NA
BBA82930.1\|2672021_2672948_-	hypothetical protein	NA	NA	NA	NA
BBA82931.1\|2672999_2673431_-	Lorf143 protein	O03904	Lactobacillus_phage	6.6e-76	95.8
BBA82932.1\|2673439_2673838_-	Gp132 protein	O03970	Lactobacillus_phage	2.2e-41	62.9
BBA82933.1\|2674002_2674263_+	uncharacterized protein	NA	NA	NA	NA
BBA82934.1\|2674259_2674430_+	prophage Lp2 protein 11	NA	NA	NA	NA
BBA82935.1\|2674441_2674747_+	prophage P2a protein 12	NA	NA	NA	NA
BBA82936.1\|2674813_2675326_+	prophage P2a protein 13	D6PST4	Lactobacillus_phage	1.8e-27	42.9
BBA82937.1\|2675435_2675564_+	prophage P1 protein 16	NA	NA	NA	NA
BBA82938.1\|2675532_2675700_+	uncharacterized protein	NA	NA	NA	NA
BBA82939.1\|2675696_2676083_+	prophage Lp1 protein 17	NA	NA	NA	NA
BBA82940.1\|2676079_2676967_+	prophage P1 protein 18, DNA single-strand annealing protein RecT	E9LUM3	Lactobacillus_phage	3.3e-61	47.7
BBA82941.1\|2676890_2677751_+	prophage P1 protein 19	A0A0P0IZH9	Lactobacillus_phage	8.6e-75	49.8
BBA82942.1\|2677831_2678740_+	prophage Lp2 protein 20	NA	NA	NA	NA
BBA82943.1\|2678736_2679024_+	prophage Lp2 protein 21	NA	NA	NA	NA
BBA82944.1\|2679020_2679743_+	bacteriophage antirepressor	A0A141E1D3	Streptococcus_phage	2.1e-50	46.4
BBA82945.1\|2679747_2680266_+	prophage Lp2 protein 23	O03915	Lactobacillus_phage	3.7e-41	55.3
BBA82946.1\|2680262_2680640_+	prophage Lp2 protein 24	F8J189	Lactobacillus_virus	1.4e-18	43.1
BBA82947.1\|2680636_2681071_+	uncharacterized protein	A0A288TZS1	Enterococcus_phage	1.8e-28	47.1
BBA82948.1\|2681070_2681301_+	prophage P1 protein 25	O03916	Lactobacillus_phage	3.5e-23	61.8
BBA82949.1\|2681303_2681435_+	prophage P1 protein 26	O03917	Lactobacillus_phage	1.3e-14	93.0
BBA82950.1\|2681572_2681752_+	uncharacterized protein	K4HZV9	Lactobacillus_phage	1.9e-16	66.1
BBA82951.1\|2681916_2682378_+	prophage P1 protein 33, phage transcription regulator, ArpU family	D6PSV8	Lactobacillus_phage	6.3e-40	57.0
BBA82952.1\|2682467_2682638_+	hypothetical protein	NA	NA	NA	NA
BBA82953.1\|2682642_2683260_-	hypothetical protein	NA	NA	NA	NA
BBA82954.1\|2683451_2683619_+	uncharacterized protein	NA	NA	NA	NA
BBA82955.1\|2683843_2684020_+	prophage P2a protein 32	E9LUP6	Lactobacillus_phage	4.5e-07	55.1
BBA82956.1\|2683988_2684138_+	prophage P1 protein 36	NA	NA	NA	NA
BBA82957.1\|2684178_2684688_+	hypothetical protein	A0A2H4IYT3	uncultured_Caudovirales_phage	4.5e-07	36.8
BBA82958.1\|2684668_2685994_+	hypothetical protein	A0A1S5SA45	Streptococcus_phage	7.1e-137	55.0
BBA82959.1\|2686041_2687592_+	hypothetical protein	B5LPR1	Bacillus_virus	1.8e-83	38.6
BBA82960.1\|2687584_2688670_+\|capsid	putative minor capsid protein	A0A059T7W2	Listeria_phage	1.4e-37	30.7
BBA82961.1\|2688733_2689336_+	hypothetical protein	NA	NA	NA	NA
BBA82962.1\|2689349_2690297_+	hypothetical protein	A8ASJ6	Listeria_phage	6.7e-89	59.5
BBA82963.1\|2690385_2690646_+	hypothetical protein	NA	NA	NA	NA
BBA82964.1\|2690656_2691061_+	hypothetical protein	A5GYM1	Lactococcus_phage	2.0e-05	27.5

DBSCAN-SWA_17

2694190 : 2712416

Lactobacillus_phage(77.78%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA82971.1\|2694190_2699821_+	hypothetical protein	A0A1S5SFC1	Streptococcus_phage	7.2e-21	24.6
BBA82972.1\|2699821_2700640_+	hypothetical protein	NA	NA	NA	NA
BBA82973.1\|2700651_2701779_+	hypothetical protein	O03938	Lactobacillus_phage	2.6e-71	42.6
BBA82974.1\|2701771_2701993_+	hypothetical protein	NA	NA	NA	NA
BBA82975.1\|2701989_2702280_+	hypothetical protein	NA	NA	NA	NA
BBA82976.1\|2702280_2704122_+	uncharacterized protein	A0A2P0ZKZ2	Lactobacillus_phage	2.5e-140	51.2
BBA82977.1\|2704135_2704879_+	uncharacterized protein	NA	NA	NA	NA
BBA82978.1\|2704890_2705211_+	uncharacterized protein	NA	NA	NA	NA
BBA82979.1\|2705207_2705354_+	prophage P1 protein 57	NA	NA	NA	NA
BBA82980.1\|2705368_2706454_+	prophage Lp2 protein 53	A0A2P0ZLF6	Lactobacillus_phage	1.3e-32	49.0
BBA82981.1\|2706450_2706666_+	prophage P2a protein 54	A0A0A1ENR9	Lactobacillus_phage	2.0e-17	76.1
BBA82982.1\|2706679_2707858_+	prophage Lp1 protein 58, lysin	E9LUR8	Lactobacillus_phage	1.4e-197	88.3
BBA82983.1\|2707858_2708155_+	prophage P1 protein 59	A0A1I9KK55	Lactobacillus_phage	9.9e-39	76.5
BBA82984.1\|2708141_2708516_+	prophage Lp2 protein 58	A0A2K9VCG4	Lactobacillus_phage	1.0e-16	67.5
BBA82985.1\|2708839_2708998_+	cytochrome D ubiquinol oxidase	NA	NA	NA	NA
BBA82986.1\|2708994_2709843_-	prophage Lp2 protein 59; xylanase/chitin deacetylase	NA	NA	NA	NA
BBA82987.1\|2710065_2710458_+	extracellular protein	NA	NA	NA	NA
BBA82988.1\|2710685_2712416_+	ABC transporter, ATP-binding and permease protein	W8CYL7	Bacillus_phage	2.6e-46	27.6

DBSCAN-SWA_18

3001763 : 3072837

Lactobacillus_phage(81.48%)

protease,transposase,portal,tRNA,tail,integrase,terminase,head

attL 2994813:2994830|attR 3065806:3065823

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2994813:2994830	attL	NA	NA	NA	NA
BBA83258.1\|3001763_3002927_-\|integrase	prophage Lp2 protein 2, integrase	B4XYR4	Lactobacillus_phage	1.2e-55	36.5
BBA83259.1\|3003143_3003782_+	hypothetical protein	NA	NA	NA	NA
BBA83260.1\|3004493_3004682_-	putative uncharacterized protein	E9LUS5	Lactobacillus_phage	2.1e-26	100.0
BBA83261.1\|3005029_3006271_-	DNA polymerase III	A0A0A7RWA3	Clostridium_phage	9.0e-25	35.8
BBA83262.1\|3006331_3006745_-	uncharacterized protein	D6PSS8	Lactobacillus_phage	1.5e-37	53.3
BBA83263.1\|3006751_3007078_-	transcription regulator	A0A1B0Y2R0	Lactobacillus_phage	6.9e-17	44.1
BBA83264.1\|3007334_3007550_+	uncharacterized protein	NA	NA	NA	NA
BBA83265.1\|3007563_3008370_+	phage anti-repressor protein	Q9T1J2	Lactobacillus_phage	6.0e-46	58.5
BBA83266.1\|3008381_3008591_+	hypothetical protein	NA	NA	NA	NA
BBA83267.1\|3008603_3008735_+	hypothetical protein	E9LUT1	Lactobacillus_phage	7.4e-15	100.0
BBA83268.1\|3008706_3009033_-	RNA polymerase III	E9LUT2	Lactobacillus_phage	2.7e-53	98.1
BBA83269.1\|3009090_3009351_+	XRE family transcriptional regulator	NA	NA	NA	NA
BBA83270.1\|3009493_3009748_+	uncharacterized protein	NA	NA	NA	NA
BBA83271.1\|3009750_3009951_+	hypothetical protein	E9LUT7	Lactobacillus_phage	1.0e-26	89.4
BBA83272.1\|3009928_3010186_+	putative uncharacterized protein	E9LUT8	Lactobacillus_phage	2.7e-24	98.3
BBA83273.1\|3010234_3010405_+	hypothetical protein	NA	NA	NA	NA
BBA83274.1\|3010404_3010662_+	transcriptional regulator, ArsR family	NA	NA	NA	NA
BBA83275.1\|3010764_3011508_+	phage replication initiation protein	E9LUM6	Lactobacillus_phage	2.7e-40	57.3
BBA83276.1\|3011507_3012293_+	DNA replication protein	E9LUN6	Lactobacillus_phage	4.1e-132	91.2
BBA83277.1\|3012289_3012451_+	uncharacterized protein	NA	NA	NA	NA
BBA83278.1\|3012428_3012731_+	uncharacterized protein	E9LUN7	Lactobacillus_phage	1.0e-46	93.0
BBA83279.1\|3012733_3013045_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	4.6e-47	89.3
BBA83280.1\|3013155_3013761_+	hypothetical protein	E9LUN9	Lactobacillus_phage	2.0e-115	98.5
BBA83281.1\|3013825_3013999_+	endoplasmic reticulum-based factor for assembly of V-ATPase	NA	NA	NA	NA
BBA83282.1\|3014079_3014508_+	uncharacterized protein	A0A1S5RCV6	Lactobacillus_phage	1.3e-12	35.9
BBA83283.1\|3014504_3014789_+	prophage P1 protein 27	A0A291I9N7	Lactobacillus_phage	2.8e-22	64.9
BBA83284.1\|3015223_3015649_+	RinA family phage transcriptional regulator	E9LUP5	Lactobacillus_phage	7.2e-67	87.2
BBA83285.1\|3016700_3017624_+	hypothetical protein	NA	NA	NA	NA
BBA83286.1\|3017706_3017886_+	putative prophage protein	E9LUP6	Lactobacillus_phage	3.6e-12	66.1
BBA83287.1\|3017854_3018367_+	restriction endonuclease	E9LUP7	Lactobacillus_phage	2.4e-80	91.7
BBA83288.1\|3018586_3019048_+\|terminase	phage terminase, small subunit, P27 family	A0A286QRF4	Streptococcus_phage	3.2e-44	57.5
BBA83289.1\|3019034_3020942_+\|terminase	phage terminase, small subunit	E9LUP9	Lactobacillus_phage	2.0e-180	49.8
BBA83290.1\|3020931_3021126_+	prophage protein	E9LUQ0	Lactobacillus_phage	3.8e-23	89.1
BBA83291.1\|3021128_3021410_+\|portal	prophage protein, portal protein	E9LUQ1	Lactobacillus_phage	7.7e-41	87.1
BBA83292.1\|3021456_3022278_+\|portal	prophage protein, portal protein	E9LUQ1	Lactobacillus_phage	2.0e-134	89.7
BBA83293.1\|3022255_3023014_+\|protease	protease subunit of ATP-dependent Clp protease	E9LUQ2	Lactobacillus_phage	5.5e-126	94.0
BBA83294.1\|3023013_3024246_+\|head	prophage protein, major head protein	E9LUQ3	Lactobacillus_phage	1.9e-200	88.0
BBA83295.1\|3024318_3024657_+	phage protein DNA packaging protein	E9LUQ4	Lactobacillus_phage	5.8e-51	91.1
BBA83296.1\|3024640_3025003_+\|head,tail	phage head-tail adaptor	E9LUQ5	Lactobacillus_phage	5.8e-65	98.3
BBA83297.1\|3024992_3025433_+\|head,tail	phage head-tail joining protein	E9LUQ6	Lactobacillus_phage	2.2e-79	100.0
BBA83298.1\|3025429_3025813_+	hypothetical protein	E9LUQ7	Lactobacillus_phage	7.2e-66	98.4
BBA83299.1\|3025813_3026452_+\|tail	major tail protein	E9LUQ8	Lactobacillus_phage	8.8e-117	100.0
BBA83300.1\|3026653_3027037_+	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
BBA83301.1\|3027033_3027225_+	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
BBA83302.1\|3027237_3028278_+\|tail	putative minor tail protein	E9LUR1	Lactobacillus_phage	5.8e-150	68.1
BBA83303.1\|3028365_3029295_+\|transposase	transposase, IS30 family	H7BW61	unidentified_phage	6.5e-20	29.9
BBA83304.1\|3029412_3033219_+\|tail	putative minor tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	87.3
BBA83305.1\|3033291_3034164_+	minor structural protein gp75-like protein	E9LUR2	Lactobacillus_phage	2.3e-152	97.8
BBA83306.1\|3034225_3035065_+	minor structural protein gp75-like protein	E9LUR2	Lactobacillus_phage	2.2e-160	98.9
BBA83307.1\|3035128_3037480_+	hypothetical protein	E9LUR3	Lactobacillus_phage	0.0e+00	94.8
BBA83308.1\|3037496_3040262_+	uncharacterized protein	A0A2P0ZL34	Lactobacillus_phage	1.2e-194	50.2
BBA83309.1\|3040254_3040509_+	hypothetical protein	E9LUR5	Lactobacillus_phage	1.4e-30	100.0
BBA83310.1\|3040512_3040674_+	hypothetical protein	E9LUR6	Lactobacillus_phage	1.2e-19	100.0
BBA83311.1\|3040657_3041419_+	uncharacterized protein	A0A1S5RCQ5	Lactobacillus_phage	1.9e-97	72.0
BBA83312.1\|3041435_3042608_+	prophage Lp1 protein 58, lysin	E9LUR8	Lactobacillus_phage	3.9e-211	98.2
BBA83313.1\|3042607_3042871_+	hypothetical protein	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
BBA83314.1\|3042883_3043414_+	putative uncharacterized protein	E9LUS0	Lactobacillus_phage	2.9e-41	100.0
BBA83315.1\|3043982_3044981_-\|integrase	integrase catalytic subunit	W5R8L2	Staphylococcus_phage	6.9e-52	37.5
BBA83316.1\|3045776_3046988_+	rod-shape determining protein	NA	NA	NA	NA
BBA83317.1\|3047466_3048945_+	nitrate/sulfonate/bicarbonate ABC transporter, permease protein	NA	NA	NA	NA
BBA83318.1\|3048833_3049208_+	nitrate ABC transporter, permease protein	NA	NA	NA	NA
BBA83319.1\|3049226_3050018_+	nitrate/sulfonate/bicarbonate ABC transporter, ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
BBA83320.1\|3050022_3051183_+	transcriptional attenuator, cell envelope-related, LytR family	NA	NA	NA	NA
BBA83321.1\|3051334_3051907_+\|transposase	transposase	NA	NA	NA	NA
BBA83322.1\|3052658_3053600_-	glycosyltransferase	V9QJB1	Oenococcus_phage	5.3e-78	49.0
BBA83323.1\|3054045_3054438_-	hypothetical protein	NA	NA	NA	NA
BBA83324.1\|3054601_3054994_+	hypothetical protein	NA	NA	NA	NA
BBA83325.1\|3055029_3056199_+	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
BBA83326.1\|3056248_3056878_-	hypothetical protein	NA	NA	NA	NA
BBA83327.1\|3057501_3058134_-	LexA repressor	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
BBA83328.1\|3058143_3058317_-	hypothetical protein	NA	NA	NA	NA
BBA83329.1\|3058285_3058525_+	UPF0291 protein	NA	NA	NA	NA
BBA83330.1\|3058628_3058859_+	UPF0154 protein	NA	NA	NA	NA
BBA83331.1\|3058915_3059551_-	1-acylglycerol-3-phosphate O-acyltransferase	NA	NA	NA	NA
BBA83332.1\|3059662_3060421_+	methyltransferase	NA	NA	NA	NA
BBA83333.1\|3060404_3060710_+	endonuclease, GIY-YIG nuclease superfamily	NA	NA	NA	NA
BBA83334.1\|3060794_3061793_+	D-lactate dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
BBA83335.1\|3061779_3063297_-\|transposase	transposase	A0ZS58	Staphylococcus_virus	3.5e-87	43.2
BBA83336.1\|3063853_3064576_-	hydrolase, HAD superfamily	NA	NA	NA	NA
BBA83337.1\|3064800_3065604_+	30S ribosomal protein S2	NA	NA	NA	NA
BBA83338.1\|3065706_3066585_+	elongation factor Ts	NA	NA	NA	NA
3065806:3065823	attR	NA	NA	NA	NA
BBA83339.1\|3066785_3067508_+	uridylate kinase	NA	NA	NA	NA
BBA83340.1\|3067509_3068073_+	ribosome recycling factor	NA	NA	NA	NA
BBA83341.1\|3068192_3068972_+	ditrans, polycis-undecaprenyl-diphosphate synthase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
BBA83342.1\|3068987_3069773_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
BBA83343.1\|3069810_3071088_+\|protease	zinc-dependent protease, membrane associated	NA	NA	NA	NA
BBA83344.1\|3071127_3072837_+\|tRNA	prolyl-tRNA synthetase	NA	NA	NA	NA

DBSCAN-SWA_19

3160788 : 3214271

Staphylococcus_virus(10.0%)

integrase,transposase,lysis

attL 3197981:3197994|attR 3215772:3215785

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
BBA83430.1\|3160788_3162333_+\|transposase	transposase	A0ZS58	Staphylococcus_virus	3.5e-87	43.2
BBA83431.1\|3162434_3162854_+	cellobiose-specific PTS system IIC component	NA	NA	NA	NA
BBA83432.1\|3162899_3163202_+	alpha/beta hydrolase superfamily protein, DUF915 family	NA	NA	NA	NA
BBA83433.1\|3163225_3164113_-\|transposase	transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.3e-33	41.8
BBA83434.1\|3164109_3164640_-\|transposase	transposase	NA	NA	NA	NA
BBA83435.1\|3164957_3165209_+	alpha/beta hydrolase superfamily protein, DUF915 family	NA	NA	NA	NA
BBA83436.1\|3165349_3166381_-\|transposase	putative transposase	H7BUM7	unidentified_phage	3.6e-43	34.7
BBA83437.1\|3166741_3166903_+	hypothetical protein	NA	NA	NA	NA
BBA83438.1\|3167575_3168109_-	transcriptional regulator, AcrR family	NA	NA	NA	NA
BBA83439.1\|3168283_3169558_-	putative ATP synthase F0, A subunit	NA	NA	NA	NA
BBA83440.1\|3169716_3170268_+	TetR family transcriptional regulator	NA	NA	NA	NA
BBA83441.1\|3170770_3172450_+	hypothetical protein	NA	NA	NA	NA
BBA83442.1\|3172885_3173218_+	oxidoreductase, atypical SDR family, subgroup 6	NA	NA	NA	NA
BBA83443.1\|3173269_3173518_+	oxidoreductase, atypical SDR family, subgroup 6	NA	NA	NA	NA
BBA83444.1\|3173747_3174137_+	hypothetical protein	NA	NA	NA	NA
BBA83445.1\|3174302_3174704_+\|lysis	negative regulator of proteolysis	NA	NA	NA	NA
BBA83446.1\|3174903_3175509_-	phosphohydrolase, MutT/nudix family	NA	NA	NA	NA
BBA83447.1\|3175524_3176277_-	DeoR family transcriptional regulator	NA	NA	NA	NA
BBA83448.1\|3176469_3177150_+	NADH oxidase	NA	NA	NA	NA
BBA83449.1\|3177168_3178161_+	NADH oxidase	NA	NA	NA	NA
BBA83450.1\|3178281_3179427_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
BBA83451.1\|3179496_3179946_-	transcription regulator, MarR family	NA	NA	NA	NA
BBA83452.1\|3180111_3181506_+	transport protein	NA	NA	NA	NA
BBA83453.1\|3181679_3182969_+	enolase	A0A1X9I5Z8	Streptococcus_phage	2.0e-104	50.7
BBA83454.1\|3183036_3185313_+	cadmium-/manganese-transporting P-type ATPase	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.6e-32	24.5
BBA83455.1\|3185423_3186398_+	oxidoreductase	NA	NA	NA	NA
BBA83456.1\|3186406_3186580_+	uncharacterized protein	NA	NA	NA	NA
BBA83457.1\|3186728_3187835_+	membrane protein	NA	NA	NA	NA
BBA83458.1\|3188160_3189306_-	lipoprotein	NA	NA	NA	NA
BBA83459.1\|3189648_3190182_+	transcription regulator	NA	NA	NA	NA
BBA83460.1\|3190174_3190543_+	hypothetical protein	NA	NA	NA	NA
BBA83461.1\|3190972_3193369_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	9.3e-119	31.6
BBA83462.1\|3193523_3194030_-	transcription regulator, MarR family	NA	NA	NA	NA
BBA83463.1\|3194204_3195146_+	ABC transporter, ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.6e-26	33.9
BBA83464.1\|3195160_3195931_+	ABC transporter, permease protein, daunorubicin resistance family B	NA	NA	NA	NA
BBA83465.1\|3196036_3196828_-	integral membrane protein	NA	NA	NA	NA
BBA83466.1\|3197018_3197300_-	hypothetical protein	NA	NA	NA	NA
BBA83467.1\|3197795_3198503_+	S-adenosyl-L-methionine-dependent methyltransferase	NA	NA	NA	NA
3197981:3197994	attL	NA	NA	NA	NA
BBA83468.1\|3198489_3199512_+	hypothetical protein	NA	NA	NA	NA
BBA83469.1\|3199550_3200789_+	peptidase T	NA	NA	NA	NA
BBA83470.1\|3200905_3203509_+	chaperone ClpB	A0A2I7SAX5	Vibrio_phage	1.9e-125	34.0
BBA83471.1\|3204165_3204366_-	integral membrane protein	NA	NA	NA	NA
BBA83472.1\|3204726_3208077_+	DNA-directed DNA polymerase III alpha chain	A0A291AVG1	Streptomyces_phage	1.4e-149	32.8
BBA83473.1\|3208190_3209153_+	6-phosphofructokinase	NA	NA	NA	NA
BBA83474.1\|3209238_3210999_+	pyruvate kinase	NA	NA	NA	NA
BBA83475.1\|3211971_3212430_+	UPF0756 membrane protein	NA	NA	NA	NA
BBA83476.1\|3212485_3213373_+	RNA-binding protein	NA	NA	NA	NA
BBA83477.1\|3213347_3214271_+\|integrase	integrase/recombinase	A0A0K2CP59	Brevibacillus_phage	4.8e-39	33.3
3215772:3215785	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. AP018409

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. AP018408

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. AP018405

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection