CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP022483	Ralstonia solanacearum strain HA4-1 plasmid pHA4-1, complete sequence	0 crisprs	NA	1
CP022481	Ralstonia solanacearum strain HA4-1 chromosome, complete genome	1 crisprs	WYL,csa3,DEDDh,DinG,cas3	10
CP022482	Ralstonia solanacearum strain HA4-1 plasmid HA4-1MP, complete sequence	0 crisprs	csa3,WYL	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

55358 : 115849

Acidithiobacillus_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU59721.1\|55358_56882_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.5e-149	53.4
AZU59722.1\|56924_57983_+	amino acid-binding protein	NA	NA	NA	NA
AZU59723.1\|57996_59370_+	hypothetical protein	NA	NA	NA	NA
AZU59724.1\|59444_60005_+	hypothetical protein	NA	NA	NA	NA
AZU59804.1\|60236_63122_+	type VI secretion protein	A0A2H4JCD4	uncultured_Caudovirales_phage	5.3e-36	24.9
AZU59725.1\|63149_63986_+	hypothetical protein	NA	NA	NA	NA
AZU59726.1\|64009_64570_+	DUF3304 domain-containing protein	NA	NA	NA	NA
AZU59727.1\|64562_66788_+	hypothetical protein	NA	NA	NA	NA
AZU59728.1\|66950_67334_+	hypothetical protein	NA	NA	NA	NA
AZU59729.1\|67943_70772_+	hypothetical protein	NA	NA	NA	NA
AZU59730.1\|71073_72993_-	Fis family transcriptional regulator	NA	NA	NA	NA
AZU59731.1\|72989_75344_-	ATP-dependent endonuclease	NA	NA	NA	NA
AZU59732.1\|75715_76372_-	hypothetical protein	NA	NA	NA	NA
AZU59805.1\|76368_76986_-	hypothetical protein	NA	NA	NA	NA
AZU59733.1\|77081_80204_-	relaxase	NA	NA	NA	NA
AZU59734.1\|80217_80880_-	hypothetical protein	NA	NA	NA	NA
AZU59735.1\|80910_81270_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AZU59736.1\|81612_82140_+	hypothetical protein	NA	NA	NA	NA
AZU59806.1\|82447_82723_-	hypothetical protein	NA	NA	NA	NA
AZU59737.1\|83642_85532_-	chromosome partitioning protein ParB	G8DH78	Emiliania_huxleyi_virus	5.6e-26	27.3
AZU59738.1\|86415_87186_-	restriction endonuclease subunit M	H7BVT3	unidentified_phage	1.1e-15	34.7
AZU59739.1\|87820_88327_-	hypothetical protein	NA	NA	NA	NA
AZU59740.1\|88323_89076_-	hypothetical protein	NA	NA	NA	NA
AZU59741.1\|89072_89552_-	hypothetical protein	NA	NA	NA	NA
AZU59742.1\|89964_91518_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.8e-162	55.9
AZU59743.1\|91526_92285_+	AAA family ATPase	K4HZD4	Acidithiobacillus_phage	2.6e-83	60.7
AZU59744.1\|93290_94148_+	hypothetical protein	NA	NA	NA	NA
AZU59745.1\|94336_95935_-	hypothetical protein	NA	NA	NA	NA
AZU59746.1\|96234_97788_-	Mobile element protein	S5VTD3	Leptospira_phage	2.2e-73	35.8
AZU59747.1\|97820_98231_-\|transposase	transposase	NA	NA	NA	NA
AZU59748.1\|98170_98647_-\|transposase	transposase	NA	NA	NA	NA
AZU59749.1\|99098_99434_+	hypothetical protein	NA	NA	NA	NA
AZU59750.1\|99501_99819_-	hypothetical protein	NA	NA	NA	NA
AZU59751.1\|99840_100035_-	YqaE/Pmp3 family membrane protein	NA	NA	NA	NA
AZU59752.1\|100114_100372_-	hypothetical protein	NA	NA	NA	NA
AZU59753.1\|100391_100691_-	hypothetical protein	NA	NA	NA	NA
AZU59754.1\|100701_101166_-	hypothetical protein	NA	NA	NA	NA
AZU59755.1\|101296_101581_-	hypothetical protein	NA	NA	NA	NA
AZU59756.1\|101655_101922_-	hypothetical protein	NA	NA	NA	NA
AZU59757.1\|102361_102748_-	hypothetical protein	NA	NA	NA	NA
AZU59758.1\|103233_103632_-	hypothetical protein	NA	NA	NA	NA
AZU59759.1\|104145_104331_-	hypothetical protein	NA	NA	NA	NA
AZU59760.1\|104343_105048_-	hypothetical protein	Q9ZXI7	Pseudomonas_virus	2.1e-23	55.8
AZU59761.1\|105703_105934_-	hypothetical protein	NA	NA	NA	NA
AZU59762.1\|105978_106278_-	hypothetical protein	NA	NA	NA	NA
AZU59763.1\|106426_106855_-	hypothetical protein	NA	NA	NA	NA
AZU59764.1\|107024_107315_-	hypothetical protein	NA	NA	NA	NA
AZU59765.1\|107563_107785_-	hypothetical protein	NA	NA	NA	NA
AZU59766.1\|107804_108416_-	hypothetical protein	Q9ZXI7	Pseudomonas_virus	6.4e-16	48.4
AZU59807.1\|108498_108780_-	hypothetical protein	NA	NA	NA	NA
AZU59767.1\|108850_109138_-	hypothetical protein	NA	NA	NA	NA
AZU59768.1\|109738_110140_+	hypothetical protein	NA	NA	NA	NA
AZU59769.1\|110248_110599_-	hypothetical protein	NA	NA	NA	NA
AZU59770.1\|110622_110844_-	hypothetical protein	NA	NA	NA	NA
AZU59771.1\|110910_111114_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZU59772.1\|112338_112578_+	hypothetical protein	NA	NA	NA	NA
AZU59808.1\|112589_113177_+	hypothetical protein	NA	NA	NA	NA
AZU59773.1\|115022_115499_+\|transposase	transposase	NA	NA	NA	NA
AZU59774.1\|115438_115849_+\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP022481

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022481_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022481_1

2392218-2392302

Orphan

Consensus_repeat	Method
TACCTGAAAAGCCTCGTGCAACT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022481_1

>merge|CP022481|1|2392218-2392302|CRISPRCasFinder
TACCTGAAAAGCCTCGTGCAACTTAGCCAGATCGTGGATGACTTTCTCGGCGGAGACCGAGCTACCTGAAAAGCTTCGTGCAACT

>CP022481|1|1|2392218-2392302|CRISPRCasFinder
TACCTGAAAAGCCTCGTGCAACT	TAGCCAGATCGTGGATGACTTTCTCGGCGGAGACCGAGC
TACCTGAAAAGCTTCGTGCAACT

Protein	Signature genes	Signature genes Name	Protein_function
CP022481.1\|AZU58077.1\|2392474_2392840_+\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56694.1\|2393179_2394415_-\|DNA-methylase-N-4	unknown	unknown	gnl\|CDD\|223931
CP022481.1\|AZU56698.1\|2399329_2399719_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56688.1\|2389209_2389431_+\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56697.1\|2396609_2396819_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56696.1\|2396212_2396620_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56695.1\|2394411_2395815_-\|DNA-modification-methylase	unknown	unknown	gnl\|CDD\|319260
CP022481.1\|AZU56693.1\|2392977_2393220_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377452
CP022481.1\|AZU56701.1\|2400851_2401724_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379213
CP022481.1\|AZU56691.1\|2391376_2391745_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56690.1\|2390165_2390669_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371839
CP022481.1\|AZU56699.1\|2399724_2400129_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU58075.1\|2386605_2388585_-\|terminase	unknown	unknown	gnl\|CDD\|368649
CP022481.1\|AZU56689.1\|2389566_2390046_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371839
CP022481.1\|AZU56684.1\|2385428_2385650_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56687.1\|2388587_2389124_-\|elements-of-external-origin	unknown	unknown	unknown
CP022481.1\|AZU56700.1\|2400201_2400834_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56685.1\|2385650_2386043_-\|hypothetical-protein	unknown	unknown	unknown
CP022481.1\|AZU56686.1\|2386053_2386563_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227798
CP022481.1\|AZU58076.1\|2390796_2391147_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP022481.1\|AZU56690.1\|2390165_2390669_+\|hypothetical-protein	gnl\|CDD\|371839	pfam11994, DUF3489, Protein of unknown function (DUF3489). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 84 to 211 amino acids in length. This protein has a single completely conserved residue W that may be functionally important.	8.52738e-16
CP022481.1\|AZU56694.1\|2393179_2394415_-\|DNA-methylase-N-4	gnl\|CDD\|223931	COG0863, COG0863, DNA modification methylase [DNA replication, recombination, and repair].	5.91424e-50
CP022481.1\|AZU58075.1\|2386605_2388585_-\|terminase	gnl\|CDD\|368649	pfam05876, Terminase_GpA, Phage terminase large subunit (GpA). This family consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities.	0
CP022481.1\|AZU56689.1\|2389566_2390046_+\|hypothetical-protein	gnl\|CDD\|371839	pfam11994, DUF3489, Protein of unknown function (DUF3489). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 84 to 211 amino acids in length. This protein has a single completely conserved residue W that may be functionally important.	4.81965e-32
CP022481.1\|AZU56701.1\|2400851_2401724_-\|hypothetical-protein	gnl\|CDD\|379213	pfam13479, AAA_24, AAA domain. This AAA domain is found in a wide variety of presumed phage proteins.	3.41067e-48
CP022481.1\|AZU56693.1\|2392977_2393220_+\|hypothetical-protein	gnl\|CDD\|377452	pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyze the reversible oxidative deamination of glutamate to ketoglutarate and ammonia.	0.00648912
CP022481.1\|AZU56686.1\|2386053_2386563_-\|hypothetical-protein	gnl\|CDD\|227798	COG5511, COG5511, Bacteriophage capsid protein [General function prediction only].	1.25771e-33
CP022481.1\|AZU56695.1\|2394411_2395815_-\|DNA-modification-methylase	gnl\|CDD\|319260	cd16403, ParB_N_like_MT, ParB N-terminal-like domain, some attached to C-terminal S-adenosylmethionine-dependent methyltransferase. This family represents domains related to the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system, fused to a variety of C-terminal domains, including S-adenosylmethionine-dependent methyltransferase-like domains. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	3.98936e-48

>CP022481.1|AZU56691.1|2391376_2391745_-|hypothetical-protein
MQSTYQVINTTNREAGFYGALRYSAAAAWPLAMVAISKATGAAPRVVRFFLDSAYGEQFGEEVLNAIALGVEGAINCVIEEWMSRVVDEQTAKARGIRPGPSYLVSLLIASAIEVRMLGDLA
>CP022481.1|AZU58076.1|2390796_2391147_+|hypothetical-protein
MSNTIKRHPCTVVIGDTIIQTEKLAKRLPFARKPADLSQVRGKEYVEVYVTEIKELTTAEFDDFASGLLVSRDWLRGKGGGRLGSYFCIEVTAPGRPTLYVNPEGSDYARYVARED
>CP022481.1|AZU56690.1|2390165_2390669_+|hypothetical-protein
MTTKPLTPAQRAILTRAIKDSNGRLDWFPETVKGGARLFALNGLANRTLIAKSGTDWLVTPQGYRVIELLELDTSQSAAPSSEAEPFRMIARKPQGMHENSKLAYMVELLRRPGGATVQQMCEATGWQPNTINATLHGPLKKRGFKITSVRSYFIEFECTEQADQST
>CP022481.1|AZU56689.1|2389566_2390046_+|hypothetical-protein
MTTQQLTPAQHAILAYAIHHTGGKIEWFPDNIKGGARTKVLAGLAKRALIAAAGANWLVASGGYGALGLEAPQKDVQKAPRTRENSKQAQVIAMLRHPEGATINEICKATGWQAHTVRGAFAGTFKKRLGLTITSYKPVNGERVYRIEAEDGAQADQSA
>CP022481.1|AZU56688.1|2389209_2389431_+|hypothetical-protein
MIGTLTREEATYELREIQQQMLNLIDDARSVLSAGDIGGHRGWMDQISAALFGDYGSGSKCSLQKLIDEIENG
>CP022481.1|AZU56687.1|2388587_2389124_-|elements-of-external-origin
MGISIRAYARHRGVSDAAVRKAIAAGRITPDADGTIDTDRADAEWARNTEAPRNGTRTPPVRAAVTPEGGQPPDGPASSPTGGTSLLQARTVNEVVKAQTNKVRLARLKGELVDRSQAIAHVFKLARAERDAWLNWPARVSSQMAATLGVEPHTMHVALEAAVREHLQELGELRPRVD
>CP022481.1|AZU58075.1|2386605_2388585_-|terminase
MDADYEGAAELERAWREGLTPDPLLTVSEWSDRHRMLSSKASAEPGRWRTSRTPYLRAIMDCLSPTSPIERVVFMKAAQLGATEMGSNWIGYVIHHAPGPMMAVWPTVEMAKRNSKQRIDPLIEESAVLAERIAPARSRDSGNTILAKEFRGGVLVMTGANSAVGLRSMPVRYLFLDEVDGYPLDVEGEGDAISLAEARTRTFARRKIFIVSTPTIAGASSIEREYDASDQRRYFVPCPHCDHRQWLRFEQLRWTKGEPETAVYVCEACDEPIHEHHKAWMLAQGEWRAMAETSGRTAGFHLSSLYSPVGWRSWREIAAAWESAVSKESGSAAAIKTFRNTELGETWVEEGEAPDWQRLLERREDYPIGTVPAGGLLLSAGADVQKDRIEVSIWAFGRGKEAWLVEHRVLMGDTARDAVWKRLAELVEAQWTHASGASMPLARLALDTGFATQEAYAFVRACGDARVMAVKGTARGAALIGTPTAVDVTRNGKKLRRGIKVFTVTVSIAKLEFYNNLRKAADVAEDNSSIAFPTGFVHLPKIDAEFLQQLCAEQLITRRDRNGFPIREWQKMRERNEALDCYVYARAAASAAGLDRFEERHWRELERQLGLAPPPDTPAPIELSSPTDATPRGGIAVSGTRPGARQAGRRVIKSRWLSS
>CP022481.1|AZU56686.1|2386053_2386563_-|hypothetical-protein
MSLQTRIESLVLRLASEFKTIHEQVGTLARLSTTDKTSLVSAINELRAQFDKIASAALIDDANAAGTTTTFSASKITGLLDALKADLLGGADAAFDTLKELQEAILKDQSGIAALLAAVDRRVRFDAAQALTADEQAQARQNIGTVAASAIGDPETDFVPVFEAALTGA
>CP022481.1|AZU56685.1|2385650_2386043_-|hypothetical-protein
MSLTGNIAELAAAIAQEVRARITADHPGLARAWVCFGTEGNQAVIRSAFNVQSVVRFATGRYRVVFAEPMPDDTYCWVAFARNAGRQSAMKAAAARVRAEAKTEAFVEVICTTAAGTLSDTSELNLMVYR
>CP022481.1|AZU56684.1|2385428_2385650_-|hypothetical-protein
MAYTEAQLLALEAALARGERRVTFQDKTVEYRTVDELKLAIREVRRGLFEQAAETGLWPGAPRQIRVTTGKGF
>CP022481.1|AZU58077.1|2392474_2392840_+|hypothetical-protein
MNTTNAMPATRNEGWGFYGTMKERAAEAWPLAMTAVSKATASSLEAVRLFLDSSFGRHFADDVCNALHRGQALADAIDFTAALWMQRKSNGRLSEIYGIPLGLPHLTAFVTACEIADELLA
>CP022481.1|AZU56693.1|2392977_2393220_+|hypothetical-protein
MRNPNLPHTHASEREQAVRWLIQNRRPDLSIEQAIRVLSMVLPRDRQSLLLLRRIAEEAAEAAVKTPLNWRTPLGLPPRG
>CP022481.1|AZU56694.1|2393179_2394415_-|DNA-methylase-N-4
MTASWLAGKIEHWPIQRLAPYAANARTHSDEQIAQIAASIVEFGFTNPILAGGDGVIVAGHGRLAAAMKLGLQVVPVVVLDHLSPTQRRALVIADNRIAGNAGWDEAVLRAELAALDAANFDLSLTGFDADALADLMDGEEGDGQAEESALPEVPEDPISRPGDVWVLGRHRLLCGDATVAENYDRLLQGEPADMVFTDPPYNVNYANTAKDRQRGTSRAILNDNLGGGFYDFLLAALAPTISNCRGAIYVAMSSSELDVLQAAFREAGGRWSTFIIWAKDRFTLGRSDYQRQYEPILYGWAEGAQRHWCGDRDQGDVWQIKKPARNDLHPTMKPVELVERAIRNSSRPGDVVLDAFGGSGTTLIAAEKAARVARLIELDPKYADVIVRRWEEYTGEQAIREAADRVVCAN
>CP022481.1|AZU56695.1|2394411_2395815_-|DNA-modification-methylase
MLNVEYRKVAALIPYARNPRTHSDEQVARIAASIVEYGWTNPVLVDGESGVIAGHGRLAAARRLGMDEVPVIELAHLSSTQKRALILADNRIALDAGWDDELLALEFAELADAGYDLALTGFNDAEIDALLADQLDDAEGDSEANGEEPDAADDLPDAAAVPVSRPGDVWLLGEHRLICGDAADSDVIAALMAGQQAALCLTSPPYANQRNYTTGGIADWDVLMRGVFGNLPMAGDGQVLVNLGLVHRDSEVVPYWDAWIAWMRTQGWRRFGWYVWDQGPGMPGDWMGRLGPSFEFIFHFNREARRPNKTVPCKFAGRDEHLRPDGTSTSMRSRDGVRGSWTHEGKVTQDTRIPDSVIRVMRHKGKIGRDIDHPAVFPVALPEFVIEAYSDAGDIVFEPFGGSGTTMLAAQRTQRQCRSVEIAPEYVDVAIKRFQQNYPEVLVTLQSTGQPFAAVAAERLAGEEVAK
>CP022481.1|AZU56696.1|2396212_2396620_-|hypothetical-protein
MTGSSEAWTPDSVAARFEEAARTGRTLPPVRVQGYFRVWPHIVREQWERLAADDQPRHYYPPSPAAIDRMLETMRWVQWLDVDHRHLVWMRAQGDEWRYIAKRYACCVKTAQRRWQRAMQTVVDRLNGGAHVDRE
>CP022481.1|AZU56697.1|2396609_2396819_-|hypothetical-protein
MKIPTPSYRSALARTQPEVTDLETFKRQGWRDQRILVVNEADERLDFIEREFIRRIGERLYGGGQRHDR
>CP022481.1|AZU56698.1|2399329_2399719_-|hypothetical-protein
MLNFNHRPKTRSTIDPRRTKRAARPRPLVTMRAVEKLLLRHVHAPATGLMPEQRLIVAVLCQAIADARYGESQSVQDDAERFLRSNDLAQVAGLIDLTSAFVREVAVKTGYLLAAPDELEERSADARLQ
>CP022481.1|AZU56699.1|2399724_2400129_-|hypothetical-protein
MGDPRRHPPDWAFCSRRCQDAFHAMYGAWCETEPPLSESLTREAHMPETTAQQRAAMRRCLRPFGQVAGEIGFDKPLAHYTEEEALRVIEAIVFAYTEAMALDAPRAQATSVGQKRSVGLSADAFADLEDDIPW
>CP022481.1|AZU56700.1|2400201_2400834_-|hypothetical-protein
MTFWNDFNDAGRQVGFDLIPKGTLLKIRMTIRQGGFDDPSRGWTGGWATESEHTGSVYLAAEFVVLEGPYAKRKLWSMIGLHSPKGDEWANMGRAFVRAALNSARGVHPDDNTEPAQLSRRIRDFGELHGMEFIGRVDTELDSRGDARNVIRQAVEPNHKDYAALMAGNAPPANAANAGVGRAHAPAASAPARAAQPRQAVGFTRPAWAQ
>CP022481.1|AZU56701.1|2400851_2401724_-|hypothetical-protein
MTLPIISAEQRLAEPRCAKIVLVGIPGAGKTSQLKTLPEDSTLFVDLEAGDLAVLDWYGDTLRPRSWPEFRDLVVFLAGPNPAASPDQPYSQAHFDAVCKRYGDPKQLDKYSTYFVDSITVLSRLCLAWARTQPQAFSERTGKPDTRGAYGLLGTEMIAALTHLQHVRDKHVVFVAILEEKVDEYNRRYFAIQLEGSKTALELPGVIDEVITLALLRPDAPVDGEAAAAPAEPFRAFVTHTDNVWGYPAKDRSGRLDALEEPHLGKLIAKTAAPRKPVPLAGATTQPNFS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

383026 : 447777

Lake_Baikal_phage(25.0%)

protease,coat,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU55072.1\|383026_384013_-\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AZU55073.1\|384088_391309_+	hemolysin-type protein	NA	NA	NA	NA
AZU55074.1\|391958_392276_-	hypothetical protein	NA	NA	NA	NA
AZU55075.1\|392757_392970_-	hypothetical protein	NA	NA	NA	NA
AZU57956.1\|393068_393323_-	translation initiation factor 1	NA	NA	NA	NA
AZU55076.1\|393405_393636_-	isochorismatase	NA	NA	NA	NA
AZU55077.1\|394091_394256_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	3.2e-07	57.1
AZU55078.1\|394302_395631_-\|transposase	DDE transposase	NA	NA	NA	NA
AZU55079.1\|396143_396470_+	hypothetical protein	NA	NA	NA	NA
AZU57957.1\|396563_396848_+	hypothetical protein	NA	NA	NA	NA
AZU57958.1\|396934_397309_+	hypothetical protein	NA	NA	NA	NA
AZU55080.1\|398187_398505_+	hypothetical protein	NA	NA	NA	NA
AZU55081.1\|398655_398952_+	hypothetical protein	NA	NA	NA	NA
AZU55082.1\|399048_399909_+	transglutaminase family protein	NA	NA	NA	NA
AZU57959.1\|399925_400186_-	hypothetical protein	NA	NA	NA	NA
AZU55083.1\|401532_402036_+\|coat	spore coat protein	NA	NA	NA	NA
AZU55084.1\|402094_402598_+\|coat	spore coat protein	NA	NA	NA	NA
AZU55085.1\|402716_403436_+	phytochrome sensor protein	NA	NA	NA	NA
AZU55086.1\|403485_405750_+	usher protein	NA	NA	NA	NA
AZU55087.1\|405746_406256_+	hypothetical protein	NA	NA	NA	NA
AZU55088.1\|406325_406868_+	hypothetical protein	NA	NA	NA	NA
AZU55089.1\|407473_408418_+	hydrogen peroxide-inducible genes activator	A0A2P0ZL89	Lactobacillus_phage	4.0e-09	23.9
AZU55090.1\|408636_408885_+	hypothetical protein	NA	NA	NA	NA
AZU55091.1\|408943_409186_+	hypothetical protein	NA	NA	NA	NA
AZU55092.1\|409345_409846_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	2.1e-20	36.2
AZU55093.1\|409919_410795_+	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
AZU55094.1\|410791_411070_-	hypothetical protein	NA	NA	NA	NA
AZU55095.1\|411091_411916_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AZU55096.1\|411950_412673_-	YggS family pyridoxal phosphate enzyme	NA	NA	NA	NA
AZU55097.1\|412797_413841_+	type IV pili twitching motility protein PilT	NA	NA	NA	NA
AZU55098.1\|413893_415033_+	type IV pili twitching motility protein PilT	NA	NA	NA	NA
AZU55099.1\|415227_415668_+	pilus assembly protein PilE	NA	NA	NA	NA
AZU55100.1\|415671_416160_+	general secretion pathway protein GspH	NA	NA	NA	NA
AZU55101.1\|416156_416747_+	type IV pilus modification protein PilV	NA	NA	NA	NA
AZU55102.1\|416743_417772_+	pilus assembly protein PilW	NA	NA	NA	NA
AZU55103.1\|417775_418312_+	pilus assembly protein	NA	NA	NA	NA
AZU55104.1\|418343_421556_+	pilus assembly protein PilY	NA	NA	NA	NA
AZU57960.1\|421651_422149_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	5.5e-26	40.2
AZU55105.1\|422165_422864_-	YafY family transcriptional regulator	NA	NA	NA	NA
AZU55106.1\|422906_423386_-	cupin	NA	NA	NA	NA
AZU55107.1\|423436_423832_-	glyoxalase	NA	NA	NA	NA
AZU55108.1\|423990_424713_-	LrgB family protein	NA	NA	NA	NA
AZU55109.1\|424709_425087_-	CidA/LrgA family protein	NA	NA	NA	NA
AZU55110.1\|425138_426386_-	glycolate oxidase iron-sulfur subunit	NA	NA	NA	NA
AZU55111.1\|426395_427517_-	glycolate oxidase subunit GlcE	NA	NA	NA	NA
AZU55112.1\|427527_429021_-	FAD-binding oxidoreductase	NA	NA	NA	NA
AZU55113.1\|429191_430082_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZU55114.1\|430092_431511_-	2-hydroxy-acid oxidase	NA	NA	NA	NA
AZU55115.1\|431631_432189_+	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AZU55116.1\|432262_433159_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AZU55117.1\|433443_433779_+	transcriptional regulator	NA	NA	NA	NA
AZU55118.1\|433902_434982_-	3-deoxy-7-phosphoheptulonate synthase	A0A2I6UFP9	Klebsiella_phage	1.1e-76	45.0
AZU55119.1\|435374_436835_-\|protease	metalloprotease TldD	NA	NA	NA	NA
AZU55120.1\|436862_437732_-	acyltransferase	M1H5W0	Paramecium_bursaria_Chlorella_virus	8.3e-09	25.3
AZU55121.1\|437737_442015_-	TIGR02099 family protein	NA	NA	NA	NA
AZU55122.1\|442194_445062_+	bifunctional glutamine synthetase adenylyltransferase/deadenyltransferase	NA	NA	NA	NA
AZU55123.1\|445058_445679_+	rhombosortase	NA	NA	NA	NA
AZU55124.1\|445734_447777_-\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	A0A1B0T6A2	Bacillus_phage	6.0e-10	34.7

DBSCAN-SWA_2

464804 : 474943

Hokovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU55141.1\|464804_466766_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-149	50.8
AZU55142.1\|466900_468043_+	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	2.9e-22	32.7
AZU55143.1\|468078_469959_+	aminodeoxychorismate synthase component I	A0A0B5J984	Pandoravirus	7.9e-57	37.4
AZU55144.1\|469914_470601_-	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.5e-13	27.2
AZU55145.1\|470608_471316_-	ABC transporter permease	NA	NA	NA	NA
AZU55146.1\|471327_472152_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	2.4e-34	31.3
AZU55147.1\|472208_472853_-	deoxynucleoside kinase	M1IA15	Paramecium_bursaria_Chlorella_virus	2.2e-06	27.8
AZU55148.1\|472886_473396_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZU55149.1\|473395_474943_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.6e-23	33.6

DBSCAN-SWA_3

1982114 : 2067923

Ralstonia_phage(44.44%)

head,holin,capsid,protease,tRNA,tail,portal,terminase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU56331.1\|1982114_1983512_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AZU56332.1\|1983685_1984645_+	esterase	H8ZJB8	Ostreococcus_tauri_virus	6.5e-07	28.3
AZU56333.1\|1984718_1985387_-	peptidoglycan endopeptidase	NA	NA	NA	NA
AZU56334.1\|1985676_1987332_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-17	32.9
AZU56335.1\|1987328_1988453_-	ABC transporter permease	NA	NA	NA	NA
AZU56336.1\|1988459_1989515_-	microcin C ABC transporter permease YejB	NA	NA	NA	NA
AZU56337.1\|1989533_1991411_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZU56338.1\|1991677_1992472_+	enoyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
AZU56339.1\|1992873_1994124_-	aspartate kinase	NA	NA	NA	NA
AZU56340.1\|1994252_1995680_-\|tRNA	tRNA(Ile)-lysidine synthetase	NA	NA	NA	NA
AZU56341.1\|1995648_1996617_-	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
AZU56342.1\|1996703_1997579_-	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
AZU56343.1\|1997563_1998961_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	3.0e-37	31.0
AZU56344.1\|1999203_1999863_+	hypothetical protein	NA	NA	NA	NA
AZU56345.1\|1999916_2000489_+	peptidylprolyl isomerase	NA	NA	NA	NA
AZU58051.1\|2000527_2001034_+	cyclophilin	NA	NA	NA	NA
AZU56346.1\|2001030_2001837_+	UDP-2,3-diacylglucosamine hydrolase	NA	NA	NA	NA
AZU56347.1\|2001858_2002605_-	serine acetyltransferase	NA	NA	NA	NA
AZU56348.1\|2002741_2003605_-	RNA methyltransferase	NA	NA	NA	NA
AZU58052.1\|2003718_2004531_+	inositol monophosphatase	NA	NA	NA	NA
AZU56349.1\|2004576_2005125_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZU56350.1\|2005217_2005946_+	glutamine amidotransferase	NA	NA	NA	NA
AZU56351.1\|2005942_2006668_+	MOSC domain-containing protein	NA	NA	NA	NA
AZU56352.1\|2006676_2008479_-	methyl-accepting chemotaxis protein	NA	NA	NA	NA
AZU56353.1\|2008554_2010426_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.1e-09	62.3
AZU56354.1\|2010559_2011375_-	2,5-didehydrogluconate reductase B	A0A1V0SDE7	Indivirus	1.0e-29	33.1
AZU56355.1\|2011407_2012610_-	MFS transporter	NA	NA	NA	NA
AZU56356.1\|2012722_2013616_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZU56357.1\|2014432_2014963_-	hypothetical protein	NA	NA	NA	NA
AZU56358.1\|2015679_2018541_+	Rhs element Vgr protein	A0A2H4JCD4	uncultured_Caudovirales_phage	2.7e-40	23.2
AZU56359.1\|2018551_2020558_+	phospholipase	NA	NA	NA	NA
AZU58053.1\|2020630_2021869_+	sel1 repeat family protein	NA	NA	NA	NA
AZU56360.1\|2021890_2022181_+	PAAR domain-containing protein	R4JMI1	Burkholderia_phage	4.1e-05	35.6
AZU56361.1\|2022217_2022865_+	hypothetical protein	NA	NA	NA	NA
AZU56362.1\|2023310_2023649_+	DUF1484 domain-containing protein	NA	NA	NA	NA
AZU56363.1\|2023670_2024750_-\|portal	phage portal protein	A0A077K9Q8	Ralstonia_phage	1.8e-194	92.0
AZU56364.1\|2024746_2026528_-	oxidoreductase	A0A077K8Q7	Ralstonia_phage	0.0e+00	91.2
AZU56365.1\|2026664_2027507_+\|capsid	capsid scaffolding protein	A4PE29	Ralstonia_virus	7.0e-122	77.9
AZU56366.1\|2027545_2028598_+\|capsid	phage major capsid protein, P2 family	A4PE30	Ralstonia_virus	4.0e-143	74.0
AZU56367.1\|2028594_2029317_+\|terminase	terminase	A4PE31	Ralstonia_virus	8.7e-97	77.5
AZU56368.1\|2029366_2029894_+\|head	head completion/stabilization protein	A0A077K9R2	Ralstonia_phage	9.9e-74	84.0
AZU56369.1\|2029893_2030097_+\|tail	phage tail protein	A0A077K8R0	Ralstonia_phage	7.2e-25	86.8
AZU56370.1\|2030112_2030520_+	hypothetical protein	A0A077K9X1	Ralstonia_phage	3.4e-21	91.1
AZU56371.1\|2030516_2030834_+\|holin	phage holin family protein	A4PE35	Ralstonia_virus	5.2e-46	94.1
AZU56372.1\|2030830_2031634_+	peptidoglycan-binding protein	A4PE36	Ralstonia_virus	3.2e-124	84.2
AZU56373.1\|2031630_2032065_+\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	1.2e-69	86.8
AZU56374.1\|2032061_2032532_+	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	6.1e-59	81.6
AZU56375.1\|2033258_2033918_-	hypothetical protein	NA	NA	NA	NA
AZU56376.1\|2035327_2035945_+\|plate	phage baseplate assembly protein V	A0A077K9S0	Ralstonia_phage	1.4e-108	94.6
AZU56377.1\|2035941_2036289_+\|plate	baseplate assembly protein	A4PE42	Ralstonia_virus	1.9e-57	98.3
AZU58054.1\|2037191_2037809_+\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	1.9e-100	95.7
AZU56378.1\|2037813_2039478_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	0.0e+00	98.0
AZU56379.1\|2039490_2040243_+\|tail	phage tail protein	A0A077K9S5	Ralstonia_phage	5.5e-118	89.2
AZU56380.1\|2040239_2040704_+	hypothetical protein	A0A077K8R9	Ralstonia_phage	2.4e-79	91.6
AZU56381.1\|2040797_2041973_+\|tail	phage tail protein	A0A077K9Y4	Ralstonia_phage	5.8e-215	94.6
AZU56382.1\|2042004_2042514_+\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	1.2e-81	84.6
AZU58055.1\|2042589_2042916_+\|tail	phage tail protein	A4PE51	Ralstonia_virus	9.8e-48	94.4
AZU56383.1\|2042912_2043014_+\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	2.7e-09	93.9
AZU56384.1\|2043010_2045674_+\|tail	phage tail protein	A4PE52	Ralstonia_virus	0.0e+00	96.9
AZU56385.1\|2045676_2046099_+	oxidoreductase	A4PE53	Ralstonia_virus	1.4e-73	99.3
AZU56386.1\|2046095_2047223_+\|tail	phage tail protein	A4PE54	Ralstonia_virus	4.6e-201	96.0
AZU58056.1\|2047333_2047528_+	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	1.6e-13	69.2
AZU56387.1\|2047490_2048357_+	DNA cytosine methyltransferase	A0A1P8DJM9	Virus_Rctr41k	5.6e-50	59.2
AZU56388.1\|2048505_2048712_-	hypothetical protein	A0A077K8S5	Ralstonia_phage	1.6e-27	87.9
AZU56389.1\|2048997_2049468_-	XRE family transcriptional regulator	A0A077K9Z1	Ralstonia_phage	7.5e-41	61.2
AZU56390.1\|2049812_2050061_+	transcriptional regulator	A0A077K829	Ralstonia_phage	4.7e-34	82.9
AZU56391.1\|2050178_2050733_+	transcriptional regulator	A0A077K9T3	Ralstonia_phage	8.5e-84	85.2
AZU56392.1\|2050919_2051156_+	hypothetical protein	A4PE65	Ralstonia_virus	5.1e-30	80.8
AZU56393.1\|2051148_2051358_+	hypothetical protein	A4PE66	Ralstonia_virus	5.5e-20	72.9
AZU56394.1\|2051772_2054457_+	bifunctional DNA primase/helicase	A0A077K8T2	Ralstonia_phage	0.0e+00	92.8
AZU56395.1\|2054516_2054744_+	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	7.6e-23	73.1
AZU58057.1\|2054744_2056028_-	alpha/beta hydrolase	C7BGE7	Burkholderia_phage	4.0e-137	55.9
AZU58058.1\|2056207_2058850_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	3.5e-26	23.3
AZU56396.1\|2058849_2059914_+	hypothetical protein	NA	NA	NA	NA
AZU56397.1\|2059969_2060494_-	peptidylprolyl isomerase	NA	NA	NA	NA
AZU56398.1\|2060505_2061735_+	cupin	NA	NA	NA	NA
AZU56399.1\|2061961_2062240_+	hypothetical protein	NA	NA	NA	NA
AZU56400.1\|2062377_2063163_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	1.0e-26	33.5
AZU56401.1\|2063197_2064394_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
AZU56402.1\|2064434_2065319_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AZU56403.1\|2065437_2066010_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZU56404.1\|2066029_2067232_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AZU56405.1\|2067245_2067923_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_4

2099145 : 2124191

Burkholderia_phage(33.33%)

integrase,transposase

attL 2093139:2093154|attR 2125009:2125024

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2093139:2093154	attL	NA	NA	NA	NA
AZU56434.1\|2099145_2100132_+\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AZU56435.1\|2100635_2101430_+	hypothetical protein	NA	NA	NA	NA
AZU56436.1\|2101547_2102597_+\|transposase	IS481 family transposase	A0A0M3LS26	Mannheimia_phage	9.9e-150	75.1
AZU56437.1\|2102738_2103839_+	hypothetical protein	NA	NA	NA	NA
AZU56438.1\|2103891_2104731_-	hypothetical protein	NA	NA	NA	NA
AZU56439.1\|2104788_2105591_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AZU56440.1\|2105850_2106618_-	AAA family ATPase	K4HZD4	Acidithiobacillus_phage	2.3e-71	54.2
AZU56441.1\|2106630_2108154_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.5e-149	53.4
AZU56442.1\|2108199_2108577_-	hypothetical protein	NA	NA	NA	NA
AZU56443.1\|2109199_2110186_-\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AZU56444.1\|2110348_2110711_-	hypothetical protein	NA	NA	NA	NA
AZU56445.1\|2111083_2111272_+	hypothetical protein	NA	NA	NA	NA
AZU56446.1\|2112291_2113203_-	hypothetical protein	NA	NA	NA	NA
AZU56447.1\|2113199_2113727_-	hypothetical protein	NA	NA	NA	NA
AZU56448.1\|2114224_2115310_-	hypothetical protein	NA	NA	NA	NA
AZU56449.1\|2115309_2116632_-	phosphohydrolase	NA	NA	NA	NA
AZU56450.1\|2117779_2118148_-	hypothetical protein	NA	NA	NA	NA
AZU56451.1\|2118147_2119980_-	hypothetical protein	A0A2H4J185	uncultured_Caudovirales_phage	1.6e-25	27.1
AZU56452.1\|2120083_2120599_-	hypothetical protein	NA	NA	NA	NA
AZU56453.1\|2120656_2121481_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AZU56454.1\|2121471_2122758_-	hypothetical protein	NA	NA	NA	NA
AZU56455.1\|2122754_2124191_-\|integrase	integrase	NA	NA	NA	NA
2125009:2125024	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2306522 : 2314757

Planktothrix_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU56618.1\|2306522_2307575_-	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	2.6e-33	39.4
AZU56619.1\|2307731_2308655_-	deacetylase	A0A2K9KZC4	Tupanvirus	9.3e-43	35.9
AZU56620.1\|2308772_2309885_+	lytic murein transglycosylase B	NA	NA	NA	NA
AZU56621.1\|2309964_2310867_-	cysteine synthase B	A0A1X9I5K7	Streptococcus_phage	8.2e-52	40.8
AZU56622.1\|2310970_2311288_-	competence protein ComE	NA	NA	NA	NA
AZU56623.1\|2311417_2312413_-	ADP-L-glycero-D-mannoheptose-6-epimerase	R9S880	Prochlorococcus_phage	4.1e-28	32.3
AZU56624.1\|2312409_2313357_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	9.0e-17	27.6
AZU56625.1\|2313383_2314757_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.9e-76	38.9

DBSCAN-SWA_6

2357637 : 2366650

Acidithiobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU56658.1\|2357637_2358099_-	glycoside hydrolase	K4I410	Acidithiobacillus_phage	4.8e-64	80.3
AZU56659.1\|2358095_2358572_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	1.4e-71	84.2
AZU56660.1\|2358568_2358859_-	hypothetical protein	K4I011	Acidithiobacillus_phage	2.4e-13	48.8
AZU56661.1\|2358926_2359151_-	hypothetical protein	NA	NA	NA	NA
AZU56662.1\|2359160_2360996_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.4e-106	45.6
AZU56663.1\|2361000_2361399_-	hypothetical protein	NA	NA	NA	NA
AZU56664.1\|2361395_2361878_-	hypothetical protein	A0A0M4TU90	Ralstonia_phage	1.1e-13	44.0
AZU56665.1\|2361881_2363048_-	hypothetical protein	NA	NA	NA	NA
AZU56666.1\|2363059_2366650_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	0.0e+00	53.6

DBSCAN-SWA_7

2371869 : 2395815

uncultured_Caudovirales_phage(42.11%)

head,capsid,protease,portal,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU58074.1\|2371869_2373135_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	1.1e-38	43.3
AZU56670.1\|2373613_2374945_+	type III effector HopG1	NA	NA	NA	NA
AZU56671.1\|2375245_2376343_-	methyltransferase	Q6J1P4	Burkholderia_virus	8.0e-102	57.2
AZU56672.1\|2376350_2377292_-	hypothetical protein	Q8W6P3	Burkholderia_virus	2.5e-128	71.3
AZU56673.1\|2377973_2378261_+	DNA-binding protein	NA	NA	NA	NA
AZU56674.1\|2378303_2378948_-	hypothetical protein	NA	NA	NA	NA
AZU56675.1\|2378922_2379144_-	hypothetical protein	NA	NA	NA	NA
AZU56676.1\|2379140_2379530_-	hypothetical protein	NA	NA	NA	NA
AZU56677.1\|2379538_2380312_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	4.0e-47	43.6
AZU56678.1\|2380434_2380881_-	hypothetical protein	NA	NA	NA	NA
AZU56679.1\|2380886_2381189_-	hypothetical protein	NA	NA	NA	NA
AZU56680.1\|2381191_2382196_-\|capsid	major capsid protein E	A0A1B2LRS0	Wolbachia_phage	1.6e-109	66.9
AZU56681.1\|2382202_2382580_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	1.4e-24	48.8
AZU56682.1\|2382589_2383849_-\|protease	Clp protease ClpP	K4HZZ6	Acidithiobacillus_phage	2.3e-60	42.7
AZU56683.1\|2383860_2385429_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	1.9e-149	57.1
AZU56684.1\|2385428_2385650_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	1.3e-11	57.5
AZU56685.1\|2385650_2386043_-	hypothetical protein	NA	NA	NA	NA
AZU56686.1\|2386053_2386563_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	4.8e-25	44.4
AZU58075.1\|2386605_2388585_-\|terminase	terminase	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	86.0
AZU56687.1\|2388587_2389124_-	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	3.2e-72	82.0
AZU56688.1\|2389209_2389431_+	hypothetical protein	NA	NA	NA	NA
AZU56689.1\|2389566_2390046_+	hypothetical protein	A0A2H4JE21	uncultured_Caudovirales_phage	9.4e-23	59.0
AZU56690.1\|2390165_2390669_+	hypothetical protein	K4HZZ2	Acidithiobacillus_phage	1.9e-13	33.1
AZU58076.1\|2390796_2391147_+	hypothetical protein	NA	NA	NA	NA
AZU56691.1\|2391376_2391745_-	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	2.1e-14	43.1
AZU56692.1\|2391905_2392286_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	3.5e-20	48.3
AZU58077.1\|2392474_2392840_+	hypothetical protein	A0A2H4JI44	uncultured_Caudovirales_phage	1.0e-32	59.5
AZU56693.1\|2392977_2393220_+	hypothetical protein	NA	NA	NA	NA
AZU56694.1\|2393179_2394415_-	DNA methylase N-4	A0A2H4JGF1	uncultured_Caudovirales_phage	4.2e-192	80.7
AZU56695.1\|2394411_2395815_-	DNA modification methylase	K4I3Y2	Acidithiobacillus_phage	1.8e-162	61.6

DBSCAN-SWA_8

2422734 : 2494665

Acidithiobacillus_phage(35.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU56722.1\|2422734_2423523_-\|transposase	transposase	NA	NA	NA	NA
AZU56723.1\|2424023_2424869_-	hypothetical protein	NA	NA	NA	NA
AZU56724.1\|2424881_2426633_-	peptide transporter	NA	NA	NA	NA
AZU56725.1\|2426644_2429185_-	hemagglutinin	A0A0R6PJK4	Moraxella_phage	1.6e-15	29.9
AZU56726.1\|2430269_2430578_-	hypothetical protein	NA	NA	NA	NA
AZU56727.1\|2441700_2442033_+	DUF1484 domain-containing protein	NA	NA	NA	NA
AZU58079.1\|2442084_2442381_-	hypothetical protein	NA	NA	NA	NA
AZU58080.1\|2442448_2442910_-	glycoside hydrolase	K4I410	Acidithiobacillus_phage	1.1e-65	80.3
AZU56728.1\|2442906_2443389_-	HNH endonuclease	A0A076YKQ7	Mycobacterium_phage	1.4e-21	48.3
AZU56729.1\|2443375_2443858_-	hypothetical protein	K4ICR8	Acidithiobacillus_phage	2.6e-60	72.9
AZU56730.1\|2443854_2444145_-	hypothetical protein	K4I011	Acidithiobacillus_phage	2.7e-12	46.4
AZU56731.1\|2444211_2444436_-	hypothetical protein	NA	NA	NA	NA
AZU56732.1\|2444816_2445194_-	hypothetical protein	NA	NA	NA	NA
AZU56733.1\|2445551_2446088_-	hypothetical protein	A0A0M4UKC5	Ralstonia_phage	1.8e-46	50.3
AZU56734.1\|2446299_2447124_+\|transposase	IS5 family transposase	NA	NA	NA	NA
AZU56735.1\|2447372_2448110_+	oxidoreductase	NA	NA	NA	NA
AZU56736.1\|2448513_2449200_-	hypothetical protein	NA	NA	NA	NA
AZU56737.1\|2449252_2449612_-	hypothetical protein	NA	NA	NA	NA
AZU56738.1\|2449812_2450157_-	hypothetical protein	NA	NA	NA	NA
AZU56739.1\|2450396_2453519_-	AcrB/AcrD/AcrF family protein	NA	NA	NA	NA
AZU56740.1\|2453515_2454631_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZU58081.1\|2454718_2455333_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZU56741.1\|2455420_2456881_+	TolC family protein	NA	NA	NA	NA
AZU56742.1\|2456973_2457780_+	oxidoreductase	NA	NA	NA	NA
AZU56743.1\|2457829_2459293_+	MFS transporter	NA	NA	NA	NA
AZU56744.1\|2460037_2461024_-\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7
AZU56745.1\|2461913_2462150_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	1.6e-20	82.3
AZU56746.1\|2462165_2462360_-	hypothetical protein	A0A2H4JCL4	uncultured_Caudovirales_phage	2.8e-18	70.0
AZU56747.1\|2462552_2463355_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AZU56748.1\|2463455_2464421_-	type III effector protein ript	NA	NA	NA	NA
AZU56749.1\|2464627_2465149_+	DUF3489 domain-containing protein	A0A2H4JE21	uncultured_Caudovirales_phage	1.2e-23	61.9
AZU58082.1\|2465277_2465568_+	hypothetical protein	NA	NA	NA	NA
AZU58083.1\|2465625_2465964_-	DUF1484 domain-containing protein	NA	NA	NA	NA
AZU56750.1\|2466417_2467764_-	hypothetical protein	NA	NA	NA	NA
AZU56751.1\|2468828_2469872_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZU56752.1\|2469998_2470376_-	hypothetical protein	U5P4I9	Shigella_phage	6.7e-16	58.8
AZU56753.1\|2470692_2470965_-	hypothetical protein	NA	NA	NA	NA
AZU58084.1\|2470964_2472434_-	virulence factor	NA	NA	NA	NA
AZU56754.1\|2472442_2474650_-	hypothetical protein	A0A077K801	Ralstonia_phage	1.9e-41	32.9
AZU56755.1\|2474654_2477375_-	type IV secretion protein Rhs	A0A2H4JCD4	uncultured_Caudovirales_phage	3.3e-88	31.9
AZU56756.1\|2477830_2478064_+	hypothetical protein	NA	NA	NA	NA
AZU56757.1\|2478045_2478243_+	hypothetical protein	NA	NA	NA	NA
AZU56758.1\|2478579_2478987_-	hypothetical protein	NA	NA	NA	NA
AZU56759.1\|2478976_2479186_-	hypothetical protein	NA	NA	NA	NA
AZU56760.1\|2481700_2482090_-	hypothetical protein	NA	NA	NA	NA
AZU56761.1\|2482095_2482500_-	hypothetical protein	K4I3X7	Acidithiobacillus_phage	6.3e-28	50.4
AZU56762.1\|2482572_2483205_-	hypothetical protein	K4ICM8	Acidithiobacillus_phage	8.0e-62	67.5
AZU56763.1\|2483222_2484095_-	hypothetical protein	K4HZX9	Acidithiobacillus_phage	2.4e-101	65.7
AZU56764.1\|2484091_2484589_-	hypothetical protein	NA	NA	NA	NA
AZU56765.1\|2484585_2484870_-	hypothetical protein	NA	NA	NA	NA
AZU56766.1\|2485291_2485897_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZU56767.1\|2486051_2486864_+	oxidoreductase	NA	NA	NA	NA
AZU56768.1\|2487073_2488075_+	NADPH:quinone oxidoreductase	NA	NA	NA	NA
AZU56769.1\|2488503_2489478_-	hypothetical protein	NA	NA	NA	NA
AZU58085.1\|2489474_2490698_-	glycine hydroxymethyltransferase	NA	NA	NA	NA
AZU56770.1\|2491095_2492202_-	serine/threonine acetyltransferase	NA	NA	NA	NA
AZU56771.1\|2492861_2492993_-	elements of external origin	NA	NA	NA	NA
AZU56772.1\|2493240_2493531_-	hypothetical protein	NA	NA	NA	NA
AZU56773.1\|2493678_2494665_-\|transposase	IS5/IS1182 family transposase	E5E3P6	Burkholderia_phage	7.6e-152	81.7

DBSCAN-SWA_9

2498914 : 2559766

uncultured_Caudovirales_phage(33.33%)

head,capsid,protease,portal,terminase,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU58086.1\|2498914_2500348_-\|transposase	transposase	NA	NA	NA	NA
AZU56778.1\|2500371_2502144_-	hypothetical protein	NA	NA	NA	NA
AZU56779.1\|2502674_2503094_-	SMI1/KNR4 family protein	NA	NA	NA	NA
AZU56780.1\|2503102_2512765_-	filamentous hemagglutinin	A0A0R6PJK4	Moraxella_phage	1.6e-36	36.1
AZU56781.1\|2513140_2514088_+	HrgA protein	NA	NA	NA	NA
AZU56782.1\|2515552_2515984_+	hypothetical protein	NA	NA	NA	NA
AZU56783.1\|2517375_2517714_+	DUF1484 domain-containing protein	NA	NA	NA	NA
AZU56784.1\|2518175_2519120_-	hypothetical protein	NA	NA	NA	NA
AZU56785.1\|2520011_2520212_-	hypothetical protein	NA	NA	NA	NA
AZU58087.1\|2521133_2521850_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AZU58088.1\|2522512_2522728_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
AZU56786.1\|2524102_2524354_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
AZU56787.1\|2524350_2524764_+	PIN domain-containing protein	NA	NA	NA	NA
AZU56788.1\|2524835_2525858_-	methyltransferase	Q6J1P4	Burkholderia_virus	1.5e-105	58.3
AZU56789.1\|2526481_2526772_+	DNA-binding protein	NA	NA	NA	NA
AZU56790.1\|2526814_2527459_-	hypothetical protein	NA	NA	NA	NA
AZU56791.1\|2527433_2527655_-	hypothetical protein	NA	NA	NA	NA
AZU56792.1\|2527651_2528041_-	hypothetical protein	NA	NA	NA	NA
AZU56793.1\|2528049_2528823_-	hypothetical protein	A0A2D2W2E0	Stenotrophomonas_phage	2.6e-46	43.2
AZU56794.1\|2528923_2529370_-	hypothetical protein	NA	NA	NA	NA
AZU56795.1\|2529375_2529678_-	hypothetical protein	NA	NA	NA	NA
AZU56796.1\|2529680_2530685_-\|capsid	major capsid protein E	A0A1B2LRS0	Wolbachia_phage	2.8e-109	66.3
AZU56797.1\|2530691_2531069_-\|head	head decoration protein	A0A1B2LRT0	Wolbachia_phage	1.4e-24	49.6
AZU56798.1\|2531078_2532338_-\|protease	Clp protease ClpP	K4HZZ6	Acidithiobacillus_phage	2.9e-63	44.9
AZU56799.1\|2532347_2533874_-\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	1.1e-152	58.4
AZU56800.1\|2533873_2534095_-	hypothetical protein	A0A2H4JCJ9	uncultured_Caudovirales_phage	4.5e-12	57.5
AZU56801.1\|2534095_2534488_-	hypothetical protein	NA	NA	NA	NA
AZU56802.1\|2534497_2535007_-	hypothetical protein	A0A0F6WCR7	Sinorhizobium_phage	9.7e-26	44.4
AZU58089.1\|2535049_2537029_-\|terminase	terminase	A0A2H4JIC6	uncultured_Caudovirales_phage	0.0e+00	85.7
AZU56803.1\|2537031_2537568_-	elements of external origin	A0A2H4JCL4	uncultured_Caudovirales_phage	1.7e-73	83.1
AZU56804.1\|2537709_2538396_-	type III effector protein ript	NA	NA	NA	NA
AZU56805.1\|2538878_2539373_+	hypothetical protein	A0A2H4JE21	uncultured_Caudovirales_phage	7.7e-20	53.4
AZU58090.1\|2539500_2539851_+	hypothetical protein	NA	NA	NA	NA
AZU56806.1\|2540140_2541049_+	type III effector	NA	NA	NA	NA
AZU56807.1\|2542119_2542921_+\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA
AZU56808.1\|2543625_2543922_-	hypothetical protein	NA	NA	NA	NA
AZU56809.1\|2544098_2544299_+	hypothetical protein	NA	NA	NA	NA
AZU56810.1\|2545644_2546373_-	nitroreductase family protein	NA	NA	NA	NA
AZU58091.1\|2546506_2547106_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZU56811.1\|2547336_2547543_+	hypothetical protein	NA	NA	NA	NA
AZU56812.1\|2547557_2548364_-	endoglucanase	NA	NA	NA	NA
AZU56813.1\|2548460_2548664_-	hypothetical protein	NA	NA	NA	NA
AZU58092.1\|2548768_2549389_-	glutathione transferase GstA	NA	NA	NA	NA
AZU56814.1\|2549552_2549807_+	transcriptional regulator	NA	NA	NA	NA
AZU56815.1\|2549878_2550277_-	hypothetical protein	NA	NA	NA	NA
AZU56816.1\|2550665_2551298_+	LysE family translocator	NA	NA	NA	NA
AZU56817.1\|2551369_2552620_+	oxidase	NA	NA	NA	NA
AZU56818.1\|2552630_2553002_+	sulfite:cytochrome C oxidoreductase subunit B	NA	NA	NA	NA
AZU56819.1\|2553015_2553243_-	SirA family protein	NA	NA	NA	NA
AZU56820.1\|2553282_2553864_-	NUDIX hydrolase	NA	NA	NA	NA
AZU56821.1\|2553882_2554920_-	low specificity L-threonine aldolase	NA	NA	NA	NA
AZU56822.1\|2554972_2555161_-	tautomerase	NA	NA	NA	NA
AZU56823.1\|2555173_2555959_-	class II aldolase	NA	NA	NA	NA
AZU58093.1\|2556041_2557262_-	MFS transporter	NA	NA	NA	NA
AZU56824.1\|2557370_2558279_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZU56825.1\|2558353_2559766_+\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_10

3789477 : 3850713

Ralstonia_virus(55.1%)

head,capsid,protease,tail,portal,terminase,transposase,integrase,plate

attL 3805698:3805743|attR 3846473:3846518

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU57830.1\|3789477_3791472_+\|protease	serine protease	NA	NA	NA	NA
AZU57831.1\|3791534_3791930_-	DUF4440 domain-containing protein	NA	NA	NA	NA
AZU57832.1\|3792059_3792548_-	DUF4437 domain-containing protein	NA	NA	NA	NA
AZU57833.1\|3792766_3793462_-	N-acetyltransferase	NA	NA	NA	NA
AZU57834.1\|3793861_3794410_+	NAD(P)H dehydrogenase	NA	NA	NA	NA
AZU57835.1\|3794443_3796342_+	glutathione-regulated potassium-efflux system protein KefC	NA	NA	NA	NA
AZU57836.1\|3796363_3797194_-	cellulose 1,4-beta-cellobiosidase	NA	NA	NA	NA
AZU57837.1\|3797316_3798111_-	DNA repair protein	NA	NA	NA	NA
AZU57838.1\|3798308_3799619_+	glutamate carboxypeptidase	NA	NA	NA	NA
AZU58185.1\|3799790_3800069_-	hypothetical protein	NA	NA	NA	NA
AZU57839.1\|3800558_3801689_+	porin	NA	NA	NA	NA
AZU57840.1\|3801819_3802845_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZU57841.1\|3802848_3803553_-	DNA-binding response regulator	NA	NA	NA	NA
AZU57842.1\|3803635_3803947_-	high-potential iron-sulfur protein	NA	NA	NA	NA
AZU57843.1\|3804127_3804325_+	hypothetical protein	NA	NA	NA	NA
AZU57844.1\|3804717_3805056_+	DUF1484 domain-containing protein	NA	NA	NA	NA
3805698:3805743	attL	NA	NA	NA	NA
AZU57845.1\|3806037_3806877_+	hypothetical protein	NA	NA	NA	NA
AZU57846.1\|3807047_3807359_+	hypothetical protein	NA	NA	NA	NA
AZU57847.1\|3807679_3807979_+	hypothetical protein	NA	NA	NA	NA
AZU57848.1\|3808732_3809398_+	hypothetical protein	A4PE23	Ralstonia_virus	3.3e-66	99.2
AZU57849.1\|3809399_3809903_+	hypothetical protein	A4PE24	Ralstonia_virus	1.0e-91	98.8
AZU57850.1\|3809889_3810237_+	hypothetical protein	NA	NA	NA	NA
AZU58186.1\|3810236_3810845_+	hypothetical protein	A4PE25	Ralstonia_virus	2.1e-99	93.6
AZU57851.1\|3810754_3811570_+	hypothetical protein	A4PE26	Ralstonia_virus	7.7e-150	93.7
AZU57852.1\|3811554_3812661_-\|portal	phage portal protein	A4PE27	Ralstonia_virus	5.1e-213	98.4
AZU57853.1\|3812657_3814439_-	oxidoreductase	A0A077K8Q7	Ralstonia_phage	0.0e+00	99.2
AZU57854.1\|3814582_3815422_+\|capsid	capsid scaffolding protein	A0A077K9W8	Ralstonia_phage	1.6e-150	98.6
AZU57855.1\|3815475_3816492_+\|capsid	phage major capsid protein, P2 family	A0A077KEQ8	Ralstonia_phage	4.7e-189	100.0
AZU57856.1\|3816488_3817211_+\|terminase	terminase	A0A077K804	Ralstonia_phage	9.9e-125	97.9
AZU58187.1\|3817307_3817787_+\|head	head completion/stabilization protein	A4PE32	Ralstonia_virus	1.4e-82	95.6
AZU57857.1\|3817786_3817990_+\|tail	phage tail protein	A0A077K8R0	Ralstonia_phage	1.7e-29	98.5
AZU57858.1\|3818005_3818410_+	hypothetical protein	A0A077K9X1	Ralstonia_phage	2.0e-26	97.8
AZU57859.1\|3818406_3818718_+	hypothetical protein	A0A077KER0	Ralstonia_phage	2.2e-49	99.0
AZU57860.1\|3818714_3819521_+	peptidoglycan-binding protein	A4PE36	Ralstonia_virus	6.9e-143	95.9
AZU57861.1\|3819517_3820018_+	hypothetical protein	A0A077K9R7	Ralstonia_phage	5.7e-79	95.2
AZU57862.1\|3820014_3820449_+\|tail	phage tail protein	A0A077K8R3	Ralstonia_phage	7.9e-77	97.2
AZU57863.1\|3820445_3820895_+	phage virion morphogenesis protein	A0A077K9X5	Ralstonia_phage	6.9e-68	91.9
AZU57864.1\|3820958_3821765_-	hypothetical protein	NA	NA	NA	NA
AZU58188.1\|3821761_3822841_-	hypothetical protein	Q332C0	Clostridium_botulinum_C_phage	5.3e-05	22.4
AZU57865.1\|3823273_3823891_+\|plate	baseplate assembly protein	A4PE41	Ralstonia_virus	2.8e-112	97.1
AZU57866.1\|3823887_3824235_+\|plate	baseplate assembly protein	A4PE42	Ralstonia_virus	7.2e-57	96.5
AZU57867.1\|3824237_3825146_+\|plate	baseplate assembly protein	A0A077K9X9	Ralstonia_phage	1.2e-162	100.0
AZU57868.1\|3825138_3825756_+\|tail	phage tail protein I	A0A077KER5	Ralstonia_phage	9.1e-103	98.4
AZU57869.1\|3825760_3827425_+\|tail	phage tail protein	A0A077K818	Ralstonia_phage	0.0e+00	98.2
AZU57870.1\|3827437_3828190_+\|tail	phage tail protein	A0A077K9S5	Ralstonia_phage	6.0e-133	99.6
AZU57871.1\|3828186_3828651_+	hypothetical protein	A0A077K8R9	Ralstonia_phage	6.7e-82	94.2
AZU57872.1\|3828749_3829925_+\|tail	phage tail protein	A0A077K9Y4	Ralstonia_phage	1.6e-225	99.2
AZU57873.1\|3829956_3830466_+\|tail	phage major tail tube protein	A0A077KER7	Ralstonia_phage	1.4e-93	99.4
AZU58189.1\|3830541_3830868_+\|tail	phage tail protein	A4PE51	Ralstonia_virus	1.8e-49	98.1
AZU57874.1\|3830864_3830966_+\|tail	GpE family phage tail protein	A0A077K821	Ralstonia_phage	4.7e-09	90.9
AZU57875.1\|3830962_3833626_+\|tail	phage tail protein	A4PE52	Ralstonia_virus	0.0e+00	96.9
AZU57876.1\|3833628_3834051_+	oxidoreductase	A4PE53	Ralstonia_virus	3.7e-71	95.7
AZU57877.1\|3834047_3835175_+\|tail	phage tail protein	A4PE54	Ralstonia_virus	4.6e-201	95.7
AZU57878.1\|3835492_3835702_+	Com family DNA-binding transcriptional regulator	A0A1S5NPS9	Burkholderia_phage	2.4e-15	70.4
AZU57879.1\|3835652_3836435_+	DNA methylase N-4	A0A1S5NPU0	Burkholderia_phage	9.2e-92	67.8
AZU57880.1\|3836350_3837097_-	hypothetical protein	A4PE55	Ralstonia_virus	1.9e-123	94.8
AZU58190.1\|3837255_3837672_-	XRE family transcriptional regulator	A4PE57	Ralstonia_virus	1.8e-70	97.8
AZU57881.1\|3837973_3838165_+	hypothetical protein	E5E3U0	Burkholderia_phage	3.4e-08	50.9
AZU57882.1\|3838193_3838388_+	hypothetical protein	A4PE59	Ralstonia_virus	1.3e-23	95.3
AZU57883.1\|3838384_3838633_+	transcriptional regulator	A4PE60	Ralstonia_virus	2.3e-41	98.8
AZU57884.1\|3838747_3839302_+	transcriptional regulator	A4PE61	Ralstonia_virus	1.2e-98	100.0
AZU57885.1\|3839311_3839545_+	hypothetical protein	A4PE62	Ralstonia_virus	6.4e-33	94.8
AZU57886.1\|3839702_3839909_+	hypothetical protein	A4PE64	Ralstonia_virus	2.1e-27	95.6
AZU57887.1\|3839908_3840145_+	hypothetical protein	A4PE65	Ralstonia_virus	3.5e-39	98.7
AZU57888.1\|3840137_3840350_+	hypothetical protein	A4PE66	Ralstonia_virus	2.7e-30	95.7
AZU57889.1\|3840369_3840678_+	hypothetical protein	NA	NA	NA	NA
AZU57890.1\|3840679_3840901_+	hypothetical protein	A4PE67	Ralstonia_virus	1.3e-35	100.0
AZU57891.1\|3840897_3841170_+	hypothetical protein	NA	NA	NA	NA
AZU57892.1\|3841166_3841457_+	RNA-binding protein	A4PE68	Ralstonia_virus	5.5e-50	94.8
AZU57893.1\|3841456_3844261_+	hypothetical protein	A4PE69	Ralstonia_virus	0.0e+00	99.6
AZU58191.1\|3844420_3845140_+	hypothetical protein	A4PE71	Ralstonia_virus	8.2e-79	72.0
AZU57894.1\|3845351_3846434_+\|integrase	integrase	A4PE72	Ralstonia_virus	7.9e-211	99.7
AZU57895.1\|3846898_3847783_+	cytochrome c5 family protein	NA	NA	NA	NA
3846473:3846518	attR	NA	NA	NA	NA
AZU57896.1\|3847957_3848371_+	hypothetical protein	NA	NA	NA	NA
AZU58192.1\|3849888_3850713_-\|transposase	IS5/IS1182 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP022482

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4108 : 52131

Salmonella_phage(18.18%)

transposase,integrase

attL 41951:41966|attR 63396:63411

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU58196.1\|4108_4519_-\|transposase	transposase	NA	NA	NA	NA
AZU58197.1\|4458_4935_-\|transposase	transposase	NA	NA	NA	NA
AZU59545.1\|6482_9467_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	2.8e-80	27.5
AZU58198.1\|9472_11182_-\|integrase	integrase	NA	NA	NA	NA
AZU59546.1\|11481_11922_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AZU58199.1\|11937_12345_+	heat-shock protein	NA	NA	NA	NA
AZU58200.1\|12530_13097_+	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
AZU59547.1\|13296_13683_+	hypothetical protein	NA	NA	NA	NA
AZU59548.1\|13855_15793_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	7.7e-148	49.8
AZU58201.1\|15971_16244_+	hypothetical protein	NA	NA	NA	NA
AZU58202.1\|17062_17320_-	hypothetical protein	NA	NA	NA	NA
AZU58203.1\|17353_17563_-	hypothetical protein	NA	NA	NA	NA
AZU59549.1\|17806_18466_+	carbonic anhydrase	NA	NA	NA	NA
AZU58204.1\|18637_19273_+	diguanylate cyclase	NA	NA	NA	NA
AZU58205.1\|19449_19767_+	co-chaperone GroES	A0A221S322	uncultured_virus	1.8e-17	47.9
AZU58206.1\|19849_21472_+	molecular chaperone GroEL	A0A240F779	uncultured_virus	5.2e-174	60.8
AZU58207.1\|22079_23594_-	deoxyribodipyrimidine photo-lyase	A0A2H4UV63	Bodo_saltans_virus	4.6e-47	27.8
AZU58208.1\|23735_24146_+	hypothetical protein	NA	NA	NA	NA
AZU58209.1\|24142_24766_+	transglycosylase	Q3T4W4	Enterobacteria_phage	3.2e-07	35.1
AZU58210.1\|24853_25096_+	hypothetical protein	NA	NA	NA	NA
AZU58211.1\|25798_27352_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	9.8e-162	55.9
AZU58212.1\|27360_28119_+	AAA family ATPase	K4HZD4	Acidithiobacillus_phage	2.6e-83	60.7
AZU58213.1\|28601_29663_+	peptidase C55	NA	NA	NA	NA
AZU58214.1\|29751_32718_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.7
AZU58215.1\|32874_33432_+	DNA invertase	A0A0C4UR34	Shigella_phage	8.3e-55	63.0
AZU58216.1\|33417_33720_-	hypothetical protein	NA	NA	NA	NA
AZU58217.1\|34776_35736_+	type III effector protein	NA	NA	NA	NA
AZU58218.1\|35988_36858_-	SDR family oxidoreductase	NA	NA	NA	NA
AZU58219.1\|36899_37562_-	hypothetical protein	NA	NA	NA	NA
AZU58220.1\|37614_38184_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZU58221.1\|38577_40563_-	GALA protein 1	NA	NA	NA	NA
AZU58222.1\|40775_41882_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
41951:41966	attL	NA	NA	NA	NA
AZU58223.1\|42179_43121_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZU58224.1\|43202_44396_-	2-polyprenyl-6-methoxyphenol hydroxylase	NA	NA	NA	NA
AZU58225.1\|44535_45465_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZU58226.1\|45567_46236_+	disulfide bond formation protein DsbA	NA	NA	NA	NA
AZU58227.1\|46312_47227_+	LLM class oxidoreductase	NA	NA	NA	NA
AZU58228.1\|47330_47714_+	DUF4437 domain-containing protein	NA	NA	NA	NA
AZU58229.1\|48176_49877_-\|integrase	integrase	A0A2K9VH72	Gordonia_phage	1.5e-06	25.5
AZU58230.1\|49875_50061_+	hypothetical protein	NA	NA	NA	NA
AZU58231.1\|50868_52131_-\|transposase	IS110 family transposase	NA	NA	NA	NA
63396:63411	attR	NA	NA	NA	NA

DBSCAN-SWA_2

854888 : 862422

Ralstonia_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZU58770.1\|854888_857549_+	type VI secretion protein	A0A077K8Q4	Ralstonia_phage	0.0e+00	83.3
AZU58771.1\|857551_857848_+	hypothetical protein	A0A077K8Q4	Ralstonia_phage	2.0e-07	51.4
AZU58772.1\|857844_858720_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	2.0e-103	69.9
AZU59608.1\|858734_859559_+	hypothetical protein	A0A077K9W3	Ralstonia_phage	1.0e-125	86.5
AZU58773.1\|859555_861814_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	0.0e+00	85.1
AZU58774.1\|861810_862149_+	hypothetical protein	NA	NA	NA	NA
AZU58775.1\|862155_862422_+	hypothetical protein	R9U4D0	Rhizobium_phage	1.7e-05	50.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP022483

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP022481

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP022482

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection