CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP018036	Bordetella pertussis strain I094 chromosome, complete genome	4 crisprs	csa3,cas3,DinG,DEDDh	0	0	24	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP018036_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP018036_1

251626-251710

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP018036_1

>merge|CP018036|1|251626-251710|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP018036|1|1|251626-251710|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP018036.1\|AZV88020.1\|254652_255273_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP018036.1\|AZV84916.1\|247072_247564_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP018036.1\|AZV88019.1\|243427_244687_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP018036.1\|AZV84926.1\|258827_259808_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223751
CP018036.1\|AZV84912.1\|239811_240567_+\|gamma-hydroxybutyrate-dehydrogenase	unknown	unknown	gnl\|CDD\|185358
CP018036.1\|AZV84922.1\|252658_254548_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP018036.1\|AZV84929.1\|261997_263752_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP018036.1\|AZV84923.1\|255415_256801_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP018036.1\|AZV84914.1\|241370_242414_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP018036.1\|AZV84920.1\|250565_251615_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP018036.1\|AZV84921.1\|251720_252662_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP018036.1\|AZV84927.1\|259943_260927_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270295
CP018036.1\|AZV84925.1\|257419_258811_+\|fumarate-hydratase,-class-II	unknown	unknown	gnl\|CDD\|234779
CP018036.1\|AZV84924.1\|256731_257268_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP018036.1\|AZV84919.1\|249611_250313_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP018036.1\|AZV84915.1\|246097_247054_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270296
CP018036.1\|AZV84918.1\|248916_249615_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319796
CP018036.1\|AZV84913.1\|240583_241327_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP018036.1\|AZV84917.1\|247560_248916_-\|poly(A)-polymerase	unknown	unknown	gnl\|CDD\|130997
CP018036.1\|AZV84928.1\|260991_261891_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107

Protein	Function_ID	Function_description	E-value
CP018036.1\|AZV88020.1\|254652_255273_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	8.25718e-70
CP018036.1\|AZV84916.1\|247072_247564_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP018036.1\|AZV88019.1\|243427_244687_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.48771e-95
CP018036.1\|AZV84926.1\|258827_259808_-\|hypothetical-protein	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP018036.1\|AZV84912.1\|239811_240567_+\|gamma-hydroxybutyrate-dehydrogenase	gnl\|CDD\|185358	PRK15461, PRK15461, sulfolactaldehyde 3-reductase.	1.19571e-122
CP018036.1\|AZV84922.1\|252658_254548_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP018036.1\|AZV84929.1\|261997_263752_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP018036.1\|AZV84923.1\|255415_256801_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	1.25625e-84
CP018036.1\|AZV84914.1\|241370_242414_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP018036.1\|AZV84920.1\|250565_251615_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP018036.1\|AZV84921.1\|251720_252662_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP018036.1\|AZV84927.1\|259943_260927_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP018036.1\|AZV84925.1\|257419_258811_+\|fumarate-hydratase,-class-II	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP018036.1\|AZV84924.1\|256731_257268_-\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP018036.1\|AZV84919.1\|249611_250313_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP018036.1\|AZV84915.1\|246097_247054_+\|hypothetical-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP018036.1\|AZV84918.1\|248916_249615_-\|hypothetical-protein	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP018036.1\|AZV84913.1\|240583_241327_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP018036.1\|AZV84917.1\|247560_248916_-\|poly(A)-polymerase	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP018036.1\|AZV84928.1\|260991_261891_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38

>CP018036.1|AZV84920.1|250565_251615_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP018036.1|AZV84919.1|249611_250313_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP018036.1|AZV84918.1|248916_249615_-|hypothetical-protein
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP018036.1|AZV84917.1|247560_248916_-|poly(A)-polymerase
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP018036.1|AZV84916.1|247072_247564_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP018036.1|AZV84915.1|246097_247054_+|hypothetical-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP018036.1|AZV88019.1|243427_244687_+|hypothetical-protein
MMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP018036.1|AZV84914.1|241370_242414_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP018036.1|AZV84913.1|240583_241327_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP018036.1|AZV84912.1|239811_240567_+|gamma-hydroxybutyrate-dehydrogenase
MLPTATHIQAALEGADGALQGMGPGALFINMSTILPQETDLIAQRLAERGMRMLDSPVGRSAMEAQRGTLLILASGSAQDKARARDALLCMGNQVIDCGEVGGGSRVKVVNNFMGISLNALTAEALTLAEASGLSVELALEVMRGTIAGLGHMNITYPNKVLRGDLSAGFQVDLAHKDLGLALELAARSRACVPMGSAAFQSYTAARAQGRGGQDYSAIYPVMRSLSGLPEALPYQVDTPVEADPFGAAAR
>CP018036.1|AZV84921.1|251720_252662_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP018036.1|AZV84922.1|252658_254548_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP018036.1|AZV88020.1|254652_255273_+|hypothetical-protein
MVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP018036.1|AZV84923.1|255415_256801_-|N-acetylmuramoyl-L-alanine-amidase
MVERDCPPAHGALSPRAAARRRLISVAATLLVLPVVPRLAHAATILAVRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP018036.1|AZV84924.1|256731_257268_-|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP018036.1|AZV84925.1|257419_258811_+|fumarate-hydratase,-class-II
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP018036.1|AZV84926.1|258827_259808_-|hypothetical-protein
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP018036.1|AZV84927.1|259943_260927_+|ABC-transporter-substrate-binding-protein
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP018036.1|AZV84928.1|260991_261891_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP018036.1|AZV84929.1|261997_263752_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP018036_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP018036_2

433062-433155

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP018036_2

>merge|CP018036|2|433062-433155|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP018036|2|2|433062-433155|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP018036.1\|AZV85081.1\|431431_432301_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP018036.1\|AZV85089.1\|440238_441024_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP018036.1\|AZV85086.1\|437433_437952_-\|methyltransferase	unknown	unknown	gnl\|CDD\|224204
CP018036.1\|AZV85076.1\|422177_423155_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP018036.1\|AZV85079.1\|427583_427763_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP018036.1\|AZV85084.1\|433800_434145_-\|TIGR01244-family-protein	unknown	unknown	gnl\|CDD\|225984
CP018036.1\|AZV85083.1\|433241_433712_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP018036.1\|AZV85082.1\|432432_432831_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP018036.1\|AZV85090.1\|441090_442062_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP018036.1\|AZV85087.1\|438062_438818_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223930
CP018036.1\|AZV85075.1\|421590_422085_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP018036.1\|AZV88029.1\|426079_427393_-\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
CP018036.1\|AZV85088.1\|439013_440246_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP018036.1\|AZV85092.1\|443175_444348_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP018036.1\|AZV85078.1\|424552_426064_+\|TRAP-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP018036.1\|AZV85077.1\|423350_424556_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP018036.1\|AZV85091.1\|442072_443050_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP018036.1\|AZV85085.1\|434244_435645_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224089
CP018036.1\|AZV85080.1\|428172_428907_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP018036.1\|AZV85074.1\|420402_421461_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030

Protein	Function_ID	Function_description	E-value
CP018036.1\|AZV85081.1\|431431_432301_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	4.17449e-23
CP018036.1\|AZV85089.1\|440238_441024_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP018036.1\|AZV85086.1\|437433_437952_-\|methyltransferase	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP018036.1\|AZV85076.1\|422177_423155_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
CP018036.1\|AZV85079.1\|427583_427763_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
CP018036.1\|AZV85084.1\|433800_434145_-\|TIGR01244-family-protein	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP018036.1\|AZV85083.1\|433241_433712_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP018036.1\|AZV85082.1\|432432_432831_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP018036.1\|AZV85090.1\|441090_442062_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP018036.1\|AZV85087.1\|438062_438818_+\|hypothetical-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP018036.1\|AZV85075.1\|421590_422085_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP018036.1\|AZV88029.1\|426079_427393_-\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP018036.1\|AZV85088.1\|439013_440246_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP018036.1\|AZV85092.1\|443175_444348_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP018036.1\|AZV85078.1\|424552_426064_+\|TRAP-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP018036.1\|AZV85077.1\|423350_424556_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP018036.1\|AZV85091.1\|442072_443050_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP018036.1\|AZV85085.1\|434244_435645_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP018036.1\|AZV85080.1\|428172_428907_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP018036.1\|AZV85074.1\|420402_421461_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89

>CP018036.1|AZV85082.1|432432_432831_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP018036.1|AZV85081.1|431431_432301_+|IS481-family-transposase
MPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP018036.1|AZV85080.1|428172_428907_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP018036.1|AZV85079.1|427583_427763_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP018036.1|AZV88029.1|426079_427393_-|short-chain-fatty-acid-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP018036.1|AZV85078.1|424552_426064_+|TRAP-ABC-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP018036.1|AZV85077.1|423350_424556_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP018036.1|AZV85076.1|422177_423155_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP018036.1|AZV85075.1|421590_422085_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP018036.1|AZV85074.1|420402_421461_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP018036.1|AZV85083.1|433241_433712_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP018036.1|AZV85084.1|433800_434145_-|TIGR01244-family-protein
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP018036.1|AZV85085.1|434244_435645_-|GntR-family-transcriptional-regulator
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP018036.1|AZV85086.1|437433_437952_-|methyltransferase
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP018036.1|AZV85087.1|438062_438818_+|hypothetical-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP018036.1|AZV85088.1|439013_440246_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP018036.1|AZV85089.1|440238_441024_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP018036.1|AZV85090.1|441090_442062_+|ABC-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP018036.1|AZV85091.1|442072_443050_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP018036.1|AZV85092.1|443175_444348_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP018036_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP018036_3

997366-997460

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP018036_3

>merge|CP018036|3|997366-997460|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP018036|3|3|997366-997460|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP018036.1\|AZV85554.1\|1000572_1001589_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
CP018036.1\|AZV85558.1\|1010861_1011113_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225170
CP018036.1\|AZV85543.1\|986789_987824_+\|sulfate-transporter-subunit	unknown	unknown	gnl\|CDD\|224529
CP018036.1\|AZV88068.1\|1004512_1005430_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP018036.1\|AZV85551.1\|997548_998235_+\|coenzyme-A-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP018036.1\|AZV85544.1\|987839_988049_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131194
CP018036.1\|AZV85552.1\|998330_999200_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP018036.1\|AZV85550.1\|996918_997299_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP018036.1\|AZV85546.1\|988859_989642_+\|sulfate-ABC-transporter-permease-subunit-CysW	unknown	unknown	gnl\|CDD\|226665
CP018036.1\|AZV85557.1\|1006237_1009417_+\|multidrug-efflux-RND-transporter-permease	unknown	unknown	gnl\|CDD\|273335
CP018036.1\|AZV85553.1\|999385_1000435_+\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP018036.1\|AZV85547.1\|989666_990731_+\|sulfate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213263
CP018036.1\|AZV85549.1\|995740_996613_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP018036.1\|AZV85555.1\|1003097_1003670_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703
CP018036.1\|AZV88066.1\|991528_992437_+\|sulfate-adenylyltransferase-small-subunit	unknown	unknown	gnl\|CDD\|235375
CP018036.1\|AZV85548.1\|995352_995733_+\|hypothetical-protein	unknown	unknown	unknown
CP018036.1\|AZV85556.1\|1003729_1004461_+\|pseudouridylate-synthase	unknown	unknown	gnl\|CDD\|224108
CP018036.1\|AZV85545.1\|988070_988745_+\|sulfate-ABC-transporter-permease-subunit-CysT	unknown	unknown	gnl\|CDD\|131194
CP018036.1\|AZV88067.1\|993924_995199_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP018036.1\|AZV85559.1\|1011258_1011873_-\|SCO-family-protein	unknown	unknown	gnl\|CDD\|239266

Protein	Function_ID	Function_description	E-value
CP018036.1\|AZV85554.1\|1000572_1001589_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.63944e-23
CP018036.1\|AZV85558.1\|1010861_1011113_-\|hypothetical-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP018036.1\|AZV85543.1\|986789_987824_+\|sulfate-transporter-subunit	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP018036.1\|AZV88068.1\|1004512_1005430_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
CP018036.1\|AZV85551.1\|997548_998235_+\|coenzyme-A-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	2.60589e-72
CP018036.1\|AZV85544.1\|987839_988049_+\|hypothetical-protein	gnl\|CDD\|131194	TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT. This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions].	1.31104e-05
CP018036.1\|AZV85552.1\|998330_999200_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	2.11943e-22
CP018036.1\|AZV85550.1\|996918_997299_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP018036.1\|AZV85546.1\|988859_989642_+\|sulfate-ABC-transporter-permease-subunit-CysW	gnl\|CDD\|226665	COG4208, CysW, ABC-type sulfate transport system, permease component [Inorganic ion transport and metabolism].	8.42883e-141
CP018036.1\|AZV85557.1\|1006237_1009417_+\|multidrug-efflux-RND-transporter-permease	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP018036.1\|AZV85553.1\|999385_1000435_+\|aldo/keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP018036.1\|AZV85547.1\|989666_990731_+\|sulfate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP018036.1\|AZV85549.1\|995740_996613_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP018036.1\|AZV85555.1\|1003097_1003670_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
CP018036.1\|AZV88066.1\|991528_992437_+\|sulfate-adenylyltransferase-small-subunit	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP018036.1\|AZV85556.1\|1003729_1004461_+\|pseudouridylate-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP018036.1\|AZV85545.1\|988070_988745_+\|sulfate-ABC-transporter-permease-subunit-CysT	gnl\|CDD\|131194	TIGR02139, permease_CysT, sulfate ABC transporter, permease protein CysT. This model represents CysT, one of two homologous, tandem permeases in the sulfate ABC transporter system; the other is CysW (TIGR02140). The sulfate transporter has been described in E. coli as transporting sulfate, thiosulfate, selenate, and selenite. Sulfate transporters may also transport molybdate ion if a specific molybdate transporter is not present. [Transport and binding proteins, Anions].	5.60551e-119
CP018036.1\|AZV88067.1\|993924_995199_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP018036.1\|AZV85559.1\|1011258_1011873_-\|SCO-family-protein	gnl\|CDD\|239266	cd02968, SCO, SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properties of Sco1 implies that it participates in signaling events rather than functioning as a chaperone that transfers copper to COX II.	2.62796e-54

>CP018036.1|AZV85550.1|996918_997299_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP018036.1|AZV85549.1|995740_996613_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP018036.1|AZV85548.1|995352_995733_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP018036.1|AZV88067.1|993924_995199_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP018036.1|AZV88066.1|991528_992437_+|sulfate-adenylyltransferase-small-subunit
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP018036.1|AZV85547.1|989666_990731_+|sulfate-ABC-transporter-ATP-binding-protein
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP018036.1|AZV85546.1|988859_989642_+|sulfate-ABC-transporter-permease-subunit-CysW
MFTEALRKGWQLYLAAIVEPDAWSAIRLTLLVAAIALPVNLVFGVAAAWAVTKFQFRGKQLLITLIDLPFSVSPVVAGMVFVLLFGSQGWFGPWLQDHDWKIVYAVPGVILATLFVTFPFIARELIPLMQAQGSEEEQAALTLGASGWQIFWRVTLPNIKWGLLYGAILCNARAMGEFGAVSVVSGQVRGLTNTMTLHVEILYNEYQFAAAFAVASLLALLALVTLAAKQVVEWRNQRLSPRQAEAPVHAGALAVRPAAA
>CP018036.1|AZV85545.1|988070_988745_+|sulfate-ABC-transporter-permease-subunit-CysT
MVASYRLTFGASLLAALVNLVFGTIVAWVLVRYRFPGKKIVDVLVDLPFALPTAVAGIALTALYSANGWLGAPLQRWFDLKVAFTPLGIVVALIFIGVPFVVRTVQPVLEDVERELEEAAASLGAGRWQTIRRVLLPALLPALLTGFALAFARAIGEYGSVVFIAGNMPMISEITPLLIISKLEQYDYAGAAAIATVMLALSFALLLVINLLQGWQTRRGGRQP
>CP018036.1|AZV85544.1|987839_988049_+|hypothetical-protein
MSLAIPSGPAPTAARRQRPGVLPGFGISMGYAVLYLSLLVLVLVLVLVLVLVPLAALPIKSLELGWAGF
>CP018036.1|AZV85543.1|986789_987824_+|sulfate-transporter-subunit
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP018036.1|AZV85551.1|997548_998235_+|coenzyme-A-pyrophosphatase
MRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP018036.1|AZV85552.1|998330_999200_-|IS481-family-transposase
MPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP018036.1|AZV85553.1|999385_1000435_+|aldo/keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP018036.1|AZV85554.1|1000572_1001589_-|IS110-family-transposase
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKQVHLCFGVLKNRIPYQPNYAMNG
>CP018036.1|AZV85555.1|1003097_1003670_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP018036.1|AZV85556.1|1003729_1004461_+|pseudouridylate-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP018036.1|AZV88068.1|1004512_1005430_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP018036.1|AZV85557.1|1006237_1009417_+|multidrug-efflux-RND-transporter-permease
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP018036.1|AZV85558.1|1010861_1011113_-|hypothetical-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA
>CP018036.1|AZV85559.1|1011258_1011873_-|SCO-family-protein
MYSPLSGRAWRGLLLAMLMLLAACSERSADWSLYNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQLGEQARDVRILFVSVDPHRDTPDILQAYVNEFNSNAIGVTGNEKQIADLARRYRVAYQIEKPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP018036_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP018036_4

3436507-3436616

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP018036_4

>merge|CP018036|4|3436507-3436616|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP018036|4|4|3436507-3436616|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP018036.1\|AZV87437.1\|3432153_3432954_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP018036.1\|AZV87447.1\|3443496_3444552_-\|cytochrome-oxidase	unknown	unknown	gnl\|CDD\|376764
CP018036.1\|AZV87436.1\|3431362_3432133_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP018036.1\|AZV87441.1\|3436617_3437010_-\|osmotically-inducible-protein-OsmC	unknown	unknown	gnl\|CDD\|224679
CP018036.1\|AZV87449.1\|3446004_3447768_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP018036.1\|AZV87445.1\|3441354_3442056_+\|two-component-system-response-regulator-OmpR	unknown	unknown	gnl\|CDD\|181883
CP018036.1\|AZV87435.1\|3430852_3431320_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP018036.1\|AZV87450.1\|3447879_3448758_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP018036.1\|AZV87432.1\|3427873_3428743_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP018036.1\|AZV87446.1\|3442055_3443480_+\|ATPase	unknown	unknown	gnl\|CDD\|236531
CP018036.1\|AZV87442.1\|3437147_3437828_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP018036.1\|AZV87430.1\|3426944_3427277_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235866
CP018036.1\|AZV87448.1\|3444548_3445889_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP018036.1\|AZV87431.1\|3427255_3427894_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235866
CP018036.1\|AZV87433.1\|3429486_3429807_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235000
CP018036.1\|AZV87444.1\|3438899_3439769_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP018036.1\|AZV87439.1\|3434468_3435254_+\|enoyl-[acyl-carrier-protein]-reductase	unknown	unknown	gnl\|CDD\|180789
CP018036.1\|AZV87434.1\|3429905_3430856_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP018036.1\|AZV87438.1\|3432964_3434374_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP018036.1\|AZV87443.1\|3437832_3438804_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296

Protein	Function_ID	Function_description	E-value
CP018036.1\|AZV87437.1\|3432153_3432954_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP018036.1\|AZV87447.1\|3443496_3444552_-\|cytochrome-oxidase	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	1.57809e-49
CP018036.1\|AZV87436.1\|3431362_3432133_-\|SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP018036.1\|AZV87441.1\|3436617_3437010_-\|osmotically-inducible-protein-OsmC	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP018036.1\|AZV87449.1\|3446004_3447768_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP018036.1\|AZV87445.1\|3441354_3442056_+\|two-component-system-response-regulator-OmpR	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP018036.1\|AZV87435.1\|3430852_3431320_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP018036.1\|AZV87450.1\|3447879_3448758_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP018036.1\|AZV87432.1\|3427873_3428743_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	3.82527e-23
CP018036.1\|AZV87446.1\|3442055_3443480_+\|ATPase	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP018036.1\|AZV87442.1\|3437147_3437828_+\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP018036.1\|AZV87430.1\|3426944_3427277_+\|hypothetical-protein	gnl\|CDD\|235866	PRK06816, PRK06816, StlD/DarB family beta-ketosynthase.	8.20524e-38
CP018036.1\|AZV87448.1\|3444548_3445889_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP018036.1\|AZV87431.1\|3427255_3427894_+\|hypothetical-protein	gnl\|CDD\|235866	PRK06816, PRK06816, StlD/DarB family beta-ketosynthase.	3.93772e-91
CP018036.1\|AZV87433.1\|3429486_3429807_+\|hypothetical-protein	gnl\|CDD\|235000	PRK02106, PRK02106, choline dehydrogenase; Validated.	5.7267e-45
CP018036.1\|AZV87444.1\|3438899_3439769_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	3.12672e-23
CP018036.1\|AZV87439.1\|3434468_3435254_+\|enoyl-[acyl-carrier-protein]-reductase	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP018036.1\|AZV87434.1\|3429905_3430856_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP018036.1\|AZV87438.1\|3432964_3434374_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP018036.1\|AZV87443.1\|3437832_3438804_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	2.71001e-129

>CP018036.1|AZV87439.1|3434468_3435254_+|enoyl-[acyl-carrier-protein]-reductase
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP018036.1|AZV87438.1|3432964_3434374_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP018036.1|AZV87437.1|3432153_3432954_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP018036.1|AZV87436.1|3431362_3432133_-|SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP018036.1|AZV87435.1|3430852_3431320_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP018036.1|AZV87434.1|3429905_3430856_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP018036.1|AZV87433.1|3429486_3429807_+|hypothetical-protein
MCATAVDTGMEFDYIIVGAGSAGCVLANRLSADPSVRVLLLEAGGADSWHWIHIPVGYLYCIGNPRTDWCYRTQADPGLNGRSLGYPRGRVLGGSSPINGIIYMRG
>CP018036.1|AZV87432.1|3427873_3428743_-|IS481-family-transposase
MPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP018036.1|AZV87431.1|3427255_3427894_+|hypothetical-protein
MPGFANMIQGELSAAPLETLSVHGICAAGVGAIQAAAQGIELGAHRRALAVASELPSRLFKRSRFAAPGYDAHFLRWMLSDGAGAMLLGDASQPLAGAANGVRLRLKWIHQRSFSGDYPVCMQLGQSAGGQAHLDYGSWSEAEAAGALLLRQDILLLPHLFDIGIHEYAKLVHDGWVDPRQVSHFLCHYSSEKFIPVVEDLMDKAGLAVNCQ
>CP018036.1|AZV87430.1|3426944_3427277_+|hypothetical-protein
MPVAFDRVYLHSAGYFMPGEPVDNDAMDQYIAPLNRISGRIKNRILAENGIRQRYYAIDPEGRTRWSNAQLAAQAIQACLARGATSTCHRSRCWPAARRAAIRSCPGSPT
>CP018036.1|AZV87441.1|3436617_3437010_-|osmotically-inducible-protein-OsmC
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP018036.1|AZV87442.1|3437147_3437828_+|hypothetical-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP018036.1|AZV87443.1|3437832_3438804_-|ABC-transporter-substrate-binding-protein
MKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP018036.1|AZV87444.1|3438899_3439769_-|IS481-family-transposase
MPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP018036.1|AZV87445.1|3441354_3442056_+|two-component-system-response-regulator-OmpR
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP018036.1|AZV87446.1|3442055_3443480_+|ATPase
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP018036.1|AZV87447.1|3443496_3444552_-|cytochrome-oxidase
MIATLAASLGLSPDDPSFWMPLVFVGLLLLLMAAGIVLDGFDIGVGLLLQLAPSEERGRMMGLLSPWRDANEFWPLLGLGLFVSAFPFAWGGVLGKLFGPLTVMALGMVLRSVSFEFRIRARTEIKPRWIFGFWVGSLLTALGQGMVLGRIATDYQADSGYGWFAFFVGLCVMAAYALLGACWLVMRVDGELQRRAAGWARHSIRWTAAGMVAIAVTLGLANAGIFYKWSNTAHLGVAAMVWALMLLGFVAAEMLLARLPGKADGFSWLPFVLCVMLFVLMLCGLAYSFFPYLILDDMTIWDGSGALDSMRLVLAGTVIGVPVVLVFNILAYRSVFGKERRPVPLLPPPGA
>CP018036.1|AZV87448.1|3444548_3445889_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP018036.1|AZV87449.1|3446004_3447768_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP018036.1|AZV87450.1|3447879_3448758_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 65102

Natrialba_phage(12.5%)

transposase,protease,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV84720.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZV84721.1\|1916_2609_+	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
AZV84722.1\|2605_3403_+	chromosome partitioning protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZV84723.1\|3409_4171_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV84724.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZV84725.1\|5124_5910_+	L-asparaginase	NA	NA	NA	NA
AZV84726.1\|5943_6126_+	hypothetical protein	NA	NA	NA	NA
AZV84727.1\|6721_7912_+	translation elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZV84728.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZV84729.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZV84730.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZV84731.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZV84732.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZV84733.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZV84734.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZV84735.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZV88003.1\|20126_20531_-	hypothetical protein	NA	NA	NA	NA
AZV84736.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZV84737.1\|21943_22894_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84738.1\|25400_26507_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZV88004.1\|27623_28334_+	hypothetical protein	NA	NA	NA	NA
AZV84739.1\|28330_29200_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84740.1\|29362_29662_-	hypothetical protein	NA	NA	NA	NA
AZV84741.1\|29722_30157_-	hypothetical protein	NA	NA	NA	NA
AZV88005.1\|30189_31407_-	thiolase	NA	NA	NA	NA
AZV84742.1\|31412_31910_-	dehydratase	NA	NA	NA	NA
AZV84743.1\|32117_33053_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV84744.1\|33262_34054_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV84745.1\|34096_35518_+	2-methylcitrate dehydratase	NA	NA	NA	NA
AZV84746.1\|35754_36624_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84747.1\|36620_37811_-	MFS transporter	NA	NA	NA	NA
AZV84748.1\|38060_38972_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZV84749.1\|38973_41112_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZV84750.1\|41108_41648_+	D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZV84751.1\|41651_42380_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZV84752.1\|42366_43260_+	hypothetical protein	NA	NA	NA	NA
AZV84753.1\|43330_43726_+	lactoylglutathione lyase	NA	NA	NA	NA
AZV84754.1\|43735_44266_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZV84755.1\|44394_44574_-	hypothetical protein	NA	NA	NA	NA
AZV88006.1\|46271_46796_+	hypothetical protein	NA	NA	NA	NA
AZV84756.1\|46767_47004_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZV84757.1\|47131_48025_+	hypothetical protein	NA	NA	NA	NA
AZV84758.1\|49194_50442_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZV84759.1\|50438_51053_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZV84760.1\|51269_52139_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84761.1\|52181_53438_+	muropeptide transporter AmpG	NA	NA	NA	NA
AZV84762.1\|54669_55404_-	glutamate racemase	NA	NA	NA	NA
AZV84763.1\|55409_56000_-	arginine transporter ATP-binding subunit	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZV84764.1\|56024_56714_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZV84765.1\|56710_57472_-	glutamate ABC transporter permease	NA	NA	NA	NA
AZV84766.1\|57551_58451_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV84767.1\|58544_59495_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84768.1\|60295_61522_-	serine kinase HipA	NA	NA	NA	NA
AZV84769.1\|61521_61941_-	transcriptional regulator	NA	NA	NA	NA
AZV88007.1\|62124_63066_-	hypothetical protein	NA	NA	NA	NA
AZV84770.1\|63489_64464_-	hypothetical protein	NA	NA	NA	NA
AZV84771.1\|64520_65102_-\|protease	protease	NA	NA	NA	NA

DBSCAN-SWA_2

70213 : 123119

Planktothrix_phage(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV84776.1\|70213_71083_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84777.1\|71176_71491_+\|transposase	transposase	NA	NA	NA	NA
AZV84778.1\|72683_74591_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AZV84779.1\|74752_75373_-	glutathione S-transferase	NA	NA	NA	NA
AZV84780.1\|75404_75986_-	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AZV84781.1\|76074_76326_-	hypothetical protein	NA	NA	NA	NA
AZV84782.1\|76327_77170_-	hypothetical protein	NA	NA	NA	NA
AZV84783.1\|77275_78685_+	signal recognition particle protein	NA	NA	NA	NA
AZV88009.1\|79705_80650_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84784.1\|80646_82521_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZV84785.1\|83868_84573_-	lipopolysaccharide biosynthesis protein	NA	NA	NA	NA
AZV84786.1\|84569_85676_-	glycosyl transferase	NA	NA	NA	NA
AZV84787.1\|85937_86531_-	sugar transferase	NA	NA	NA	NA
AZV84788.1\|86527_87715_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZV84789.1\|87777_89037_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZV84790.1\|89060_90149_-	UDP-N-acetylglucosamine 2-epimerase	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZV84791.1\|90156_91257_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZV84792.1\|91260_91836_-	N-acetyltransferase	NA	NA	NA	NA
AZV84793.1\|91839_92892_-	oxidoreductase	NA	NA	NA	NA
AZV84794.1\|93022_94030_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZV84795.1\|94031_95318_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZV84796.1\|95334_95490_-	hypothetical protein	NA	NA	NA	NA
AZV84797.1\|95514_96318_-	pantothenate kinase	NA	NA	NA	NA
AZV84798.1\|96314_97181_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZV84799.1\|97255_98386_+	ABC transporter permease	NA	NA	NA	NA
AZV84800.1\|98385_99225_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZV88010.1\|99378_99846_-	hypothetical protein	NA	NA	NA	NA
AZV84801.1\|99935_100157_+	hypothetical protein	NA	NA	NA	NA
AZV84802.1\|100157_100760_+	hypothetical protein	NA	NA	NA	NA
AZV84803.1\|100789_101443_+	alpha/beta hydrolase	NA	NA	NA	NA
AZV88011.1\|101653_102832_+	peptidase	B6DZZ7	Stx2-converting_phage	5.8e-66	40.5
AZV84804.1\|102912_103779_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZV84805.1\|103854_104130_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZV84806.1\|104137_104800_+	octanoyltransferase	NA	NA	NA	NA
AZV84807.1\|104861_105863_+	lipoyl synthase	NA	NA	NA	NA
AZV84808.1\|105877_106426_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZV84809.1\|106483_107380_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZV84810.1\|107376_108438_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZV84811.1\|108473_109343_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84812.1\|110323_111517_+	cystathionine beta-lyase	NA	NA	NA	NA
AZV84813.1\|111598_112228_-	thiol:disulfide interchange protein	NA	NA	NA	NA
AZV84814.1\|112289_112973_-	cell division protein	NA	NA	NA	NA
AZV84815.1\|112982_114665_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZV88012.1\|114952_115300_+	hypothetical protein	NA	NA	NA	NA
AZV84816.1\|115390_115708_+	hypothetical protein	NA	NA	NA	NA
AZV84817.1\|115990_117007_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV84818.1\|117082_117883_-	ABC transporter permease	NA	NA	NA	NA
AZV84819.1\|117879_118755_-	ABC transporter permease	NA	NA	NA	NA
AZV84820.1\|118765_120058_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV84821.1\|120100_121141_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZV84822.1\|121246_122068_-	phosphodiesterase	NA	NA	NA	NA
AZV84823.1\|122168_123119_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

165936 : 304055

116

Klosneuvirus(10.53%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV84857.1\|165936_166887_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84858.1\|168330_169233_-	hypothetical protein	NA	NA	NA	NA
AZV84859.1\|169210_169840_-	hypothetical protein	NA	NA	NA	NA
AZV84860.1\|170122_171553_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-44	29.8
AZV84861.1\|171586_172216_+	threonine transporter RhtB	NA	NA	NA	NA
AZV84862.1\|172264_173872_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZV84863.1\|173908_174580_+	hypothetical protein	NA	NA	NA	NA
AZV88015.1\|174661_175138_-	bacterioferritin	NA	NA	NA	NA
AZV84864.1\|175425_176295_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84865.1\|177410_177938_+	hypothetical protein	NA	NA	NA	NA
AZV84866.1\|178903_179638_+	sulfurtransferase	NA	NA	NA	NA
AZV84867.1\|179675_181754_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZV84868.1\|182003_182276_-	hypothetical protein	NA	NA	NA	NA
AZV84869.1\|182377_183463_+	ATP-binding protein	NA	NA	NA	NA
AZV84870.1\|183466_185371_+	hypothetical protein	NA	NA	NA	NA
AZV84871.1\|189100_189664_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZV84872.1\|189671_190094_-	glyoxalase	NA	NA	NA	NA
AZV84873.1\|190121_190541_-	glyoxalase	NA	NA	NA	NA
AZV84874.1\|190569_190917_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV88016.1\|191190_191640_+	hypothetical protein	NA	NA	NA	NA
AZV84875.1\|191793_194064_+	lysine decarboxylase	NA	NA	NA	NA
AZV84876.1\|194139_195345_+	hypothetical protein	NA	NA	NA	NA
AZV84877.1\|196495_197131_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.8e-83	73.8
AZV84878.1\|197127_198021_+	ZIP family metal transporter	NA	NA	NA	NA
AZV84879.1\|198415_199516_+	glycine cleavage system protein T	NA	NA	NA	NA
AZV84880.1\|199597_199972_+	glycine cleavage system protein H	NA	NA	NA	NA
AZV84881.1\|200030_202895_+	glycine dehydrogenase (aminomethyl-transferring)	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZV84882.1\|203039_203780_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZV84883.1\|203849_205061_+	formyl-CoA transferase	NA	NA	NA	NA
AZV84884.1\|205089_206058_+	hypothetical protein	NA	NA	NA	NA
AZV84885.1\|206752_207622_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84886.1\|207778_208102_+	PsiF repeat family protein	NA	NA	NA	NA
AZV88017.1\|208206_209247_-	cyclase	NA	NA	NA	NA
AZV84887.1\|209252_210032_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AZV84888.1\|210077_210374_-	hypothetical protein	NA	NA	NA	NA
AZV84889.1\|210399_210675_-	muconolactone delta-isomerase	NA	NA	NA	NA
AZV84890.1\|210731_211376_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZV84891.1\|211375_212062_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZV88018.1\|212260_213043_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZV84892.1\|213093_213819_-	short-chain dehydrogenase	NA	NA	NA	NA
AZV84893.1\|213850_215200_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZV84894.1\|215311_216244_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZV84895.1\|216701_219497_-	peptidase S8	NA	NA	NA	NA
AZV84896.1\|220090_222934_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZV84897.1\|223104_223824_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZV84898.1\|223862_224411_-	GNAT family N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZV84899.1\|224565_225465_+	virginiamycin B lyase	NA	NA	NA	NA
AZV84900.1\|225489_226440_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84901.1\|226658_227354_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZV84902.1\|227370_228783_+	hydroxyacid dehydrogenase	NA	NA	NA	NA
AZV84903.1\|228895_230326_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AZV84904.1\|230367_232281_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
AZV84905.1\|232599_233166_+	preprotein translocase subunit SecD	NA	NA	NA	NA
AZV84906.1\|233256_234258_+	restriction endonuclease	NA	NA	NA	NA
AZV84907.1\|234371_235322_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84908.1\|235408_236359_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84909.1\|236355_237306_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84910.1\|237404_238202_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZV84911.1\|239151_239562_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZV84912.1\|239811_240567_+	gamma-hydroxybutyrate dehydrogenase	D2K0C8	Staphylococcus_phage	4.6e-32	55.0
AZV84913.1\|240583_241327_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZV84914.1\|241370_242414_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV88019.1\|243427_244687_+	hypothetical protein	NA	NA	NA	NA
AZV84915.1\|246097_247054_+	hypothetical protein	NA	NA	NA	NA
AZV84916.1\|247072_247564_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZV84917.1\|247560_248916_-	poly(A) polymerase	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZV84918.1\|248916_249615_-	hypothetical protein	NA	NA	NA	NA
AZV84919.1\|249611_250313_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZV84920.1\|250565_251615_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZV84921.1\|251720_252662_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZV84922.1\|252658_254548_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZV88020.1\|254652_255273_+	hypothetical protein	NA	NA	NA	NA
AZV84923.1\|255415_256801_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.5e-17	30.3
AZV84924.1\|256731_257268_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZV84925.1\|257419_258811_+	fumarate hydratase, class II	NA	NA	NA	NA
AZV84926.1\|258827_259808_-	hypothetical protein	NA	NA	NA	NA
AZV84927.1\|259943_260927_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV84928.1\|260991_261891_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV84929.1\|261997_263752_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZV84930.1\|263759_264884_-	carnitine dehydratase	NA	NA	NA	NA
AZV84931.1\|264897_265878_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV84932.1\|266689_267559_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84933.1\|267573_267945_+	hypothetical protein	NA	NA	NA	NA
AZV84934.1\|268118_268664_+	ArsR family transcriptional regulator	NA	NA	NA	NA
AZV84935.1\|268789_270367_+	cytochrome d terminal oxidase subunit 1	NA	NA	NA	NA
AZV84936.1\|270382_271537_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AZV84937.1\|271550_271676_+	cyd operon protein YbgT	NA	NA	NA	NA
AZV84938.1\|271672_273424_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AZV84939.1\|273420_275100_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AZV84940.1\|275162_275711_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.3e-28	43.1
AZV84941.1\|276853_277132_+	hypothetical protein	NA	NA	NA	NA
AZV84942.1\|278175_279126_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84943.1\|279403_279565_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZV84944.1\|279572_279713_+	hypothetical protein	NA	NA	NA	NA
AZV84945.1\|280231_280681_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZV84946.1\|280690_281302_-	glutathione S-transferase	NA	NA	NA	NA
AZV88021.1\|281460_282309_-	cytochrome c1	NA	NA	NA	NA
AZV84947.1\|282334_283717_-	cytochrome b	NA	NA	NA	NA
AZV84948.1\|283781_284423_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZV84949.1\|284562_285021_+	large-conductance mechanosensitive channel protein	NA	NA	NA	NA
AZV84950.1\|285045_285822_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZV84951.1\|285875_287012_+	2-alkenal reductase	W5SAB9	Pithovirus	1.2e-07	31.2
AZV84952.1\|287008_287959_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV84953.1\|288057_288684_-	hypothetical protein	NA	NA	NA	NA
AZV84954.1\|288706_289633_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AZV84955.1\|289641_291228_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV84956.1\|291224_292229_-	acetylesterase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
AZV84957.1\|292428_293289_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZV84958.1\|293320_294322_-	hypothetical protein	NA	NA	NA	NA
AZV84959.1\|294392_295202_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZV84960.1\|295279_297139_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZV84961.1\|297267_298470_-	MFS transporter	NA	NA	NA	NA
AZV84962.1\|298583_299465_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV84963.1\|300967_301528_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
AZV84964.1\|302728_302989_-	hypothetical protein	NA	NA	NA	NA
AZV84965.1\|303104_304055_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

391888 : 449394

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85049.1\|391888_392839_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88027.1\|392981_393893_+	reductase	NA	NA	NA	NA
AZV85050.1\|393889_394138_+	NrdH-redoxin	NA	NA	NA	NA
AZV85051.1\|394134_395340_+	CoA transferase	NA	NA	NA	NA
AZV85052.1\|395412_396408_-	hypothetical protein	NA	NA	NA	NA
AZV85053.1\|396430_397651_-	acyl-CoA transferase	NA	NA	NA	NA
AZV85054.1\|397647_398292_-	hypothetical protein	NA	NA	NA	NA
AZV88028.1\|398288_398681_-	hypothetical protein	NA	NA	NA	NA
AZV85055.1\|398991_399981_+	hypothetical protein	NA	NA	NA	NA
AZV85056.1\|400021_400831_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZV85057.1\|401135_402089_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.6e-59	42.5
AZV85058.1\|402186_403170_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85059.1\|403846_404617_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZV85060.1\|404613_405792_-	carnitine dehydratase	NA	NA	NA	NA
AZV85061.1\|405959_407666_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZV85062.1\|407662_408559_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85063.1\|408599_410189_-	sulfurtransferase	NA	NA	NA	NA
AZV85064.1\|410238_411231_-	hypothetical protein	NA	NA	NA	NA
AZV85065.1\|411299_411899_-	hypothetical protein	NA	NA	NA	NA
AZV85066.1\|412359_413340_-	hypothetical protein	NA	NA	NA	NA
AZV85067.1\|413415_414285_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85068.1\|414454_415369_+	EamA family transporter	NA	NA	NA	NA
AZV85069.1\|415365_416025_+	hypothetical protein	NA	NA	NA	NA
AZV85070.1\|416114_417038_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AZV85071.1\|417043_417499_-	hypothetical protein	NA	NA	NA	NA
AZV85072.1\|417495_418599_-	hypothetical protein	NA	NA	NA	NA
AZV85073.1\|418786_420406_-	dolichyl-phosphate-mannose--protein mannosyltransferase	NA	NA	NA	NA
AZV85074.1\|420402_421461_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AZV85075.1\|421590_422085_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV85076.1\|422177_423155_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85077.1\|423350_424556_+	sodium/glutamate symporter	NA	NA	NA	NA
AZV85078.1\|424552_426064_+	TRAP ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV88029.1\|426079_427393_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZV85079.1\|427583_427763_-	hypothetical protein	NA	NA	NA	NA
AZV85080.1\|428172_428907_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AZV85081.1\|431431_432301_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85082.1\|432432_432831_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZV85083.1\|433241_433712_-	universal stress protein	NA	NA	NA	NA
AZV85084.1\|433800_434145_-	TIGR01244 family protein	NA	NA	NA	NA
AZV85085.1\|434244_435645_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZV85086.1\|437433_437952_-	methyltransferase	G3MA03	Bacillus_virus	2.1e-12	38.9
AZV85087.1\|438062_438818_+	hypothetical protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZV85088.1\|439013_440246_+	CoA transferase	NA	NA	NA	NA
AZV85089.1\|440238_441024_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV85090.1\|441090_442062_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85091.1\|442072_443050_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85092.1\|443175_444348_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV85093.1\|444374_445403_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV85094.1\|445468_446662_+	acetyl-CoA acetyltransferase	NA	NA	NA	NA
AZV85095.1\|448443_449394_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

637813 : 737924

106

uncultured_Caudovirales_phage(13.79%)

tail,terminase,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85257.1\|637813_638764_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85258.1\|638862_639663_-	hypothetical protein	NA	NA	NA	NA
AZV85259.1\|639724_640108_+	thiol reductase thioredoxin	NA	NA	NA	NA
AZV85260.1\|640119_641553_-	ATP-dependent RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZV85261.1\|641759_642089_-	hypothetical protein	NA	NA	NA	NA
AZV85262.1\|642091_642841_-	hypothetical protein	NA	NA	NA	NA
AZV85263.1\|643023_643944_+	branched chain amino acid aminotransferase	NA	NA	NA	NA
AZV85264.1\|643990_644203_+	hypothetical protein	NA	NA	NA	NA
AZV85265.1\|644225_644648_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AZV85266.1\|644664_645765_+	alpha/beta hydrolase	NA	NA	NA	NA
AZV85267.1\|645861_647379_-	peptidase	NA	NA	NA	NA
AZV85268.1\|647454_648294_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZV88039.1\|648315_649188_-	hypothetical protein	NA	NA	NA	NA
AZV85269.1\|649278_650373_-	porin	NA	NA	NA	NA
AZV85270.1\|650666_651536_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88040.1\|651691_652633_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85271.1\|652716_653076_-	hypothetical protein	NA	NA	NA	NA
AZV85272.1\|653457_654495_-	hypothetical protein	NA	NA	NA	NA
AZV85273.1\|654811_656152_+	Xaa-Pro aminopeptidase	NA	NA	NA	NA
AZV85274.1\|656161_656614_-	hypothetical protein	NA	NA	NA	NA
AZV85275.1\|656719_657892_+	monooxygenase	NA	NA	NA	NA
AZV88041.1\|657957_658983_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZV85276.1\|659023_659263_+	Fis family transcriptional regulator	NA	NA	NA	NA
AZV85277.1\|659332_660922_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZV85278.1\|660921_661470_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZV85279.1\|661550_662123_+	Holliday junction DNA helicase RuvA	NA	NA	NA	NA
AZV85280.1\|662141_663053_-	NAD-dependent dehydratase	NA	NA	NA	NA
AZV85281.1\|663126_664095_-	serine dehydratase	NA	NA	NA	NA
AZV85282.1\|664217_665291_+	Holliday junction DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZV85283.1\|665295_667116_-	ATP-dependent DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZV85284.1\|668230_668566_+	hypothetical protein	NA	NA	NA	NA
AZV85285.1\|668699_669350_+	carbonate dehydratase	NA	NA	NA	NA
AZV88042.1\|669371_670790_-	amidase	NA	NA	NA	NA
AZV85286.1\|670859_671615_-	hypothetical protein	NA	NA	NA	NA
AZV88043.1\|671583_672342_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV85287.1\|672352_673234_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV85288.1\|673250_673958_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AZV85289.1\|673960_674719_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AZV85290.1\|674928_676671_+	sulfite reductase	NA	NA	NA	NA
AZV85291.1\|676663_677188_+	hypothetical protein	NA	NA	NA	NA
AZV85292.1\|677227_678022_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85293.1\|678189_679263_+	hypothetical protein	NA	NA	NA	NA
AZV85294.1\|679361_680312_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85295.1\|680563_680770_-	hypothetical protein	NA	NA	NA	NA
AZV88044.1\|680841_681453_-	LexA family transcriptional repressor	NA	NA	NA	NA
AZV85296.1\|681932_682253_-	hypothetical protein	NA	NA	NA	NA
AZV85297.1\|682245_682944_-	hypothetical protein	NA	NA	NA	NA
AZV85298.1\|682958_683180_-	hypothetical protein	NA	NA	NA	NA
AZV85299.1\|683197_684148_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85300.1\|684787_685273_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	7.3e-39	61.5
AZV85301.1\|685259_686537_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZV85302.1\|686539_687958_+	hypothetical protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZV85303.1\|687929_689042_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.1e-102	49.7
AZV85304.1\|689047_689290_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZV85305.1\|689412_690015_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZV85306.1\|690443_691394_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85307.1\|692068_692320_+	hypothetical protein	NA	NA	NA	NA
AZV85308.1\|692382_692865_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZV85309.1\|692866_693067_+	hypothetical protein	NA	NA	NA	NA
AZV85310.1\|693066_693462_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZV85311.1\|693458_693857_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZV85312.1\|693853_694276_+	hypothetical protein	NA	NA	NA	NA
AZV85313.1\|694283_694784_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZV85314.1\|695038_695557_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZV85315.1\|695566_695896_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZV85316.1\|695913_696204_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZV85317.1\|696229_698842_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AZV85318.1\|698851_699211_+	hypothetical protein	NA	NA	NA	NA
AZV85319.1\|699278_699812_+	hypothetical protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZV85320.1\|699808_700198_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZV85321.1\|700190_704147_+	hypothetical protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZV85322.1\|704151_704568_+	hypothetical protein	NA	NA	NA	NA
AZV85323.1\|704786_705050_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AZV85324.1\|705049_705862_+	hypothetical protein	NA	NA	NA	NA
AZV85325.1\|705866_706109_+	hypothetical protein	NA	NA	NA	NA
AZV85326.1\|706087_706639_+	lysozyme	NA	NA	NA	NA
AZV85327.1\|706638_707154_+	hypothetical protein	NA	NA	NA	NA
AZV88045.1\|707150_707432_-	hypothetical protein	NA	NA	NA	NA
AZV85328.1\|707431_707653_-	hypothetical protein	NA	NA	NA	NA
AZV85329.1\|707981_708653_-	hypothetical protein	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZV85330.1\|708580_708949_-	hypothetical protein	NA	NA	NA	NA
AZV88046.1\|709008_709695_-	DNA-binding response regulator	NA	NA	NA	NA
AZV85331.1\|709675_710248_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZV85332.1\|710313_712044_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AZV85333.1\|712096_712525_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AZV85334.1\|712527_713208_+	protein TolQ	NA	NA	NA	NA
AZV85335.1\|713207_713666_+	protein TolR	NA	NA	NA	NA
AZV85336.1\|714692_716009_+	Tol-Pal system beta propeller repeat protein TolB	NA	NA	NA	NA
AZV85337.1\|716040_716538_+	peptidoglycan-associated lipoprotein	NA	NA	NA	NA
AZV85338.1\|716624_717314_+	tol-pal system protein YbgF	NA	NA	NA	NA
AZV85339.1\|717313_718363_+	iron-siderophore ABC transporter permease	NA	NA	NA	NA
AZV85340.1\|718359_719154_+	iron ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AZV85341.1\|719322_719673_+	hypothetical protein	NA	NA	NA	NA
AZV85342.1\|719648_720206_+	hypothetical protein	NA	NA	NA	NA
AZV85343.1\|721335_722286_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85344.1\|724423_725653_+	hypothetical protein	NA	NA	NA	NA
AZV85345.1\|725655_727098_-	pyruvate kinase	NA	NA	NA	NA
AZV85346.1\|727202_728348_+	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	42.2
AZV85347.1\|728379_729177_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase	NA	NA	NA	NA
AZV85348.1\|729201_730761_-	molecular chaperone SurA	NA	NA	NA	NA
AZV88047.1\|730757_733124_-	LPS biosynthesis protein	NA	NA	NA	NA
AZV88048.1\|733302_734343_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
AZV85349.1\|734342_735035_+	mannose-1-phosphate guanylyltransferase	NA	NA	NA	NA
AZV85350.1\|735178_735880_+	hypothetical protein	NA	NA	NA	NA
AZV85351.1\|735864_736242_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
AZV85352.1\|736973_737924_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

860810 : 914939

Vibrio_phage(25.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85447.1\|860810_862769_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AZV85448.1\|862851_863802_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85449.1\|864022_864691_+	transcriptional regulator	NA	NA	NA	NA
AZV85450.1\|864814_865921_+	efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZV85451.1\|865933_869047_+	multidrug efflux protein	S5VTK5	Leptospira_phage	4.5e-57	21.5
AZV85452.1\|869043_870537_+	RND transporter	NA	NA	NA	NA
AZV85453.1\|870551_871223_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZV88057.1\|871266_871719_-	azurin	NA	NA	NA	NA
AZV85454.1\|871901_872549_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZV88058.1\|872652_874701_+	hydantoinase	NA	NA	NA	NA
AZV85455.1\|874697_876710_+	hydantoin utilization protein B	NA	NA	NA	NA
AZV88059.1\|876735_878070_+	hypothetical protein	NA	NA	NA	NA
AZV85456.1\|878178_879171_+	hypothetical protein	NA	NA	NA	NA
AZV85457.1\|879237_881322_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZV85458.1\|881346_882318_-	hypothetical protein	NA	NA	NA	NA
AZV85459.1\|882446_883448_-	peptidase M14	NA	NA	NA	NA
AZV85460.1\|883481_884633_-	cystathionine beta-lyase	NA	NA	NA	NA
AZV85461.1\|884836_885727_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85462.1\|885804_886629_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZV85463.1\|886825_887842_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV85464.1\|888038_889022_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV88060.1\|889080_890208_-	argininosuccinate lyase	NA	NA	NA	NA
AZV85465.1\|890198_890573_-	hypothetical protein	NA	NA	NA	NA
AZV85466.1\|890620_892009_-	hypothetical protein	NA	NA	NA	NA
AZV85467.1\|892039_893029_-	hypothetical protein	NA	NA	NA	NA
AZV85468.1\|894652_895453_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZV85469.1\|895475_897707_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZV85470.1\|898494_898941_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZV85471.1\|898962_899709_-	triose-phosphate isomerase	NA	NA	NA	NA
AZV85472.1\|899852_900830_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZV85473.1\|901463_902075_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZV85474.1\|902068_903286_-	threonine ammonia-lyase	NA	NA	NA	NA
AZV85475.1\|903425_904376_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85476.1\|904372_905092_-	hypothetical protein	NA	NA	NA	NA
AZV85477.1\|905212_907372_-	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
AZV85478.1\|907462_907732_-	30S ribosomal protein S15	NA	NA	NA	NA
AZV85479.1\|908025_908553_+	hypothetical protein	NA	NA	NA	NA
AZV85480.1\|908571_909351_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
AZV85481.1\|909518_910535_-	ketol-acid reductoisomerase	NA	NA	NA	NA
AZV85482.1\|910607_911099_-	acetolactate synthase small subunit	NA	NA	NA	NA
AZV85483.1\|911109_912825_-	acetolactate synthase, large subunit, biosynthetic type	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	3.1e-60	30.3
AZV85484.1\|913301_913907_+	hypothetical protein	NA	NA	NA	NA
AZV85485.1\|913988_914939_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

953847 : 1027308

Bacillus_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85518.1\|953847_954798_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85519.1\|954794_955769_-	hypothetical protein	NA	NA	NA	NA
AZV88062.1\|955914_956805_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.3e-05	27.6
AZV88063.1\|957081_957474_-	hypothetical protein	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZV85520.1\|957603_958554_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85521.1\|958583_958766_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZV85522.1\|959538_960720_-	MFS transporter	NA	NA	NA	NA
AZV85523.1\|960934_961612_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZV85524.1\|961608_962334_-	bifunctional 3-demethylubiquinol 3-O-methyltransferase/2-polyprenyl-6-hydroxyphenol methylase	NA	NA	NA	NA
AZV85525.1\|962459_963041_-	hypothetical protein	NA	NA	NA	NA
AZV85526.1\|963411_966093_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZV88064.1\|966095_967226_+	phosphoserine transaminase	M1Q1P2	Streptococcus_phage	4.9e-78	44.0
AZV85527.1\|967218_968304_+	chorismate mutase	NA	NA	NA	NA
AZV85528.1\|968390_969290_+	prephenate dehydrogenase	NA	NA	NA	NA
AZV85529.1\|969286_970615_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZV85530.1\|970629_971301_+	cytidylate kinase	NA	NA	NA	NA
AZV85531.1\|971488_973204_+	30S ribosomal protein S1	NA	NA	NA	NA
AZV85532.1\|973205_973565_+	integration host factor subunit beta	NA	NA	NA	NA
AZV85533.1\|973756_974071_+	hypothetical protein	NA	NA	NA	NA
AZV85534.1\|974113_975334_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZV85535.1\|975330_976272_+	hypothetical protein	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZV85536.1\|976268_977258_+	ADP-glyceromanno-heptose 6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZV88065.1\|977547_977877_+	hypothetical protein	NA	NA	NA	NA
AZV85537.1\|979005_979917_+	cysteine synthase B	A0A1X9I5K7	Streptococcus_phage	8.0e-47	38.8
AZV85538.1\|979977_981123_-	lytic murein transglycosylase B	NA	NA	NA	NA
AZV85539.1\|981142_982057_+	deacetylase	A0A2K9KZC4	Tupanvirus	9.8e-45	34.7
AZV85540.1\|982128_982878_+	electron transporter RnfB	NA	NA	NA	NA
AZV85541.1\|984049_985876_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV85542.1\|985958_986600_+	peroxidase	NA	NA	NA	NA
AZV85543.1\|986789_987824_+	sulfate transporter subunit	NA	NA	NA	NA
AZV85544.1\|987839_988049_+	hypothetical protein	NA	NA	NA	NA
AZV85545.1\|988070_988745_+	sulfate ABC transporter permease subunit CysT	NA	NA	NA	NA
AZV85546.1\|988859_989642_+	sulfate ABC transporter permease subunit CysW	NA	NA	NA	NA
AZV85547.1\|989666_990731_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-24	30.3
AZV88066.1\|991528_992437_+	sulfate adenylyltransferase small subunit	NA	NA	NA	NA
AZV88067.1\|993924_995199_+	radical SAM protein	NA	NA	NA	NA
AZV85548.1\|995352_995733_+	hypothetical protein	NA	NA	NA	NA
AZV85549.1\|995740_996613_-	multidrug DMT transporter permease	NA	NA	NA	NA
AZV85550.1\|996918_997299_+	50S ribosomal protein L19	NA	NA	NA	NA
AZV85551.1\|997548_998235_+	coenzyme A pyrophosphatase	NA	NA	NA	NA
AZV85552.1\|998330_999200_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85553.1\|999385_1000435_+	aldo/keto reductase	NA	NA	NA	NA
AZV85554.1\|1000572_1001589_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV85555.1\|1003097_1003670_-	chorismate--pyruvate lyase	NA	NA	NA	NA
AZV85556.1\|1003729_1004461_+	pseudouridylate synthase	NA	NA	NA	NA
AZV88068.1\|1004512_1005430_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85557.1\|1006237_1009417_+	multidrug efflux RND transporter permease	NA	NA	NA	NA
AZV85558.1\|1010861_1011113_-	hypothetical protein	NA	NA	NA	NA
AZV85559.1\|1011258_1011873_-	SCO family protein	NA	NA	NA	NA
AZV85560.1\|1012059_1014120_-	oligopeptidase A	NA	NA	NA	NA
AZV85561.1\|1014249_1015101_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
AZV85562.1\|1015097_1015724_-	DNA-binding response regulator	NA	NA	NA	NA
AZV85563.1\|1015720_1017475_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
AZV85564.1\|1017767_1020473_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AZV85565.1\|1020485_1022147_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
AZV85566.1\|1022159_1023950_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
AZV85567.1\|1024171_1025347_-	flagellin	NA	NA	NA	NA
AZV85568.1\|1025389_1026259_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85569.1\|1026438_1027308_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1048340 : 1099001

uncultured_Mediterranean_phage(50.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85587.1\|1048340_1049291_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85588.1\|1049589_1050327_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AZV85589.1\|1050762_1051086_+	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AZV85590.1\|1051120_1051681_+	transcriptional regulator FlhC	NA	NA	NA	NA
AZV85591.1\|1051801_1052677_+	flagellar motor stator protein MotA	NA	NA	NA	NA
AZV85592.1\|1052689_1053637_+	flagellar motor protein MotB	NA	NA	NA	NA
AZV85593.1\|1053738_1054032_+	two-component system response regulator	NA	NA	NA	NA
AZV85594.1\|1054058_1056116_+	chemotaxis protein CheA	NA	NA	NA	NA
AZV85595.1\|1056130_1056631_+	chemotaxis protein CheW	NA	NA	NA	NA
AZV85596.1\|1056704_1058411_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AZV85597.1\|1059274_1060327_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AZV85598.1\|1060379_1060769_+	two-component system response regulator	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AZV85599.1\|1060777_1061410_+	protein phosphatase CheZ	NA	NA	NA	NA
AZV85600.1\|1061509_1062526_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV88071.1\|1063356_1064364_+	aldo/keto reductase	NA	NA	NA	NA
AZV85601.1\|1064360_1066004_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AZV85602.1\|1066000_1066888_-	magnesium/cobalt efflux protein	NA	NA	NA	NA
AZV85603.1\|1067028_1067502_-	rRNA maturation RNase YbeY	NA	NA	NA	NA
AZV85604.1\|1067491_1068514_-	phosphate starvation-inducible protein PhoH	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
AZV85605.1\|1068510_1069938_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZV85606.1\|1070875_1071892_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV85607.1\|1072224_1073160_-	protein-export membrane protein SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AZV85608.1\|1073209_1075090_-	protein-export membrane protein SecD	NA	NA	NA	NA
AZV85609.1\|1075156_1075501_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AZV85610.1\|1075645_1076782_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZV85611.1\|1076778_1077852_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
AZV85612.1\|1078009_1079446_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZV88072.1\|1079536_1080178_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZV85613.1\|1080513_1081530_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV85614.1\|1083470_1084421_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88073.1\|1085724_1087146_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AZV88074.1\|1087412_1088126_+	hypothetical protein	NA	NA	NA	NA
AZV85615.1\|1088210_1088528_+	hypothetical protein	NA	NA	NA	NA
AZV85616.1\|1088568_1088982_+	hypothetical protein	NA	NA	NA	NA
AZV85617.1\|1088983_1089343_+	hypothetical protein	NA	NA	NA	NA
AZV85618.1\|1089385_1090930_-	3-octaprenyl-4-hydroxybenzoate decarboxylase	NA	NA	NA	NA
AZV85619.1\|1091013_1091844_+	lytic transglycosylase	NA	NA	NA	NA
AZV85620.1\|1091878_1093033_-	aminotransferase	NA	NA	NA	NA
AZV85621.1\|1093075_1093948_+	hypothetical protein	NA	NA	NA	NA
AZV85622.1\|1094064_1096353_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZV85623.1\|1097559_1098024_+	barstar family protein 2	NA	NA	NA	NA
AZV85624.1\|1098050_1099001_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1382370 : 1448869

uncultured_Caudovirales_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85834.1\|1382370_1383321_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85835.1\|1383386_1383566_-	hypothetical protein	NA	NA	NA	NA
AZV85836.1\|1383682_1384438_-	alpha/beta hydrolase	NA	NA	NA	NA
AZV85837.1\|1384424_1385570_-	hypothetical protein	NA	NA	NA	NA
AZV85838.1\|1386477_1387428_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85839.1\|1387418_1387619_-	hypothetical protein	NA	NA	NA	NA
AZV85840.1\|1387615_1388818_-	cardiolipin synthase B	NA	NA	NA	NA
AZV85841.1\|1388814_1389573_-	hypothetical protein	NA	NA	NA	NA
AZV85842.1\|1389966_1390599_+	PadR family transcriptional regulator	NA	NA	NA	NA
AZV85843.1\|1391554_1394155_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZV85844.1\|1394142_1397562_-	nuclease	NA	NA	NA	NA
AZV85845.1\|1397569_1398475_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85846.1\|1398613_1399192_+	NADPH-dependent FMN reductase	NA	NA	NA	NA
AZV85847.1\|1399188_1400100_+	CoA ester lyase	NA	NA	NA	NA
AZV88097.1\|1400113_1400794_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZV85848.1\|1400995_1403035_+	acetyl-CoA synthetase	NA	NA	NA	NA
AZV85849.1\|1403053_1404040_+	hypothetical protein	NA	NA	NA	NA
AZV85850.1\|1404065_1404863_+	citryl-CoA lyase	NA	NA	NA	NA
AZV85851.1\|1404859_1406053_+	CoA transferase	NA	NA	NA	NA
AZV85852.1\|1406049_1407012_+	hypothetical protein	NA	NA	NA	NA
AZV85853.1\|1407029_1408070_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZV85854.1\|1408057_1408666_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZV85855.1\|1410254_1411250_+	hypothetical protein	NA	NA	NA	NA
AZV85856.1\|1411269_1412448_+	mandelate racemase	NA	NA	NA	NA
AZV85857.1\|1412458_1413376_+	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AZV85858.1\|1413431_1414382_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85859.1\|1414480_1415251_-	ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-30	39.1
AZV85860.1\|1415247_1415928_-	cysteine ABC transporter permease	NA	NA	NA	NA
AZV85861.1\|1415994_1416783_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85862.1\|1417029_1418046_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV85863.1\|1418351_1419506_+	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
AZV85864.1\|1424011_1424494_-	flagellar protein FlgN	NA	NA	NA	NA
AZV85865.1\|1424511_1424802_-	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
AZV85866.1\|1425821_1426229_+	flagellar basal body rod protein FlgB	NA	NA	NA	NA
AZV85867.1\|1426241_1426661_+	flagellar basal body rod protein FlgC	NA	NA	NA	NA
AZV85868.1\|1426708_1427413_+	flagellar basal body rod modification protein	NA	NA	NA	NA
AZV85869.1\|1427478_1428900_+	flagellar hook protein FlgE	NA	NA	NA	NA
AZV85870.1\|1428938_1429703_+	flagellar biosynthesis protein FlgF	NA	NA	NA	NA
AZV85871.1\|1429746_1430532_+	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
AZV85872.1\|1430531_1431221_+	flagellar basal body L-ring protein	NA	NA	NA	NA
AZV85873.1\|1431223_1432357_+	flagellar biosynthesis protein FlgI	NA	NA	NA	NA
AZV85874.1\|1432374_1433397_+	flagellar rod assembly protein/muramidase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.9e-12	31.4
AZV85875.1\|1433466_1435113_+	flagellar hook-associated protein FlgK	NA	NA	NA	NA
AZV85876.1\|1435146_1436679_+	flagellar hook-associated protein 3	NA	NA	NA	NA
AZV85877.1\|1436757_1438578_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-11	52.6
AZV85878.1\|1438698_1440318_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	45.3
AZV85879.1\|1440496_1441939_+	chemotaxis protein	A0A1B0V854	Salmonella_phage	1.0e-35	41.8
AZV85880.1\|1442155_1443172_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV85881.1\|1443218_1444007_-	flagellar biosynthetic protein FliR	NA	NA	NA	NA
AZV85882.1\|1444029_1444299_-	EscS/YscS/HrcS family type III secretion system export apparatus protein	NA	NA	NA	NA
AZV88098.1\|1444315_1445050_-	flagellar biosynthetic protein FliP	NA	NA	NA	NA
AZV85883.1\|1445118_1445460_-	flagellar biosynthetic protein FliO	NA	NA	NA	NA
AZV85884.1\|1445470_1445971_-	flagellar motor switch protein FliN	NA	NA	NA	NA
AZV85885.1\|1445963_1446974_-	flagellar motor switch protein FliM	NA	NA	NA	NA
AZV85886.1\|1446976_1447549_-	flagellar basal body protein FliL	NA	NA	NA	NA
AZV85887.1\|1447690_1447903_-	hypothetical protein	NA	NA	NA	NA
AZV88099.1\|1447918_1448869_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1491146 : 1616112

112

Planktothrix_phage(19.05%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV85926.1\|1491146_1492097_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85927.1\|1492214_1493141_+	paraslipin	NA	NA	NA	NA
AZV85928.1\|1493206_1494364_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AZV85929.1\|1494344_1494812_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AZV85930.1\|1494959_1495910_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85931.1\|1495926_1496361_+	ubiquinone-binding protein	NA	NA	NA	NA
AZV85932.1\|1496350_1496701_+	RnfH family protein	NA	NA	NA	NA
AZV85933.1\|1496897_1498052_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV85934.1\|1498048_1499221_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV85935.1\|1499268_1500162_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AZV85936.1\|1500207_1500645_+	thioesterase	NA	NA	NA	NA
AZV85937.1\|1500704_1501394_+	hypothetical protein	NA	NA	NA	NA
AZV85938.1\|1502450_1503401_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85939.1\|1503499_1504462_-	transaldolase	H6WFR1	Cyanophage	7.5e-11	29.2
AZV85940.1\|1504688_1505843_+	carbamoyl phosphate synthase small subunit	R4TGJ8	Halovirus	3.3e-53	35.4
AZV85941.1\|1505853_1509096_+	carbamoyl phosphate synthase large subunit	NA	NA	NA	NA
AZV85942.1\|1510117_1510762_-	histidine phosphatase family protein	NA	NA	NA	NA
AZV85943.1\|1510772_1511672_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85944.1\|1511719_1512805_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-27	37.7
AZV85945.1\|1512801_1514496_-	ABC transporter permease	NA	NA	NA	NA
AZV85946.1\|1514674_1515625_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85947.1\|1515766_1516069_+	hypothetical protein	NA	NA	NA	NA
AZV85948.1\|1517177_1518239_+	chorismate synthase	A0A291AU41	Pandoravirus	2.9e-80	42.8
AZV85949.1\|1518272_1519109_+	peptidase M48	NA	NA	NA	NA
AZV85950.1\|1519118_1519661_-	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
AZV85951.1\|1519674_1520967_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZV85952.1\|1520963_1521557_-	molybdenum cofactor guanylyltransferase MobA	NA	NA	NA	NA
AZV85953.1\|1521709_1522807_+	MRP family ATP-binding protein	NA	NA	NA	NA
AZV85954.1\|1522813_1523374_+	hypothetical protein	NA	NA	NA	NA
AZV85955.1\|1523370_1524051_+	hypothetical protein	NA	NA	NA	NA
AZV88103.1\|1524107_1526165_+	4Fe-4S ferredoxin	NA	NA	NA	NA
AZV85956.1\|1526161_1526791_+	hypothetical protein	NA	NA	NA	NA
AZV85957.1\|1526942_1527152_+	formate dehydrogenase	NA	NA	NA	NA
AZV85958.1\|1527166_1530136_+	formate dehydrogenase	NA	NA	NA	NA
AZV85959.1\|1530770_1531004_+	hypothetical protein	NA	NA	NA	NA
AZV85960.1\|1531016_1532174_+	formate dehydrogenase subunit gamma	NA	NA	NA	NA
AZV85961.1\|1532196_1532571_+	hypothetical protein	NA	NA	NA	NA
AZV85962.1\|1532604_1533720_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV85963.1\|1534619_1535324_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-13	30.0
AZV85964.1\|1535320_1536139_+	tungsten ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85965.1\|1536422_1537826_+	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AZV88104.1\|1537840_1538491_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZV85966.1\|1538572_1539649_+	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AZV85967.1\|1539835_1540966_+	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZV85968.1\|1541136_1542720_+	peptidoglycan-binding protein LysM	NA	NA	NA	NA
AZV85969.1\|1542723_1543536_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AZV85970.1\|1543680_1544775_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85971.1\|1544986_1545616_+	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85972.1\|1547298_1547955_+	N-(5'-phosphoribosyl)anthranilate isomerase	NA	NA	NA	NA
AZV85973.1\|1548515_1549385_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85974.1\|1549411_1550185_+	peroxide stress protein YaaA	NA	NA	NA	NA
AZV85975.1\|1550196_1551438_+	hypothetical protein	NA	NA	NA	NA
AZV85976.1\|1553300_1554170_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85977.1\|1554201_1555299_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.5e-20	37.3
AZV85978.1\|1555295_1556246_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85979.1\|1556238_1556670_+	hypothetical protein	NA	NA	NA	NA
AZV85980.1\|1556666_1557059_-	hypothetical protein	NA	NA	NA	NA
AZV85981.1\|1557064_1557841_-	DNA-binding response regulator	NA	NA	NA	NA
AZV85982.1\|1558228_1560178_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.1e-125	36.0
AZV85983.1\|1560198_1560744_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.1e-14	29.9
AZV85984.1\|1561846_1562245_+	PTS mannose transporter subunit IIA	NA	NA	NA	NA
AZV85985.1\|1562360_1562630_+	phosphocarrier protein HPr	NA	NA	NA	NA
AZV85986.1\|1562751_1564446_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AZV85987.1\|1564610_1564835_-	hypothetical protein	NA	NA	NA	NA
AZV85988.1\|1565433_1566384_+	ornithine cyclodeaminase	NA	NA	NA	NA
AZV85989.1\|1566425_1567586_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV85990.1\|1567746_1568667_+	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
AZV85991.1\|1568679_1569321_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
AZV85992.1\|1569317_1569989_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
AZV85993.1\|1569985_1570756_+	ectoine/hydroxyectoine ABC transporter ATP-binding protein EhuA	G9BWD6	Planktothrix_phage	8.3e-29	39.5
AZV85994.1\|1570854_1571805_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV85995.1\|1572021_1572426_-	aldehyde-activating protein	NA	NA	NA	NA
AZV85996.1\|1572499_1573690_-	formate dehydrogenase	NA	NA	NA	NA
AZV85997.1\|1573723_1574050_-	hypothetical protein	NA	NA	NA	NA
AZV85998.1\|1574072_1574588_-	transporter	NA	NA	NA	NA
AZV85999.1\|1574646_1575873_-	formamidase	A0A1V0S8X7	Catovirus	5.2e-134	58.8
AZV86000.1\|1576050_1577181_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZV86001.1\|1577415_1577997_+	MOSC domain-containing protein	NA	NA	NA	NA
AZV86002.1\|1578133_1579198_+	fructose-1,6-bisphosphate aldolase	NA	NA	NA	NA
AZV86003.1\|1579282_1579729_-	aldehyde-activating protein	NA	NA	NA	NA
AZV86004.1\|1579953_1580835_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.8e-51	36.1
AZV86005.1\|1580889_1581141_+	mRNA interferase MqsR	NA	NA	NA	NA
AZV86006.1\|1581143_1581545_+	antitoxin	NA	NA	NA	NA
AZV86007.1\|1581808_1582288_+	disulfide bond formation protein DsbB	NA	NA	NA	NA
AZV86008.1\|1582437_1582953_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	7.0e-16	42.6
AZV86009.1\|1582955_1584146_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AZV86010.1\|1584165_1585203_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	3.6e-35	37.8
AZV86011.1\|1585339_1586362_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.6e-67	40.7
AZV86012.1\|1586453_1587290_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZV86013.1\|1587482_1588388_+	agmatinase	NA	NA	NA	NA
AZV86014.1\|1588414_1589206_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV86015.1\|1589228_1589921_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZV86016.1\|1589942_1590695_+	glutamine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-29	39.7
AZV86017.1\|1590823_1592383_+	acetolactate synthase large subunit	NA	NA	NA	NA
AZV88105.1\|1592516_1592960_+	acyl dehydratase	NA	NA	NA	NA
AZV86018.1\|1593097_1594291_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV86019.1\|1594370_1596065_-	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	3.8e-26	24.5
AZV86020.1\|1596222_1597110_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.4e-18	28.7
AZV86021.1\|1597147_1598080_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.3e-25	29.5
AZV86022.1\|1598093_1598582_+\|tRNA	aminoacyl-tRNA deacylase	NA	NA	NA	NA
AZV86023.1\|1598699_1599278_+\|protease	protease	NA	NA	NA	NA
AZV86024.1\|1599383_1599752_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AZV86025.1\|1599849_1600800_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86026.1\|1600806_1601919_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
AZV86027.1\|1602605_1603808_+	MFS transporter	NA	NA	NA	NA
AZV86028.1\|1604011_1606672_+	hypothetical protein	NA	NA	NA	NA
AZV86029.1\|1606684_1610089_+	nuclease	NA	NA	NA	NA
AZV88106.1\|1610891_1612982_+	DNA polymerase III, subunit gamma and tau	A0A1U9WR94	Streptococcus_virus	1.1e-43	38.5
AZV86030.1\|1613028_1613355_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
AZV86031.1\|1613405_1614014_+	recombination protein RecR	NA	NA	NA	NA
AZV86032.1\|1614112_1615063_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86033.1\|1615161_1616112_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1657050 : 1728122

Ectocarpus_siliculosus_virus(11.11%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV86067.1\|1657050_1658001_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86068.1\|1658022_1659243_+	YggW family oxidoreductase	NA	NA	NA	NA
AZV86069.1\|1659428_1660841_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZV86070.1\|1660904_1661972_+	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZV86071.1\|1661971_1663459_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZV88111.1\|1663468_1664413_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV86072.1\|1664572_1665271_+	quercetin 2,3-dioxygenase	NA	NA	NA	NA
AZV86073.1\|1665348_1666254_+	hypothetical protein	NA	NA	NA	NA
AZV86074.1\|1666273_1667143_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86075.1\|1667322_1668117_-	ABC transporter	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AZV86076.1\|1668121_1669792_-	iron ABC transporter permease	NA	NA	NA	NA
AZV86077.1\|1669915_1670965_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV86078.1\|1671286_1672063_+	ferredoxin--NADP(+) reductase	NA	NA	NA	NA
AZV86079.1\|1672127_1673030_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV86080.1\|1674323_1675127_+	2,5-didehydrogluconate reductase B	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AZV86081.1\|1677820_1678207_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
AZV86082.1\|1678222_1680313_+	ATP-dependent DNA helicase RecG	NA	NA	NA	NA
AZV86083.1\|1680364_1681318_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AZV88112.1\|1681332_1682220_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV86084.1\|1682357_1683884_+	methylmalonate-semialdehyde dehydrogenase (acylating)	NA	NA	NA	NA
AZV88113.1\|1683982_1684483_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AZV86085.1\|1684806_1686762_-	capsular biosynthesis protein	NA	NA	NA	NA
AZV86086.1\|1686929_1689014_-	hypothetical protein	NA	NA	NA	NA
AZV88114.1\|1689040_1689466_-	hypothetical protein	NA	NA	NA	NA
AZV86087.1\|1690681_1691452_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AZV86088.1\|1691451_1692192_+	sugar ABC transporter ATP-binding protein	NA	NA	NA	NA
AZV86089.1\|1692233_1693403_+	capsule biosynthesis protein	NA	NA	NA	NA
AZV86090.1\|1693434_1695519_+	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AZV86091.1\|1695515_1696406_+	capsular biosynthesis protein	NA	NA	NA	NA
AZV86092.1\|1696402_1697500_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZV86093.1\|1697522_1698812_+	Vi polysaccharide biosynthesis protein VipA/TviB	NA	NA	NA	NA
AZV86094.1\|1698823_1699849_+	LPS biosynthesis protein WbpP	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AZV86095.1\|1699845_1701903_+	beta-3-deoxy-D-manno-oct-2-ulosonic acid transferase	NA	NA	NA	NA
AZV86096.1\|1701916_1703092_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZV86097.1\|1703173_1704124_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86098.1\|1704182_1704956_+	short-chain dehydrogenase	NA	NA	NA	NA
AZV86099.1\|1704948_1706505_+	capsular biosynthesis protein	NA	NA	NA	NA
AZV86100.1\|1706501_1707452_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86101.1\|1708778_1709381_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZV86102.1\|1709620_1710322_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZV86103.1\|1710315_1711098_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZV86104.1\|1711282_1712233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86105.1\|1712330_1713068_-	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZV86106.1\|1713257_1714016_-	short-chain dehydrogenase	NA	NA	NA	NA
AZV86107.1\|1714062_1715064_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV86108.1\|1715229_1716198_-	phenol degradation protein meta	NA	NA	NA	NA
AZV86109.1\|1717737_1718706_+	AAA family ATPase	NA	NA	NA	NA
AZV86110.1\|1718714_1719656_+	MoxR protein	NA	NA	NA	NA
AZV88115.1\|1720129_1721140_+	hypothetical protein	NA	NA	NA	NA
AZV88117.1\|1721130_1722645_+	hypothetical protein	NA	NA	NA	NA
AZV86111.1\|1722641_1723988_+	hypothetical protein	NA	NA	NA	NA
AZV88116.1\|1723990_1725025_+	haloacid dehalogenase	NA	NA	NA	NA
AZV86112.1\|1725074_1726700_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZV86113.1\|1726793_1727273_+	hypothetical protein	NA	NA	NA	NA
AZV86114.1\|1727252_1728122_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

2201706 : 2267256

Lake_Baikal_phage(21.43%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV86462.1\|2201706_2202576_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86463.1\|2202857_2203667_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV86464.1\|2203872_2204742_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86465.1\|2204738_2205632_-	methylglyoxal synthase	NA	NA	NA	NA
AZV86466.1\|2205756_2205951_-	Fe-S assembly protein IscX	NA	NA	NA	NA
AZV86467.1\|2205950_2206292_-	ferredoxin, 2Fe-2S type, ISC system	NA	NA	NA	NA
AZV86468.1\|2206301_2208164_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
AZV86469.1\|2208293_2208806_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
AZV86470.1\|2208808_2209132_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
AZV86471.1\|2209133_2209544_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
AZV86472.1\|2209581_2210793_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
AZV86473.1\|2210810_2211323_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
AZV86474.1\|2211538_2212030_-	protein tyrosine phosphatase	NA	NA	NA	NA
AZV86475.1\|2212282_2214319_-	excinuclease ABC subunit B	NA	NA	NA	NA
AZV86476.1\|2214396_2215599_+	aromatic amino acid aminotransferase	NA	NA	NA	NA
AZV86477.1\|2215727_2216378_+	repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	3.3e-10	50.7
AZV86478.1\|2216604_2217534_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZV86479.1\|2217579_2217939_+	hypothetical protein	NA	NA	NA	NA
AZV86480.1\|2217935_2218805_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88153.1\|2219456_2219669_-	hypothetical protein	NA	NA	NA	NA
AZV86481.1\|2219686_2220418_-	hypothetical protein	NA	NA	NA	NA
AZV86482.1\|2220452_2221094_-	succinyl-CoA--3-ketoacid-CoA transferase	NA	NA	NA	NA
AZV86483.1\|2221086_2221755_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZV86484.1\|2223967_2224744_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZV86485.1\|2224765_2225923_-	thiolase	NA	NA	NA	NA
AZV86486.1\|2225919_2226351_-	hypothetical protein	NA	NA	NA	NA
AZV88154.1\|2226347_2227145_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZV86487.1\|2227164_2227620_-	oxidoreductase	NA	NA	NA	NA
AZV86488.1\|2227632_2228604_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV86489.1\|2228669_2229893_-	CoA transferase	NA	NA	NA	NA
AZV86490.1\|2230120_2231071_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV86491.1\|2231195_2233649_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZV86492.1\|2233837_2235142_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZV86493.1\|2235246_2235900_-	ATP-dependent Clp endopeptidase, proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZV86494.1\|2235902_2237213_-	trigger factor	NA	NA	NA	NA
AZV86495.1\|2237409_2237970_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZV86496.1\|2238081_2238282_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZV86497.1\|2238627_2239194_-	hypothetical protein	NA	NA	NA	NA
AZV86498.1\|2239277_2239481_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZV86499.1\|2239787_2240108_-	hypothetical protein	NA	NA	NA	NA
AZV86500.1\|2240149_2240431_-	hypothetical protein	NA	NA	NA	NA
AZV86501.1\|2240505_2241762_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZV86502.1\|2242144_2242474_+	hypothetical protein	NA	NA	NA	NA
AZV86503.1\|2244044_2244866_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZV86504.1\|2244865_2246005_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZV86505.1\|2246011_2246908_+	ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZV86506.1\|2246922_2248830_+	ABC transporter	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZV86507.1\|2249189_2251802_+	TonB-dependent receptor	NA	NA	NA	NA
AZV86508.1\|2251854_2254155_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZV86509.1\|2254151_2255360_-	acyl-CoA desaturase	NA	NA	NA	NA
AZV86510.1\|2255621_2255996_+	hypothetical protein	NA	NA	NA	NA
AZV86511.1\|2255992_2256862_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88155.1\|2257041_2258439_-	rRNA methyltransferase	NA	NA	NA	NA
AZV86512.1\|2259095_2260061_+	riboflavin biosynthesis protein RibF	NA	NA	NA	NA
AZV86513.1\|2260050_2262912_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
AZV86514.1\|2262914_2263421_+	signal peptidase II	NA	NA	NA	NA
AZV86515.1\|2263525_2264734_+	phosphopantothenate synthase	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
AZV86516.1\|2264735_2265674_-	hypothetical protein	NA	NA	NA	NA
AZV86517.1\|2265835_2266309_+	AsnC family transcriptional regulator	NA	NA	NA	NA
AZV86518.1\|2266305_2267256_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

2688976 : 2734621

Salmonella_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV86857.1\|2688976_2689846_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86858.1\|2690037_2690220_+	hypothetical protein	NA	NA	NA	NA
AZV86859.1\|2690319_2690913_-	twin-arginine translocation pathway signal	NA	NA	NA	NA
AZV86860.1\|2691099_2692191_+	hypothetical protein	NA	NA	NA	NA
AZV86861.1\|2692690_2693101_-	transcriptional regulator	NA	NA	NA	NA
AZV86862.1\|2693159_2693489_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.7e-13	42.2
AZV86863.1\|2693506_2695924_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZV86864.1\|2695936_2696959_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
AZV86865.1\|2697033_2697393_-	50S ribosomal protein L20	NA	NA	NA	NA
AZV86866.1\|2697408_2697606_-	50S ribosomal protein L35	NA	NA	NA	NA
AZV86867.1\|2697941_2698811_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86868.1\|2699086_2699536_+	deoxyuridine 5'-triphosphate nucleotidohydrolase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AZV86869.1\|2699546_2700482_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86870.1\|2700592_2702041_+	2-aminoadipate aminotransferase	NA	NA	NA	NA
AZV86871.1\|2702155_2702401_-	hypothetical protein	NA	NA	NA	NA
AZV86872.1\|2702621_2703491_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86873.1\|2703735_2704449_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZV86874.1\|2704571_2704799_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV86875.1\|2705093_2705732_-	hypothetical protein	NA	NA	NA	NA
AZV86876.1\|2705840_2706875_+	hydrolase	NA	NA	NA	NA
AZV86877.1\|2708235_2708760_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZV86878.1\|2709231_2710293_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZV86879.1\|2710376_2712011_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZV86880.1\|2712012_2712816_-	peptide ABC transporter permease	NA	NA	NA	NA
AZV86881.1\|2712844_2713804_-	ABC transporter	NA	NA	NA	NA
AZV86882.1\|2713807_2715322_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV86883.1\|2715358_2716363_-	peptidase M20	NA	NA	NA	NA
AZV86884.1\|2716370_2716619_-	hypothetical protein	NA	NA	NA	NA
AZV86885.1\|2716793_2717264_-	histidine kinase	NA	NA	NA	NA
AZV86886.1\|2717299_2717911_-	RhtB family transporter	NA	NA	NA	NA
AZV86887.1\|2717941_2718565_-	transcriptional regulator	NA	NA	NA	NA
AZV86888.1\|2718645_2720178_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZV86889.1\|2720212_2721430_-	MFS transporter	NA	NA	NA	NA
AZV86890.1\|2721497_2722529_-	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZV86891.1\|2722525_2723695_-	amine oxidase	NA	NA	NA	NA
AZV86892.1\|2723688_2724369_-	anti-sigma factor	NA	NA	NA	NA
AZV86893.1\|2724530_2725373_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV86894.1\|2725535_2726507_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZV86895.1\|2726678_2727557_+	hypothetical protein	NA	NA	NA	NA
AZV86896.1\|2727579_2728650_-	hypothetical protein	NA	NA	NA	NA
AZV86897.1\|2728690_2729560_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86898.1\|2729932_2731291_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZV86899.1\|2731402_2733130_+	sodium-independent anion transporter	NA	NA	NA	NA
AZV86900.1\|2733751_2734621_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

2755786 : 2816852

Bacillus_virus(20.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV86918.1\|2755786_2756656_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86919.1\|2756845_2757082_+	hypothetical protein	NA	NA	NA	NA
AZV86920.1\|2757152_2759789_-	GTP-binding protein	NA	NA	NA	NA
AZV86921.1\|2759785_2760910_-	DNA repair exonuclease	NA	NA	NA	NA
AZV86922.1\|2760906_2762289_-	D-amino acid dehydrogenase small subunit	NA	NA	NA	NA
AZV86923.1\|2762424_2762892_+	AsnC family transcriptional regulator	NA	NA	NA	NA
AZV86924.1\|2763810_2764956_+	hypothetical protein	NA	NA	NA	NA
AZV86925.1\|2764957_2766688_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV86926.1\|2766805_2767114_-	hypothetical protein	NA	NA	NA	NA
AZV86927.1\|2767126_2767939_-	sugar ABC transporter permease	NA	NA	NA	NA
AZV88189.1\|2768819_2769908_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.7e-15	28.1
AZV88190.1\|2771110_2771899_+	DeoR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.0e-22	30.4
AZV86928.1\|2771938_2773543_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZV86929.1\|2773623_2774364_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZV86930.1\|2774371_2774866_-	hypothetical protein	NA	NA	NA	NA
AZV88191.1\|2775238_2776258_-	hypothetical protein	NA	NA	NA	NA
AZV86931.1\|2776254_2777637_-	hypothetical protein	A0A2P0ZL82	Lactobacillus_phage	7.9e-30	28.4
AZV86932.1\|2777669_2778530_-	hypothetical protein	NA	NA	NA	NA
AZV86933.1\|2779611_2780415_+	hypothetical protein	NA	NA	NA	NA
AZV86934.1\|2780473_2780911_+	hypothetical protein	NA	NA	NA	NA
AZV86935.1\|2781001_2781964_-	hypothetical protein	NA	NA	NA	NA
AZV86936.1\|2782011_2782956_-	dihydrodipicolinate synthase family protein	NA	NA	NA	NA
AZV86937.1\|2783051_2783861_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZV86938.1\|2783937_2784312_-	hypothetical protein	NA	NA	NA	NA
AZV86939.1\|2784418_2785111_-	hypothetical protein	NA	NA	NA	NA
AZV86940.1\|2785103_2785520_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AZV86941.1\|2785630_2786263_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
AZV86942.1\|2786291_2786735_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AZV86943.1\|2786756_2787848_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV88192.1\|2787902_2788691_-	aldolase	NA	NA	NA	NA
AZV86944.1\|2788838_2789459_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZV86945.1\|2789598_2790072_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZV86946.1\|2791210_2792161_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86947.1\|2792157_2799819_-	adhesin	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
AZV86948.1\|2800059_2804106_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
AZV86949.1\|2804463_2805000_+	TRAP transporter small permease protein	NA	NA	NA	NA
AZV86950.1\|2804996_2806295_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZV86951.1\|2806374_2807403_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZV86952.1\|2807744_2808614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86953.1\|2808793_2809663_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86954.1\|2809659_2810610_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86955.1\|2810926_2811532_+	fimbrial protein	NA	NA	NA	NA
AZV86956.1\|2811585_2812899_-	phenylacetate--CoA ligase	NA	NA	NA	NA
AZV86957.1\|2812973_2813444_-	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AZV86958.1\|2813443_2814232_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AZV86959.1\|2814242_2815895_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AZV86960.1\|2815982_2816852_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

2840858 : 2906689

Pelagibacter_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV86979.1\|2840858_2841809_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV86980.1\|2841942_2843049_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV86981.1\|2843059_2844157_+	cyclic pyranopterin phosphate synthase	NA	NA	NA	NA
AZV86982.1\|2844301_2845507_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZV86983.1\|2845513_2846035_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AZV88196.1\|2846031_2846514_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AZV86984.1\|2846519_2846771_-	molybdopterin synthase sulfur carrier subunit	NA	NA	NA	NA
AZV88195.1\|2846751_2847237_-	molybdenum cofactor biosynthesis protein C	NA	NA	NA	NA
AZV86985.1\|2847372_2850834_+	hypothetical protein	NA	NA	NA	NA
AZV86986.1\|2850851_2851736_+	carboxymethylenebutenolidase	NA	NA	NA	NA
AZV86987.1\|2851745_2852177_-	hypothetical protein	NA	NA	NA	NA
AZV88197.1\|2852423_2852927_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AZV86988.1\|2853004_2854405_+	MFS transporter	NA	NA	NA	NA
AZV86989.1\|2854479_2855355_-	hypothetical protein	NA	NA	NA	NA
AZV88198.1\|2855351_2856359_-	biotin synthase BioB	NA	NA	NA	NA
AZV86990.1\|2856826_2857132_+	hypothetical protein	NA	NA	NA	NA
AZV86991.1\|2857222_2857813_+	TetR family transcriptional regulator	NA	NA	NA	NA
AZV86992.1\|2858003_2859020_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV86993.1\|2859211_2861548_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-124	42.8
AZV86994.1\|2861630_2862065_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AZV86995.1\|2864156_2864951_-	N-formylglutamate deformylase	NA	NA	NA	NA
AZV86996.1\|2864982_2865687_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZV86997.1\|2865761_2866562_-	hypothetical protein	NA	NA	NA	NA
AZV86998.1\|2866558_2866966_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AZV86999.1\|2866962_2867604_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AZV87000.1\|2867596_2869597_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AZV87001.1\|2870857_2872189_+	arabinose ABC transporter permease	NA	NA	NA	NA
AZV87002.1\|2872185_2873055_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87003.1\|2874842_2875109_-	hypothetical protein	NA	NA	NA	NA
AZV87004.1\|2875816_2876155_+	transcriptional regulator	NA	NA	NA	NA
AZV87005.1\|2877483_2879763_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZV87006.1\|2879740_2880445_-	hypothetical protein	NA	NA	NA	NA
AZV87007.1\|2880707_2881310_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZV87008.1\|2881406_2882696_+	MFS transporter	NA	NA	NA	NA
AZV87009.1\|2882753_2883485_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
AZV87010.1\|2883481_2884285_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
AZV87011.1\|2884281_2885370_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZV87012.1\|2885366_2886296_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV87013.1\|2886444_2887590_-	branched chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87014.1\|2887611_2888481_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87015.1\|2888892_2892714_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AZV87016.1\|2892870_2893539_-	hypothetical protein	NA	NA	NA	NA
AZV87017.1\|2893543_2895217_-	paraquat-inducible protein B	NA	NA	NA	NA
AZV87018.1\|2895235_2896555_-	paraquat-inducible membrane protein A	NA	NA	NA	NA
AZV87019.1\|2896559_2898875_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.1e-164	41.9
AZV88199.1\|2898930_2901099_-	penicillin-binding protein 1C	NA	NA	NA	NA
AZV88200.1\|2901095_2905661_-	alpha-2-macroglobulin	NA	NA	NA	NA
AZV87020.1\|2906374_2906689_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8

DBSCAN-SWA_16

2912919 : 2972253

Vibrio_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87027.1\|2912919_2913870_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87028.1\|2914150_2914771_+	flagellar motor protein MotA	NA	NA	NA	NA
AZV87029.1\|2914767_2915181_+	biopolymer transporter ExbD	NA	NA	NA	NA
AZV87030.1\|2915177_2916221_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZV87031.1\|2916276_2916465_+	hypothetical protein	NA	NA	NA	NA
AZV87032.1\|2916474_2917239_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZV87033.1\|2917329_2917986_+	adenylate kinase	NA	NA	NA	NA
AZV87034.1\|2918077_2918836_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZV87035.1\|2918861_2920463_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZV87036.1\|2920663_2921668_+	iron dicitrate transport regulator FecR	NA	NA	NA	NA
AZV87037.1\|2921768_2922032_+	30S ribosomal protein S20	NA	NA	NA	NA
AZV87038.1\|2922149_2922926_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZV87039.1\|2923516_2924467_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87040.1\|2926850_2927963_-	malate dehydrogenase	NA	NA	NA	NA
AZV87041.1\|2928019_2928970_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87042.1\|2929178_2929400_-	hypothetical protein	NA	NA	NA	NA
AZV87043.1\|2929613_2931020_-	threonine synthase	NA	NA	NA	NA
AZV87044.1\|2931016_2932321_-	homoserine dehydrogenase	NA	NA	NA	NA
AZV87045.1\|2932317_2933505_-	alanine transaminase	NA	NA	NA	NA
AZV87046.1\|2933721_2934174_+	hypothetical protein	NA	NA	NA	NA
AZV87047.1\|2934176_2934641_+	peroxiredoxin	NA	NA	NA	NA
AZV87048.1\|2934720_2936400_+	phosphate starvation-inducible protein PhoH	A0A2I7SAD7	Vibrio_phage	7.3e-70	36.7
AZV87049.1\|2936504_2937482_+	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
AZV87050.1\|2937561_2938530_+	bile acid:sodium symporter	NA	NA	NA	NA
AZV87051.1\|2938550_2939924_-	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.0e-135	58.2
AZV87052.1\|2939920_2940757_-	hypothetical protein	NA	NA	NA	NA
AZV87053.1\|2940873_2941329_-	50S ribosomal protein L9	NA	NA	NA	NA
AZV87054.1\|2941344_2941617_-	30S ribosomal protein S18	NA	NA	NA	NA
AZV87055.1\|2941709_2942033_-	primosomal replication protein N	NA	NA	NA	NA
AZV87056.1\|2942080_2942461_-	30S ribosomal protein S6	NA	NA	NA	NA
AZV87057.1\|2942680_2943478_-	GTP cyclohydrolase	NA	NA	NA	NA
AZV87058.1\|2943634_2945497_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
AZV87059.1\|2945546_2946458_-	geranyl transferase	NA	NA	NA	NA
AZV87060.1\|2946462_2946729_-	exodeoxyribonuclease VII small subunit	NA	NA	NA	NA
AZV88201.1\|2946815_2947646_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZV87061.1\|2947820_2948786_+	MFS transporter	NA	NA	NA	NA
AZV87062.1\|2948956_2949967_+	hypothetical protein	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	3.6e-16	24.6
AZV87063.1\|2950114_2951266_+	Rieske (2Fe-2S) protein	NA	NA	NA	NA
AZV87064.1\|2951349_2952213_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87065.1\|2952408_2953881_-	magnesium transporter	NA	NA	NA	NA
AZV87066.1\|2953891_2954302_-	acyl-CoA thioesterase	NA	NA	NA	NA
AZV87067.1\|2954365_2955412_-	hypothetical protein	NA	NA	NA	NA
AZV87068.1\|2955518_2956397_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87069.1\|2956410_2957607_-	amidohydrolase	NA	NA	NA	NA
AZV87070.1\|2957668_2959360_+	long-chain fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.4e-33	28.1
AZV87071.1\|2959356_2960226_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87072.1\|2960427_2961324_-	inositol monophosphatase	NA	NA	NA	NA
AZV87073.1\|2963601_2965827_+	glycosyl hydrolase	NA	NA	NA	NA
AZV87074.1\|2965991_2967080_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZV87075.1\|2967036_2967690_+	DL-methionine transporter permease subunit	NA	NA	NA	NA
AZV87076.1\|2967737_2968535_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87077.1\|2969147_2970017_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87078.1\|2970097_2971246_+	alcohol dehydrogenase	NA	NA	NA	NA
AZV87079.1\|2971302_2972253_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2989247 : 3052339

Bacillus_virus(28.57%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87095.1\|2989247_2990117_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87096.1\|2990301_2990922_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZV88204.1\|2991025_2991766_+	oxidoreductase	NA	NA	NA	NA
AZV87097.1\|2992900_2994025_-	hypothetical protein	NA	NA	NA	NA
AZV87098.1\|2994070_2994439_-	hypothetical protein	NA	NA	NA	NA
AZV87099.1\|2994680_2995550_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87100.1\|2996666_2997209_-	hypothetical protein	NA	NA	NA	NA
AZV87101.1\|2997675_2998545_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87102.1\|2998541_2999450_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87103.1\|2999576_3000413_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.6e-33	33.3
AZV87104.1\|3000925_3002035_+	porin	NA	NA	NA	NA
AZV87105.1\|3002096_3002966_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87106.1\|3003239_3004022_-	short-chain dehydrogenase	NA	NA	NA	NA
AZV87107.1\|3004035_3004800_-	short-chain dehydrogenase	A0A0M4JSW6	Mollivirus	3.1e-12	26.5
AZV87108.1\|3004812_3006159_-	MFS transporter	NA	NA	NA	NA
AZV87109.1\|3006184_3007114_-	acetylxylan esterase	NA	NA	NA	NA
AZV87110.1\|3007229_3008135_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87111.1\|3008152_3009352_-	aromatic amino acid aminotransferase	NA	NA	NA	NA
AZV87112.1\|3009424_3010117_-	hydrolase	A0A1D6Y7U0	Golden_Marseillevirus	4.7e-07	29.9
AZV87113.1\|3013801_3014170_-	hypothetical protein	NA	NA	NA	NA
AZV87114.1\|3014456_3015383_+	hypothetical protein	NA	NA	NA	NA
AZV87115.1\|3015426_3016437_+	zinc-binding dehydrogenase	NA	NA	NA	NA
AZV87116.1\|3016433_3016868_+	thioesterase	NA	NA	NA	NA
AZV87117.1\|3017993_3018782_+	ABC transporter	G3M9Y6	Bacillus_virus	1.1e-33	40.0
AZV87118.1\|3018791_3019574_+	ABC transporter permease	NA	NA	NA	NA
AZV87119.1\|3019577_3020669_-	hypothetical protein	NA	NA	NA	NA
AZV88205.1\|3020774_3022250_+	acid--CoA ligase	Q75ZG1	Hepacivirus	3.0e-35	25.6
AZV87120.1\|3022391_3022940_+	cysteine dioxygenase	NA	NA	NA	NA
AZV87121.1\|3022955_3023417_-	transcriptional regulator	NA	NA	NA	NA
AZV87122.1\|3023517_3024507_-	MFS transporter	NA	NA	NA	NA
AZV87123.1\|3024805_3025507_+	riboflavin synthase subunit alpha	NA	NA	NA	NA
AZV87124.1\|3025545_3026919_-	amidase	NA	NA	NA	NA
AZV87125.1\|3029129_3030032_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87126.1\|3029979_3031200_-	MFS transporter	NA	NA	NA	NA
AZV87127.1\|3031196_3031706_-\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
AZV87128.1\|3031695_3032391_-	hypothetical protein	NA	NA	NA	NA
AZV87129.1\|3032461_3033331_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87130.1\|3033341_3033617_-	hypothetical protein	NA	NA	NA	NA
AZV87131.1\|3033915_3034629_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87132.1\|3035489_3036188_-	branched-chain amino acid ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.8e-12	28.7
AZV87133.1\|3036955_3037918_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV87134.1\|3037921_3038782_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV87135.1\|3038775_3039168_-	RidA family protein	NA	NA	NA	NA
AZV87136.1\|3041822_3042620_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZV87137.1\|3042653_3043433_-	short-chain dehydrogenase	NA	NA	NA	NA
AZV87138.1\|3043461_3044334_-	hypothetical protein	NA	NA	NA	NA
AZV87139.1\|3044355_3045105_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.2e-29	33.5
AZV88206.1\|3045112_3045970_-	ABC transporter permease	NA	NA	NA	NA
AZV87140.1\|3046010_3046574_-	hypothetical protein	NA	NA	NA	NA
AZV87141.1\|3046604_3046901_-	histidine kinase	NA	NA	NA	NA
AZV87142.1\|3046981_3047785_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87143.1\|3047805_3049002_-	formyl-CoA transferase	NA	NA	NA	NA
AZV88207.1\|3049004_3050006_-	amidase	NA	NA	NA	NA
AZV87144.1\|3050110_3050521_+	hypothetical protein	NA	NA	NA	NA
AZV87145.1\|3050623_3051286_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZV87146.1\|3051469_3052339_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

3125622 : 3189454

Pseudomonas_phage(30.0%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87200.1\|3125622_3126573_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88211.1\|3126718_3127843_-	riboflavin biosynthesis protein RibD	A0A2H4PQS8	Staphylococcus_phage	3.8e-38	33.3
AZV87201.1\|3128048_3128612_+	hydrolase	NA	NA	NA	NA
AZV87202.1\|3129606_3130089_-	transcriptional regulator NrdR	NA	NA	NA	NA
AZV87203.1\|3130246_3131494_-	serine hydroxymethyltransferase	A0A219YCZ0	Aeromonas_phage	1.1e-99	52.7
AZV87204.1\|3131713_3132370_-	phospholipid-binding protein	NA	NA	NA	NA
AZV87205.1\|3132405_3133635_-\|tRNA	tyrosine--tRNA ligase	NA	NA	NA	NA
AZV87206.1\|3133982_3134852_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87207.1\|3134950_3135901_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87208.1\|3135992_3137408_+	metallopeptidase	A8ATH6	Listeria_phage	1.9e-18	46.9
AZV87209.1\|3137413_3138550_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
AZV87210.1\|3138619_3138991_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	4.7e-30	56.9
AZV87211.1\|3139078_3139825_-	hypothetical protein	NA	NA	NA	NA
AZV87212.1\|3139861_3140926_-	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
AZV87213.1\|3141114_3141507_-	30S ribosomal protein S9	NA	NA	NA	NA
AZV87214.1\|3141516_3141945_-	50S ribosomal protein L13	NA	NA	NA	NA
AZV87215.1\|3142240_3143338_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87216.1\|3143679_3145044_-\|protease	metalloprotease PmbA	NA	NA	NA	NA
AZV87217.1\|3145102_3145654_+	hypothetical protein	NA	NA	NA	NA
AZV87218.1\|3147597_3148407_+	spermidine/putrescine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-33	37.9
AZV87219.1\|3148409_3149246_+	sulfonate ABC transporter permease	NA	NA	NA	NA
AZV87220.1\|3149260_3149953_+	hydrolase	NA	NA	NA	NA
AZV87221.1\|3149964_3150354_-	glyoxalase	NA	NA	NA	NA
AZV87222.1\|3150459_3151848_-	ATP-dependent RNA helicase DbpA	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-54	33.5
AZV87223.1\|3151964_3153461_-	hypothetical protein	NA	NA	NA	NA
AZV87224.1\|3153757_3154432_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZV87225.1\|3154611_3155481_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87226.1\|3155477_3157937_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV88212.1\|3158072_3159479_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AZV87227.1\|3159482_3160670_-	MFS transporter	NA	NA	NA	NA
AZV87228.1\|3160738_3161248_-	hypothetical protein	NA	NA	NA	NA
AZV87229.1\|3161449_3161902_-	AsnC family transcriptional regulator	NA	NA	NA	NA
AZV87230.1\|3162074_3162332_-	hypothetical protein	NA	NA	NA	NA
AZV87231.1\|3162463_3165526_+	pyruvate ferredoxin oxidoreductase	NA	NA	NA	NA
AZV87232.1\|3165831_3168759_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	3.4e-171	43.9
AZV87233.1\|3168780_3169977_+	ribonucleotide-diphosphate reductase subunit beta	A0A2H4P762	Pseudomonas_phage	1.0e-33	28.9
AZV87234.1\|3170294_3170822_+	histone	NA	NA	NA	NA
AZV87235.1\|3170975_3171536_+	hypothetical protein	NA	NA	NA	NA
AZV88213.1\|3171543_3172998_-	D-alanine--poly(phosphoribitol) ligase	A0A2K9L3I8	Tupanvirus	7.3e-26	25.1
AZV87236.1\|3173017_3174145_-	membrane-bound O-acyltransferase	A0A125RNP0	Pseudomonas_phage	3.7e-25	30.8
AZV87237.1\|3174152_3174278_-	hypothetical protein	NA	NA	NA	NA
AZV87238.1\|3174274_3175450_-	teichoic acid biosynthesis protein	NA	NA	NA	NA
AZV87239.1\|3175427_3175667_-	acyl carrier protein	NA	NA	NA	NA
AZV87240.1\|3175947_3176451_-	hypothetical protein	NA	NA	NA	NA
AZV88214.1\|3176623_3177565_-	carbohydrate kinase family protein	NA	NA	NA	NA
AZV87241.1\|3177576_3178674_-	hypothetical protein	NA	NA	NA	NA
AZV87242.1\|3179639_3180986_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AZV87243.1\|3180995_3181445_-	acetyl-CoA carboxylase, biotin carboxyl carrier protein	NA	NA	NA	NA
AZV87244.1\|3181534_3181969_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
AZV87245.1\|3182047_3182596_-	thioredoxin	NA	NA	NA	NA
AZV87246.1\|3182678_3184049_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
AZV87247.1\|3184059_3184653_+	esterase	NA	NA	NA	NA
AZV87248.1\|3184724_3186608_+	ribonuclease II	NA	NA	NA	NA
AZV87249.1\|3186645_3187545_+	energy transducer TonB	NA	NA	NA	NA
AZV87250.1\|3187541_3188405_+	shikimate dehydrogenase	NA	NA	NA	NA
AZV87251.1\|3188584_3189454_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

3237593 : 3273477

Erwinia_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87283.1\|3237593_3238544_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87284.1\|3238988_3239300_-	cell division protein ZapA	NA	NA	NA	NA
AZV87285.1\|3239299_3239830_-	hypothetical protein	NA	NA	NA	NA
AZV87286.1\|3240072_3240942_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87287.1\|3241040_3241991_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87288.1\|3242280_3242745_+	tricarboxylate transporter	NA	NA	NA	NA
AZV87289.1\|3242759_3244265_+	hypothetical protein	NA	NA	NA	NA
AZV87290.1\|3244521_3246126_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZV87291.1\|3246181_3247087_+	oxidoreductase	NA	NA	NA	NA
AZV87292.1\|3247527_3248397_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87293.1\|3248576_3249446_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87294.1\|3249607_3250189_-	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AZV88219.1\|3250613_3250919_+	RND transporter	NA	NA	NA	NA
AZV87295.1\|3250932_3252267_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
AZV87296.1\|3252288_3252828_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AZV87297.1\|3252975_3253440_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
AZV87298.1\|3253582_3254698_-	cobalamin biosynthesis protein CobW	NA	NA	NA	NA
AZV87299.1\|3254974_3255478_-	transcriptional repressor	NA	NA	NA	NA
AZV87300.1\|3255615_3255816_+	hypothetical protein	NA	NA	NA	NA
AZV87301.1\|3255806_3256529_+	ABC transporter	A0A2R8FG22	Brazilian_cedratvirus	1.1e-11	30.0
AZV87302.1\|3256525_3257422_+	zinc ABC transporter permease	NA	NA	NA	NA
AZV87303.1\|3257418_3258354_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87304.1\|3258314_3258983_+	hypothetical protein	NA	NA	NA	NA
AZV87305.1\|3258973_3259942_+	nickel transporter	NA	NA	NA	NA
AZV87306.1\|3259990_3262132_+	TonB-dependent receptor	NA	NA	NA	NA
AZV87307.1\|3262144_3263086_-	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	3.2e-14	30.5
AZV87308.1\|3263138_3263831_-	hypothetical protein	NA	NA	NA	NA
AZV87309.1\|3263857_3264769_-	diaminopimelate epimerase	NA	NA	NA	NA
AZV87310.1\|3264811_3265702_-	acyltransferase	NA	NA	NA	NA
AZV87311.1\|3265698_3266553_-	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
AZV87312.1\|3266836_3268000_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	5.0e-126	60.8
AZV87313.1\|3268110_3268362_+	DUF1289 domain-containing protein	NA	NA	NA	NA
AZV87314.1\|3268441_3269482_+	alpha-mannosyltransferase	NA	NA	NA	NA
AZV87315.1\|3269761_3271180_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	8.7e-40	29.4
AZV87316.1\|3271250_3271586_+	hypothetical protein	NA	NA	NA	NA
AZV87317.1\|3271585_3272428_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZV87318.1\|3272607_3273477_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

3280063 : 3336126

Sinorhizobium_phage(16.67%)

integrase,transposase,protease,tRNA

attL 3318973:3318991|attR 3338861:3338879

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87321.1\|3280063_3281158_+\|tRNA	CCA tRNA nucleotidyltransferase	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
AZV87322.1\|3281172_3282363_-	hypothetical protein	NA	NA	NA	NA
AZV87323.1\|3284413_3285166_-	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
AZV87324.1\|3285303_3286254_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV88222.1\|3286566_3288045_+	hypothetical protein	NA	NA	NA	NA
AZV87325.1\|3288051_3289161_-	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-23	34.5
AZV87326.1\|3289172_3289853_-	molybdenum ABC transporter permease subunit	NA	NA	NA	NA
AZV87327.1\|3289874_3290630_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87328.1\|3290765_3291668_-	hydrolase	NA	NA	NA	NA
AZV87329.1\|3291737_3292319_+	hypothetical protein	NA	NA	NA	NA
AZV87330.1\|3292411_3292534_-	hypothetical protein	NA	NA	NA	NA
AZV87331.1\|3292579_3292879_-	hypothetical protein	NA	NA	NA	NA
AZV87332.1\|3293030_3293510_-	hypothetical protein	NA	NA	NA	NA
AZV88223.1\|3293525_3293891_-	hypothetical protein	NA	NA	NA	NA
AZV87333.1\|3295662_3296091_-	AsnC family transcriptional regulator	NA	NA	NA	NA
AZV87334.1\|3296181_3297132_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87335.1\|3297659_3298433_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87336.1\|3298565_3299576_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZV87337.1\|3299727_3301383_-	gamma-glutamyltransferase	NA	NA	NA	NA
AZV87338.1\|3301437_3301779_-	cupin	NA	NA	NA	NA
AZV87339.1\|3301792_3303232_-	amine oxidase	NA	NA	NA	NA
AZV87340.1\|3303364_3304180_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZV87341.1\|3304609_3305323_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87342.1\|3306716_3307658_+	hypothetical protein	NA	NA	NA	NA
AZV87343.1\|3307884_3308625_+	TetR family transcriptional regulator	NA	NA	NA	NA
AZV87344.1\|3311098_3312670_-	transcriptional regulator	NA	NA	NA	NA
AZV87345.1\|3313002_3314856_+	hypothetical protein	NA	NA	NA	NA
AZV87346.1\|3314900_3317465_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
3318973:3318991	attL	NA	NA	NA	NA
AZV87347.1\|3319617_3319902_-	hypothetical protein	A0A1V0SIN4	Klosneuvirus	6.8e-05	34.1
AZV87348.1\|3319983_3320895_-	hypothetical protein	NA	NA	NA	NA
AZV87349.1\|3320964_3321210_+	hypothetical protein	NA	NA	NA	NA
AZV87350.1\|3321438_3321696_-	hypothetical protein	NA	NA	NA	NA
AZV87351.1\|3322210_3323080_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87352.1\|3323344_3324556_-	chromosome segregation protein SMC	NA	NA	NA	NA
AZV87353.1\|3324571_3327523_-	site-specific DNA-methyltransferase	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
AZV87354.1\|3327524_3330281_-	restriction endonuclease	NA	NA	NA	NA
AZV87355.1\|3330791_3331838_-	cell filamentation protein Fic	NA	NA	NA	NA
AZV87356.1\|3332179_3333307_-\|integrase	integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
AZV87357.1\|3333586_3334678_-	redox-regulated ATPase YchF	NA	NA	NA	NA
AZV87358.1\|3334750_3335533_-\|protease	CAAX protease	NA	NA	NA	NA
AZV87359.1\|3335529_3336126_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
3338861:3338879	attR	NA	NA	NA	NA

DBSCAN-SWA_21

3385142 : 3505221

103

Acinetobacter_phage(18.75%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87395.1\|3385142_3386012_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87396.1\|3386416_3387061_-	urease accessory protein UreG	NA	NA	NA	NA
AZV87397.1\|3387085_3387670_-	urease accessory protein UreF	NA	NA	NA	NA
AZV87398.1\|3387770_3388388_-	urease accessory protein UreE	NA	NA	NA	NA
AZV87399.1\|3388390_3390106_-	urease subunit alpha	NA	NA	NA	NA
AZV87400.1\|3390102_3390411_-	urease subunit beta	NA	NA	NA	NA
AZV87401.1\|3390427_3391045_-	urease accessory protein UreJ	NA	NA	NA	NA
AZV87402.1\|3391089_3391392_-	urease subunit gamma	NA	NA	NA	NA
AZV87403.1\|3391492_3392347_-	urease accessory protein	NA	NA	NA	NA
AZV87404.1\|3393618_3394026_-	aldehyde-activating protein	NA	NA	NA	NA
AZV87405.1\|3394395_3395190_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZV87406.1\|3395290_3396526_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZV87407.1\|3396594_3397611_+	LacI family transcriptional regulator	NA	NA	NA	NA
AZV87408.1\|3397622_3398999_+	hypothetical protein	NA	NA	NA	NA
AZV87409.1\|3398995_3400192_+	hypothetical protein	NA	NA	NA	NA
AZV87410.1\|3400188_3401727_-	SpoVR family protein	NA	NA	NA	NA
AZV87411.1\|3401723_3402983_-	hypothetical protein	NA	NA	NA	NA
AZV87412.1\|3404923_3405793_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87413.1\|3406640_3407735_-	CoA transferase	NA	NA	NA	NA
AZV87414.1\|3407727_3409062_-	CoA ligase	NA	NA	NA	NA
AZV87415.1\|3409015_3409699_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZV87416.1\|3409724_3410888_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV87417.1\|3410884_3411886_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV87418.1\|3411885_3412758_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZV87419.1\|3412754_3413504_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZV87420.1\|3413500_3414292_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZV87421.1\|3414288_3415428_-	ABC transporter	NA	NA	NA	NA
AZV87422.1\|3415703_3416489_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZV87423.1\|3416522_3417305_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87424.1\|3417308_3417698_+	DNA-binding protein	NA	NA	NA	NA
AZV87425.1\|3418837_3419701_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZV87426.1\|3419736_3420825_+	hypothetical protein	NA	NA	NA	NA
AZV87427.1\|3420821_3421691_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87428.1\|3422125_3425104_+	hypothetical protein	NA	NA	NA	NA
AZV87429.1\|3426030_3426909_+	fatty acid desaturase	NA	NA	NA	NA
AZV87430.1\|3426944_3427277_+	hypothetical protein	NA	NA	NA	NA
AZV87431.1\|3427255_3427894_+	hypothetical protein	NA	NA	NA	NA
AZV87432.1\|3427873_3428743_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87433.1\|3429486_3429807_+	hypothetical protein	A0A1V0S9J5	Catovirus	2.4e-14	45.3
AZV87434.1\|3429905_3430856_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87435.1\|3430852_3431320_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZV87436.1\|3431362_3432133_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZV87437.1\|3432153_3432954_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZV87438.1\|3432964_3434374_+	lytic transglycosylase	NA	NA	NA	NA
AZV87439.1\|3434468_3435254_+	enoyl-[acyl-carrier-protein] reductase	NA	NA	NA	NA
AZV87440.1\|3435493_3436510_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV87441.1\|3436617_3437010_-	osmotically inducible protein OsmC	NA	NA	NA	NA
AZV87442.1\|3437147_3437828_+	hypothetical protein	NA	NA	NA	NA
AZV87443.1\|3437832_3438804_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87444.1\|3438899_3439769_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87445.1\|3441354_3442056_+	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	5.6e-32	36.6
AZV87446.1\|3442055_3443480_+	ATPase	NA	NA	NA	NA
AZV87447.1\|3443496_3444552_-	cytochrome oxidase	NA	NA	NA	NA
AZV87448.1\|3444548_3445889_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AZV87449.1\|3446004_3447768_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AZV87450.1\|3447879_3448758_+	septum site-determining protein MinC	NA	NA	NA	NA
AZV87451.1\|3448870_3449686_+	septum site-determining protein MinD	NA	NA	NA	NA
AZV87452.1\|3449689_3449941_+	cell division topological specificity factor MinE	NA	NA	NA	NA
AZV87453.1\|3451371_3451593_-	hypothetical protein	NA	NA	NA	NA
AZV88226.1\|3453953_3454820_-	EamA family transporter	NA	NA	NA	NA
AZV87454.1\|3455368_3456577_-	ABC transporter permease	NA	NA	NA	NA
AZV87455.1\|3456656_3458228_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87456.1\|3458345_3459281_-	glycosyl transferase	NA	NA	NA	NA
AZV87457.1\|3459469_3460414_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZV87458.1\|3460482_3460653_-	hypothetical protein	NA	NA	NA	NA
AZV87459.1\|3460981_3466699_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZV87460.1\|3466704_3467832_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZV87461.1\|3467887_3468514_+	aminotransferase	NA	NA	NA	NA
AZV87462.1\|3468785_3469802_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZV87463.1\|3469897_3470608_-	short-chain dehydrogenase	NA	NA	NA	NA
AZV88227.1\|3470604_3471594_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87464.1\|3471689_3473321_+	acyl-CoA synthetase	NA	NA	NA	NA
AZV87465.1\|3473323_3474061_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZV87466.1\|3474216_3475089_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZV87467.1\|3475438_3476578_+	MFS transporter	NA	NA	NA	NA
AZV87468.1\|3476574_3477234_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZV87469.1\|3477305_3477938_+	pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZV87470.1\|3477967_3478486_+	flavin reductase	NA	NA	NA	NA
AZV87471.1\|3478496_3479606_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZV87472.1\|3479652_3480507_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZV87473.1\|3480508_3481411_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87474.1\|3482633_3483584_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87475.1\|3483681_3484815_-	hypothetical protein	NA	NA	NA	NA
AZV87476.1\|3484851_3485100_-	hypothetical protein	NA	NA	NA	NA
AZV87477.1\|3485339_3486329_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87478.1\|3486504_3487293_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZV87479.1\|3487289_3488321_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZV87480.1\|3488339_3488903_-	anthranilate/aminodeoxychorismate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZV87481.1\|3488958_3490479_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZV87482.1\|3490742_3491447_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZV87483.1\|3491454_3492183_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZV87484.1\|3492297_3492672_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZV87485.1\|3492714_3494004_+	hypothetical protein	NA	NA	NA	NA
AZV87486.1\|3494000_3495170_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZV87487.1\|3495196_3496006_+	disulfide bond formation protein DsbC	NA	NA	NA	NA
AZV87488.1\|3496065_3497001_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZV87489.1\|3497013_3497964_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87490.1\|3498062_3499025_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZV87491.1\|3499056_3499416_-	dihydroneopterin aldolase	NA	NA	NA	NA
AZV87492.1\|3499540_3500443_+	oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZV88228.1\|3500444_3502211_-	peptidase M61	NA	NA	NA	NA
AZV87493.1\|3502251_3503028_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87494.1\|3504351_3505221_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

3520240 : 3578309

Catovirus(12.5%)

holin,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87507.1\|3520240_3521191_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87508.1\|3521319_3522453_-	peptidase	NA	NA	NA	NA
AZV87509.1\|3522496_3523402_-	alpha/beta hydrolase	NA	NA	NA	NA
AZV87510.1\|3525101_3526022_-	peptide ABC transporter permease	NA	NA	NA	NA
AZV87511.1\|3526029_3527007_-	ABC transporter permease	NA	NA	NA	NA
AZV87512.1\|3527065_3528025_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZV87513.1\|3530074_3530311_-	hypothetical protein	NA	NA	NA	NA
AZV87514.1\|3530437_3531301_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZV87515.1\|3531389_3532211_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87516.1\|3532290_3533028_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87517.1\|3533024_3534017_-	2-nitropropane dioxygenase	NA	NA	NA	NA
AZV88231.1\|3534169_3534793_+	TetR family transcriptional regulator	NA	NA	NA	NA
AZV87518.1\|3534837_3535986_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZV87519.1\|3538390_3539260_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87520.1\|3539600_3540551_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87521.1\|3540730_3541600_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87522.1\|3541896_3542394_+	hypothetical protein	NA	NA	NA	NA
AZV87523.1\|3542436_3544212_+	hypothetical protein	NA	NA	NA	NA
AZV87524.1\|3544219_3545086_+	copper resistance protein	NA	NA	NA	NA
AZV87525.1\|3545092_3545818_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87526.1\|3545987_3546218_+	hypothetical protein	NA	NA	NA	NA
AZV87527.1\|3546282_3546477_+	hypothetical protein	NA	NA	NA	NA
AZV87528.1\|3546996_3547767_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZV87529.1\|3548080_3548671_+	cysteine dioxygenase	NA	NA	NA	NA
AZV87530.1\|3548704_3550033_-	amidase	NA	NA	NA	NA
AZV87531.1\|3550107_3551253_-	transporter	NA	NA	NA	NA
AZV87532.1\|3552322_3552757_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AZV87533.1\|3554273_3555158_+	EamA family transporter	NA	NA	NA	NA
AZV87534.1\|3555154_3556360_-	cardiolipin synthase B	NA	NA	NA	NA
AZV87535.1\|3556356_3557217_-	endonuclease	NA	NA	NA	NA
AZV87536.1\|3557329_3559120_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AZV88232.1\|3559160_3559805_-	hypothetical protein	A0A2I7S9X1	Vibrio_phage	8.5e-11	28.4
AZV87537.1\|3559826_3560135_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AZV88233.1\|3560300_3561587_-	hypothetical protein	NA	NA	NA	NA
AZV87538.1\|3561713_3562973_-\|holin	choline dehydrogenase	A0A2I2L3D3	Orpheovirus	6.1e-13	27.6
AZV87539.1\|3563020_3563971_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87540.1\|3565922_3567137_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AZV87541.1\|3567242_3568232_+	D-arabinose 5-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AZV87542.1\|3568228_3568837_+	phenylphosphate carboxylase subunit delta	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AZV87543.1\|3568849_3569479_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZV87544.1\|3569475_3570096_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZV87545.1\|3570127_3570919_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AZV87546.1\|3571272_3571494_+	ribosomal subunit interface protein	NA	NA	NA	NA
AZV87547.1\|3571770_3572226_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZV87548.1\|3572244_3573171_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZV87549.1\|3573224_3574511_-	alcohol dehydrogenase	NA	NA	NA	NA
AZV87550.1\|3575441_3576314_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AZV87551.1\|3576310_3577261_+	hypothetical protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AZV87552.1\|3577439_3578309_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

3709463 : 3752600

Streptococcus_phage(11.11%)

integrase,transposase,tRNA

attL 3747439:3747457|attR 3753223:3753241

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV87658.1\|3709463_3710333_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87659.1\|3710513_3711383_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87660.1\|3711379_3712015_-	lysine transporter LysE	NA	NA	NA	NA
AZV87661.1\|3712144_3713044_+	transcriptional regulator ArgP	NA	NA	NA	NA
AZV87662.1\|3713139_3713631_+	hypothetical protein	NA	NA	NA	NA
AZV87663.1\|3713677_3714643_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87664.1\|3715776_3717018_+	2-aminoadipate aminotransferase	A0A1X9I5H2	Streptococcus_phage	1.9e-14	24.9
AZV87665.1\|3717131_3718148_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	3.5e-75	43.8
AZV87666.1\|3718182_3718659_-	hypothetical protein	NA	NA	NA	NA
AZV87667.1\|3718801_3719710_-	hydroxymethylglutaryl-CoA lyase	NA	NA	NA	NA
AZV87668.1\|3719823_3720936_-	DNA protecting protein DprA	S6BFL3	Thermus_phage	1.9e-21	35.0
AZV88243.1\|3721036_3721522_-	AsnC family transcriptional regulator	NA	NA	NA	NA
AZV87669.1\|3721658_3722909_+	kynureninase	NA	NA	NA	NA
AZV87670.1\|3723010_3723523_+	peptide deformylase	E3SLL2	Synechococcus_phage	8.5e-22	43.3
AZV87671.1\|3723621_3724572_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87672.1\|3724637_3725576_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.4e-09	35.7
AZV87673.1\|3725598_3726225_-	flavin-nucleotide-binding protein	NA	NA	NA	NA
AZV87674.1\|3726221_3726878_-	HAD family hydrolase	NA	NA	NA	NA
AZV87675.1\|3726874_3727477_-	hypothetical protein	NA	NA	NA	NA
AZV87676.1\|3727483_3728071_-	Rossman fold protein, TIGR00730 family	A0A2I2L3F0	Orpheovirus	1.1e-07	23.3
AZV87677.1\|3728251_3728821_+	bacterioferritin	NA	NA	NA	NA
AZV87678.1\|3728891_3730211_-	ribosomal protein S12 methylthiotransferase	NA	NA	NA	NA
AZV88244.1\|3730317_3730509_-	4-oxalocrotonate tautomerase	NA	NA	NA	NA
AZV87679.1\|3732203_3733199_+	hypothetical protein	NA	NA	NA	NA
AZV87680.1\|3733283_3733958_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZV87681.1\|3733954_3734824_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87682.1\|3735066_3736308_+	ornithine--oxo-acid transaminase	A0A1V0SKB7	Klosneuvirus	4.0e-25	25.2
AZV87683.1\|3736304_3737249_+	arginase	A0A0N9R043	Chrysochromulina_ericina_virus	9.5e-27	33.3
AZV87684.1\|3737448_3738318_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87685.1\|3738277_3739207_-	hypothetical protein	NA	NA	NA	NA
AZV87686.1\|3739260_3739596_-	alkylhydroperoxidase	NA	NA	NA	NA
AZV87687.1\|3739640_3740405_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZV87688.1\|3740428_3741169_-	transcriptional regulator	NA	NA	NA	NA
AZV87689.1\|3741176_3742730_-	long-chain fatty acid--CoA ligase	A0A2K9L3I8	Tupanvirus	1.5e-13	22.6
AZV87690.1\|3742764_3743742_-	hypothetical protein	NA	NA	NA	NA
AZV87691.1\|3744014_3744596_-	ureidoglycolate hydrolase	NA	NA	NA	NA
AZV87692.1\|3744647_3751781_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
3747439:3747457	attL	NA	NA	NA	NA
AZV87693.1\|3751996_3752128_-	entericidin	NA	NA	NA	NA
AZV88245.1\|3752159_3752285_-	hypothetical protein	NA	NA	NA	NA
AZV87694.1\|3752393_3752600_-\|integrase	integrase	NA	NA	NA	NA
3753223:3753241	attR	NA	NA	NA	NA

DBSCAN-SWA_24

3758568 : 3792223

Burkholderia_phage(11.11%)

integrase,transposase

attL 3755074:3755091|attR 3800762:3800779

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3755074:3755091	attL	NA	NA	NA	NA
AZV87701.1\|3758568_3759438_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87702.1\|3759448_3760090_+	hypothetical protein	NA	NA	NA	NA
AZV87703.1\|3760256_3760499_+	hypothetical protein	NA	NA	NA	NA
AZV87704.1\|3760678_3761548_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87705.1\|3761583_3762051_+	hypothetical protein	Q3HQX1	Burkholderia_phage	2.1e-43	71.3
AZV87706.1\|3762284_3762662_+	hypothetical protein	NA	NA	NA	NA
AZV87707.1\|3762658_3762841_+	hypothetical protein	NA	NA	NA	NA
AZV87708.1\|3762844_3763831_+	DNA recombinase	H9C0R8	Aeromonas_phage	2.0e-67	57.3
AZV87709.1\|3763827_3764475_+	exonuclease	A0A0U2BXF3	Paracoccus_phage	2.0e-31	41.4
AZV87710.1\|3764532_3765060_+	hypothetical protein	NA	NA	NA	NA
AZV87711.1\|3765096_3766281_+	hypothetical protein	A0A291L9X3	Bordetella_phage	1.5e-24	37.8
AZV87712.1\|3766291_3766633_+	hypothetical protein	A0A0H5ARN8	Pseudomonas_phage	1.0e-10	45.3
AZV87713.1\|3766625_3766745_+	hypothetical protein	NA	NA	NA	NA
AZV87714.1\|3766745_3766946_+	hypothetical protein	NA	NA	NA	NA
AZV87715.1\|3766942_3767932_-\|integrase	integrase	A0A1B1P9F9	Acinetobacter_phage	4.4e-75	44.4
AZV87716.1\|3769418_3771389_-	hypothetical protein	NA	NA	NA	NA
AZV87717.1\|3771630_3772029_+	hypothetical protein	NA	NA	NA	NA
AZV87718.1\|3772037_3772961_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV87719.1\|3773499_3774369_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87720.1\|3774599_3776291_-	membrane protein insertase YidC	NA	NA	NA	NA
AZV87721.1\|3776339_3776612_-	membrane protein insertion efficiency factor YidD	A0A2H4PQM5	Staphylococcus_phage	7.0e-15	52.2
AZV87722.1\|3776608_3776980_-	ribonuclease P protein component	NA	NA	NA	NA
AZV87723.1\|3777075_3777210_-	50S ribosomal protein L34	NA	NA	NA	NA
AZV88246.1\|3777615_3779025_+	chromosomal replication initiation protein DnaA	NA	NA	NA	NA
AZV87724.1\|3779027_3780137_+	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	1.2e-41	32.6
AZV87725.1\|3780231_3782685_+	DNA gyrase subunit B	G3M9Z3	Bacillus_virus	2.3e-112	34.8
AZV87726.1\|3782803_3783595_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZV87727.1\|3783714_3785142_+	amidase	NA	NA	NA	NA
AZV88247.1\|3785180_3786152_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV87728.1\|3786236_3786440_+	hypothetical protein	NA	NA	NA	NA
AZV87729.1\|3786570_3787734_+	alpha-hydroxy-acid oxidizing enzyme	NA	NA	NA	NA
AZV87730.1\|3787821_3788667_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZV87731.1\|3790304_3791174_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZV87732.1\|3791353_3792223_+\|transposase	IS481 family transposase	NA	NA	NA	NA
3800762:3800779	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP018036

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection