CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP024646	Pseudomonas syringae isolate inb918 chromosome, complete genome	2 crisprs	DEDDh,csa3,DinG,cas3,WYL	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP024646_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP024646_2

2120549-2120643

Orphan

Consensus_repeat	Method
GCGATGGCGGCCTGCCAGCCGACCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP024646_2

>merge|CP024646|2|2120549-2120643|CRISPRCasFinder
GCGATGGCGGCCTGCCAGCCGACCAATCTCTTGCAGACTGCATGTAATGCCTGTGGGAGCTGGCTTGACAGCGATGGCGGCCTGACAGCCGACCA

>CP024646|2|2|2120549-2120643|CRISPRCasFinder
GCGATGGCGGCCTGCCAGCCGACCA	ATCTCTTGCAGACTGCATGTAATGCCTGTGGGAGCTGGCTTGACA
GCGATGGCGGCCTGACAGCCGACCA

Protein	Signature genes	Signature genes Name	Protein_function
CP024646.1\|AZV26248.1\|2113614_2115057_-\|cytochrome-c-oxidase,-cbb3-type-subunit-I	unknown	unknown	gnl\|CDD\|237726
CP024646.1\|AZV26245.1\|2111835_2112819_-\|cytochrome-c-oxidase,-cbb3-type-subunit-III	unknown	unknown	gnl\|CDD\|129864
CP024646.1\|AZV26254.1\|2121130_2121496_+\|hypothetical-protein	unknown	unknown	unknown
CP024646.1\|AZV26246.1\|2112815_2113001_-\|CcoQ/FixQ-family-Cbb3-type-cytochrome-c-oxidase-assembly-chaperone	unknown	unknown	gnl\|CDD\|238647
CP024646.1\|AZV26259.1\|2125970_2126954_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
CP024646.1\|AZV26257.1\|2124135_2124927_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
CP024646.1\|AZV26256.1\|2122467_2124033_-\|chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
CP024646.1\|AZV26261.1\|2127833_2128223_-\|hypothetical-protein	unknown	unknown	unknown
CP024646.1\|AZV26250.1\|2116488_2116686_-\|CcoQ/FixQ-family-Cbb3-type-cytochrome-c-oxidase-assembly-chaperone	unknown	unknown	gnl\|CDD\|368492
CP024646.1\|AZV26244.1\|2111408_2111666_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	unknown	unknown	gnl\|CDD\|376852
CP024646.1\|AZV26253.1\|2118828_2119506_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|226101
CP024646.1\|AZV26251.1\|2116689_2117298_-\|cytochrome-c-oxidase,-cbb3-type-subunit-II	unknown	unknown	gnl\|CDD\|237725
CP024646.1\|AZV26255.1\|2121583_2121943_+\|hypothetical-protein	unknown	unknown	unknown
CP024646.1\|AZV26262.1\|2128531_2130358_-\|glucoamylase	unknown	unknown	gnl\|CDD\|225922
CP024646.1\|AZV26260.1\|2126922_2127822_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP024646.1\|AZV26258.1\|2125195_2125882_-\|dimethylglycine-dehydrogenase	unknown	unknown	gnl\|CDD\|153233
CP024646.1\|AZV26249.1\|2115538_2116492_-\|cytochrome-c-oxidase,-cbb3-type-subunit-III	unknown	unknown	gnl\|CDD\|129864
CP024646.1\|AZV26252.1\|2117308_2118733_-\|cytochrome-c-oxidase,-cbb3-type-subunit-I	unknown	unknown	gnl\|CDD\|237726
CP024646.1\|AZV26263.1\|2130350_2131151_-\|sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|187616
CP024646.1\|AZV26247.1\|2113006_2113615_-\|cytochrome-c-oxidase,-cbb3-type-subunit-II	unknown	unknown	gnl\|CDD\|237725

Protein	Function_ID	Function_description	E-value
CP024646.1\|AZV26248.1\|2113614_2115057_-\|cytochrome-c-oxidase,-cbb3-type-subunit-I	gnl\|CDD\|237726	PRK14488, PRK14488, cbb3-type cytochrome c oxidase subunit I; Provisional.	0
CP024646.1\|AZV26245.1\|2111835_2112819_-\|cytochrome-c-oxidase,-cbb3-type-subunit-III	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	1.26475e-81
CP024646.1\|AZV26250.1\|2116488_2116686_-\|CcoQ/FixQ-family-Cbb3-type-cytochrome-c-oxidase-assembly-chaperone	gnl\|CDD\|368492	pfam05545, FixQ, Cbb3-type cytochrome oxidase component FixQ. This family consists of several Cbb3-type cytochrome oxidase components (FixQ/CcoQ). FixQ is found in nitrogen fixing bacteria. Since nitrogen fixation is an energy-consuming process, effective symbioses depend on operation of a respiratory chain with a high affinity for O2, closely coupled to ATP production. This requirement is fulfilled by a special three-subunit terminal oxidase (cytochrome terminal oxidase cbb3), which was first identified in Bradyrhizobium japonicum as the product of the fixNOQP operon.	3.60197e-07
CP024646.1\|AZV26246.1\|2112815_2113001_-\|CcoQ/FixQ-family-Cbb3-type-cytochrome-c-oxidase-assembly-chaperone	gnl\|CDD\|238647	cd01324, cbb3_Oxidase_CcoQ, Cytochrome cbb oxidase CcoQ. Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I. Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center. ccoQ, the fourth subunit, is a single transmembrane helix protein. It has been shown to protect the core complex from proteolytic degradation by serine proteases. See cd00919, cd01322, or cd01323 for more information on cbb3 oxidase.	4.34584e-09
CP024646.1\|AZV26259.1\|2125970_2126954_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	4.4945e-87
CP024646.1\|AZV26258.1\|2125195_2125882_-\|dimethylglycine-dehydrogenase	gnl\|CDD\|153233	cd03139, GATase1_PfpI_2, Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus. PfpI is an ATP-independent intracellular proteases which may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow.	2.73004e-85
CP024646.1\|AZV26256.1\|2122467_2124033_-\|chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	6.58429e-71
CP024646.1\|AZV26244.1\|2111408_2111666_-\|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin	gnl\|CDD\|376852	pfam02604, PhdYeFM_antitox, Antitoxin Phd_YefM, type II toxin-antitoxin system. Members of this family act as antitoxins in type II toxin-antitoxin systems. When bound to their toxin partners, they can bind DNA via the N-terminus and repress the expression of operons containing genes encoding the toxin and the antitoxin. This domain complexes with Txe toxins containing pfam06769, Fic/DOC toxins containing pfam02661 and YafO toxins containing pfam13957.	3.11506e-10
CP024646.1\|AZV26260.1\|2126922_2127822_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.52689e-31
CP024646.1\|AZV26253.1\|2118828_2119506_+\|alpha/beta-hydrolase	gnl\|CDD\|226101	COG3571, COG3571, Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only].	1.26581e-81
CP024646.1\|AZV26251.1\|2116689_2117298_-\|cytochrome-c-oxidase,-cbb3-type-subunit-II	gnl\|CDD\|237725	PRK14487, PRK14487, cbb3-type cytochrome c oxidase subunit II; Provisional.	2.18208e-149
CP024646.1\|AZV26257.1\|2124135_2124927_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.66427e-09
CP024646.1\|AZV26262.1\|2128531_2130358_-\|glucoamylase	gnl\|CDD\|225922	COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism].	3.17544e-114
CP024646.1\|AZV26249.1\|2115538_2116492_-\|cytochrome-c-oxidase,-cbb3-type-subunit-III	gnl\|CDD\|129864	TIGR00782, di-heme_cytochrome_cp, cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase. [Energy metabolism, Electron transport].	1.87123e-87
CP024646.1\|AZV26252.1\|2117308_2118733_-\|cytochrome-c-oxidase,-cbb3-type-subunit-I	gnl\|CDD\|237726	PRK14488, PRK14488, cbb3-type cytochrome c oxidase subunit I; Provisional.	0
CP024646.1\|AZV26263.1\|2130350_2131151_-\|sugar-dehydrogenase	gnl\|CDD\|187616	cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs. GlcDH, is a tetrameric member of the SDR family, it catalyzes the NAD(P)-dependent oxidation of beta-D-glucose to D-glucono-delta-lactone. GlcDH has a typical NAD-binding site glycine-rich pattern as well as the canonical active site tetrad (YXXXK motif plus upstream Ser and Asn). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	4.06245e-131
CP024646.1\|AZV26247.1\|2113006_2113615_-\|cytochrome-c-oxidase,-cbb3-type-subunit-II	gnl\|CDD\|237725	PRK14487, PRK14487, cbb3-type cytochrome c oxidase subunit II; Provisional.	3.15278e-150

>CP024646.1|AZV26253.1|2118828_2119506_+|alpha/beta-hydrolase
MDKQHKASIDGDQWAQCLRDHGWLWDAASGEASATLILAHGAGAPMDSEWMTDVAGRLAGLGINVLRFEFPYMAQRRVDGSKRPPNPAPKLLECWREVYGLVRLHVAGVLAVGGKSMGGRMASLLADELGADALVCLGYPFYAVGKPEKPRVEHLAGLKTRTLIVQGERDALGNRDAVGAYDLSPSIEVFWLASGDHDLKPLKVSGFTHEQHLASAAERVAGFLR
>CP024646.1|AZV26252.1|2117308_2118733_-|cytochrome-c-oxidase,-cbb3-type-subunit-I
MNTSISTAYNYKVVRQFAIMTVVWGIVGMGLGVFLAAQLVWPELNFNLPWTSFGRLRPLHTNAVIFAFGGCALFASSFYSVQRTCQTQLFAPKIAAFCFWGWQLVILLAAISLPLGYTSSKEYAELEWPIDILITIVWVAYAIVFFGTIMQRKTKHIYVGNWFFGAFIITVAILHIVNNLELPVSFTKSYSVYAGATDAMVQWWYGHNAVGFFLTAGFLGMMYYFVPKQAERPVYSYRLSIVHFWALITLYIWAGPHHLHYTALPDWAQSLGMVMSLVLLAPSWGGMINGMMTLSGAWHKLRSDPILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHAGALGWVAMISIGALYHMIPKIFGKEQMHSIGLINAHFWLATIGTVLYIASMWVNGIAQGLMWRAVNEDGTLTYSFVETLVASHPGFVVRLIGGAIFLSGMFLMAYNTWRTVRASQPADVVAAAQMA
>CP024646.1|AZV26251.1|2116689_2117298_-|cytochrome-c-oxidase,-cbb3-type-subunit-II
MKHETIEKNVGLLMLLMVFAVSIGGLTQIVPLFFQDVTNKPVEGMKPYTALQLEGRDIYIREGCVGCHSQMIRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGARYSDDWHRAHLYNPRNVVPESKMPAYPWLVTQPVDSSHTETKLKVMRTLGVPYTDDDISGAVASLKGKTEMDALVSYLQVLGTAIKSKR
>CP024646.1|AZV26250.1|2116488_2116686_-|CcoQ/FixQ-family-Cbb3-type-cytochrome-c-oxidase-assembly-chaperone
MVFEMSAGLIRGLGTVVVFVAFVGLTLWVFNRKRTPEFAEARLLPFADEPQPDTTQANETRSTRP
>CP024646.1|AZV26249.1|2115538_2116492_-|cytochrome-c-oxidase,-cbb3-type-subunit-III
MTTFWSTWICVLTIGSLIGLTWLLVGTRRGETKGSVDQTMGHSFDGIEEYDNPLPQWWFMLFAGTLVFSVGYLILYPGLGNWKGILPGYEDGWTGVHEWEKEMSKADAKFGPIFAKFAAMPVEEVAKDPQALKMGGRLFASNCSVCHGSDAKGAFGFPNLADKDWRWGGSAETIKTTIMGGRMAAMPAWGEVLGEAGVKNVAAYVRHELAGLPLPADNKADLQAGQQAFSTTCTACHGANGQGTEAMGAPNLTHPAGFIYGTSLTQLEQTIRHGRQGHMPAQNELLGNDKVQLLAAYVYSLSKGLNTEKLITEDNKK
>CP024646.1|AZV26248.1|2113614_2115057_-|cytochrome-c-oxidase,-cbb3-type-subunit-I
MSTAISPTAYNYKVVRQFAIMTVVWGILGMGLGVFIASQLVWPELNFGLPWTSFGRLRPLHTNLVIFAFGGCALFATSYYVVQRTCQTRLISDSLAAFTFWGWQAVIVGAIITLPLGYTTTKEYAELEWPLAILLAIVWVTYGLVFFGTITKRKTKHIYVGNWFYGAFIVVTAMLHIVNHMSLPVSLFKSYSAYSGATDAMIQWWYGHNAVGFFLTTGFLGMMYYFVPKQAERPIYSYRLSIVHFWALITLYIWAGPHHLHYTALPDWAQSLGMAMSIILLAPSWGGMINGMMTLSGAWHKLRTDPILRFLVVSLAFYGMSTFEGPMMAIKTVNSLSHYTDWTIGHVHAGALGWVAMISIGAIYHMIPKLFGRAQMHSTGLINAHFWLATIGTVLYIASMWVNGITQGLMWRAINDDGTLTYSFVEALQASHPGFIVRALGGAFFASGMLLMAYNVWRTVRASNPAEAEAAAKIAVVGAH
>CP024646.1|AZV26247.1|2113006_2113615_-|cytochrome-c-oxidase,-cbb3-type-subunit-II
MKHEAVEKNIGLLAFFMVIAVSVGGLTQIVPLFFQDVTNKPVEGMKPRTALELEGRDVYIANGCVGCHSQMIRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGGRYSDDWQRAHLYNPRNVVPESKMPAYPFLVENKLDGKDTAKKMEVLRTLGVPYTDEDIAGAKDAVKGKTEMDALVAYLQGLGTIIKSKR
>CP024646.1|AZV26246.1|2112815_2113001_-|CcoQ/FixQ-family-Cbb3-type-cytochrome-c-oxidase-assembly-chaperone
MDIGMIRGLGTVVVMVAFIGLALWVFSPKRKSEFEDATLLPFADDPEAIKHVEQASRSNKE
>CP024646.1|AZV26245.1|2111835_2112819_-|cytochrome-c-oxidase,-cbb3-type-subunit-III
MTTFWSLYVTVLSLGTIFSLTWLLLSTRKGQRTEQTDETVGHSFDGIEEYDNPLPKWWFMLFVGTIVFALGYLVLYPGLGNWKGLLPGYNYLDTEKQTAFANGQTGWTGVHEWEKEMARSDAKFGPIFAKFAAMPIEEVAKDPQALKMGGRLFASNCSVCHGSDAKGAYGFPNLTDADWRWGGEPETIKTTIMGGRHAVMPAWAEVIGEQGVADVAAFVLTNLDGRKLPEGTKADPANGQKLFAANCVACHGPAGKGTPAMGAPDLTHPAAFIYGSSFAQLQQTIRYGRQGQMPAQEQLQGNDKVHLLAAYVYSLSHGEKTAEAEAQ
>CP024646.1|AZV26244.1|2111408_2111666_-|type-II-toxin-antitoxin-system-Phd/YefM-family-antitoxin
MMAITTISSREFNQDTSSAKKAARNGPVIITDRGKPAHVLLSIEEYEKLTGLNASIVDLLVMPEAADIEFETERAVITHRPVDLS
>CP024646.1|AZV26254.1|2121130_2121496_+|hypothetical-protein
MFKATPNPPETDSIPYDAALEAENIKTATERAINHYLDPGAQKTSKPSRKPGKIYLVNPTMDDETLLVEACETLSSASDMARDIGETVDPSQRKAMQILQQVIMLSELLVNRVLDNHHVSR
>CP024646.1|AZV26255.1|2121583_2121943_+|hypothetical-protein
MSKTVIPPLEDPVSPYEFPDSRKLHDAAERALDYYLTPAAQIMATPYTPNDMFMVNPQTDTESLLANACESLASATVMLGDFAGLLEGPNRRTLLGIAQVVMLGELAVNQALDNLVPKE
>CP024646.1|AZV26256.1|2122467_2124033_-|chemotaxis-protein
MRNNQPITQRERTFPAQQRLISTTDAKGVITYCNDAFVEISGFSREELIRAPHNLVRHPDVPAAVFSHMWGTLKQGLPWMGIVKNRCKTGDHYWVNAYVTPVFDGSQVVGYESVRVKPSAEQIRRAEALYQRINQGKSAIPSSDKWLPIVQDWLPFILVSQLSFMIGATLNSQWGFALAAGLSVPLGLLGLQWQQRGLKRLLRLAEQTTSDPLIAQMYTDSRGAQARLEMSILSQEARLKTCLTRLQDTAEHLTDQAKQSDALAHNSSSGLERQRVETEQVATAVNQMAATTQEVASHVQRTADATQEANRLTGRGRDIAGETREAIQRLSVVVGETGLTVTQLAKDSDEIGGVVDVIKGIADQTNLLALNAAIEAARAGEMGRGFAVVADEVRQLAQRTSESTGQIHALIAKLQQTASSAVQTMEAGHRQAEEGVARVLEADQALVGISEAVANITDMTTQIAAATEEQSAVAEEISRNISNISELADQTSEQAHNSALLSEELTKTANTQYSLVERFNR
>CP024646.1|AZV26257.1|2124135_2124927_-|CPBP-family-intramembrane-metalloprotease
MTALPWLYLGLLSLGYGLALSFGQLGWLALISIALLVFAGYAVRQQTVPVGRYLGHGLFIVLALALALHWLPGFYNGRAIVPQRFTDNAVPFSMYLNLDKPLIGFWLLLVCPWIVARRSLRLTVYATALALTLSVILALGGAVLLGMITWAPKWPDQAWLWVLNNLLLVTLVEEALFRGYIQGGLSRRFQHLPYGENLALLLASLLFGLVHVGAGWHWVLLASLAGVGYGLAYRFGGLGAAIATHFGLNLLHFGLFTYPMLAG
>CP024646.1|AZV26258.1|2125195_2125882_-|dimethylglycine-dehydrogenase
MALQIGFLLFPQVQQLDLTGPYDVLASLPDVQVHLVWKDLVPVTASTGLVLKPTTTFEDCPDLDVICIPGGAGVGPLMEDEQTLAFIKSQAAQARYVTSVCTGSLVLGAAGLLQGKRATTHWAYHDLLPTLGAIAVKDRVVRDGNLFTGGGITAGIDFALTLAQELVGVDTAQLVQLQLEYTPAPPFDSGSPETAPSAVVDEARKRAAPSLKLRTEITERAAAKLNLR
>CP024646.1|AZV26259.1|2125970_2126954_+|AraC-family-transcriptional-regulator
MPKTIHVLAFANVQLLDVTGPLQVFASANDIARQQGLPAPYAPTVIASGGGAVNSSAGLAMLAEPLPKQPSDTLIIAGGWGVYAAAEDAELVSWVREHANGCRRVASVCTGAFLLAASGWLDGRRVVTHWTRCEQLAQQHPQLQVEPNPIFINDGPVWTSAGVTAGIDLALAMVEDDLGRDMALDVARQLVVFLKRPGGQSQFSVTLSLQKQGNRFDDLHAWIAEHLTCDLGIPTLAEQAGMSERSFVRHYRADTGQTPARAIELIRVETARRLLSDTGLPIKRVAANCGFGSEETLRRSFLRAMGVTPQAYRERFSVSAGADPVMP
>CP024646.1|AZV26260.1|2126922_2127822_-|alpha/beta-hydrolase
MTGAEIRFSQTPSLTIGYEHHGPENGTPVILLHGFPYSPRAYDEIAPPLAAKGYRVIVPYLRGYGPTRFNSPDTLRSGQQAALAQDLLELMDALGIEQATLCGYDWGGRAACIVAALYPERVRGLVTGDGYNLQDIPNSIQPLDPQSEHRYWYQYYFHTPRGVEGLTQNRRALCELLWQLWSPTWARNAERFPLSAPAFDNPDFVEVVIHSYRHRFMYAPGDPALEGMEQALEKQPAIGVPTISLCGADDGVGPAPVDDEDAQHFTGVYERRVLAGVGHNIPEEAPGETLKALLDLLQR
>CP024646.1|AZV26261.1|2127833_2128223_-|hypothetical-protein
MSQRIHRQIDTPLRTGLKRDELWEAADKGLIKCWEIGRQRATRFPDLAQRCSADELPVLGWKGGVSRSLKKNEKYGSLKYLAQWQGLRGEDLDIDLGSERVMTCSRTKMVVTFTPDRSKYFNQVAEAEV
>CP024646.1|AZV26262.1|2128531_2130358_-|glucoamylase
MAEHHPERQSPIDAHGIIGDMRSAALVNDKGSVDFFCWPEFDSPSIFCSLLDTPDAGIFQLAPDLPDARREQIYLPDTNVLQTRWLSDHAVVEITDLLPIGDNDDALPLLMRRVRVVSGQATFHLRCAVRHDYARAETRAVIDKKDVLFSASGQPTLRLASDQTLSVDNEAAVGQFTLKQDQTAAFMLGASDDPRFAEGAAQLCIERTLKFWRDWIGQSNYRGRWREMVNRSALALKLLTSRQHGAILAAATFGLPETPGGERNWDYRYTWIRDASFTVYAFMRLGFVDEANGYMRWLRGRVSDCSGQSMKLNILYAIDGRQELPETELTHLSGHGGAKPVRIGNGAYDQIQLDIFGELMDAVYLVNKYGDAISHEGWKHVMEVVDQVCETWQTKDVGIWEMRGEQHHFLHSRLMCWVALDRAIRLASKRSLPAPFARWDQTRQAIHADIWDNFWNEERGHFVQYQGGTALDGSMLLMPLVRFVSAKDPKWLATLEAIEKHLVRDGMVYRYRNDDAGIDGLSGTEGAFAACSFWYVECLARAGQVEKAHLEFEQLLRYANPLGLYAEEFDNRGRHLGNTPQALTHLALISAASFLDRKLSGEKNYWQP
>CP024646.1|AZV26263.1|2130350_2131151_-|sugar-dehydrogenase
MQISLARQVALVTGASSGIGHGAAKALAAAGAAVVINYNRQAEPAEALARQIIADGGQAIAIGADVSKEEDVERLFQQTLDAFGTLDILVANSGLQKDAAAVDMSLADWNAVIGVNLTGQFLCARAALRIFNRQGVREGVSRAAGKIIHMSSVHQRIPWAGHVNYAASKGGVDQLMQTLAQEVSHQRIRINSIAPGAILTAINKDATEGDAGQALLKLIPYGRIGDVEDVANAVVFLASDASDYIVGTTLFIDGGMSLYPEFRGNG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP024646_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP024646_4

2864558-2864660

Orphan

Consensus_repeat	Method
CTTTTGATTTTAAGCACTTTTCTCTGGCCGTCCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP024646_4

>merge|CP024646|4|2864558-2864660|CRISPRCasFinder
CTTTTGATTTTAAGCACTTTTCTCTGGCCGTCCTCAATCAAAAGGGGACAGATTTATTTAATTGTCCTCTTTTGATTTTAAGCACTTTTCTCTGGCCGTCCTC

>CP024646|4|4|2864558-2864660|CRISPRCasFinder
CTTTTGATTTTAAGCACTTTTCTCTGGCCGTCCTC	AATCAAAAGGGGACAGATTTATTTAATTGTCCT
CTTTTGATTTTAAGCACTTTTCTCTGGCCGTCCTC

Protein	Signature genes	Signature genes Name	Protein_function
CP024646.1\|AZV26831.1\|2855312_2856431_+\|agmatine-deiminase	unknown	unknown	gnl\|CDD\|377332
CP024646.1\|AZV26839.1\|2862155_2863838_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340927
CP024646.1\|AZV26835.1\|2857945_2858449_-\|thioesterase	unknown	unknown	gnl\|CDD\|239527
CP024646.1\|AZV26837.1\|2859079_2860990_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|379135
CP024646.1\|AZV26841.1\|2864784_2865480_-\|transposase	unknown	unknown	gnl\|CDD\|224854
CP024646.1\|AZV26844.1\|2869663_2870095_+\|DNA-methylase	unknown	unknown	gnl\|CDD\|238013
CP024646.1\|AZV26840.1\|2864281_2864515_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236499
CP024646.1\|AZV26849.1\|2876427_2877492_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP024646.1\|AZV26836.1\|2858594_2858864_-\|DUF4880-domain-containing-protein	unknown	unknown	gnl\|CDD\|226235
CP024646.1\|AZV26838.1\|2861020_2861989_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
CP024646.1\|AZV26842.1\|2865816_2866830_+\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
CP024646.1\|AZV26843.1\|2868822_2869206_-\|hypothetical-protein	unknown	unknown	unknown
CP024646.1\|AZV26848.1\|2873598_2874909_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341030
CP024646.1\|AZV29996.1\|2875380_2876406_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|227311
CP024646.1\|AZV26832.1\|2856440_2857103_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|223698
CP024646.1\|AZV26834.1\|2857571_2857925_-\|hypothetical-protein	unknown	unknown	unknown
CP024646.1\|AZV26845.1\|2870091_2870823_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224714
CP024646.1\|AZV26833.1\|2857132_2857540_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100005
CP024646.1\|AZV26847.1\|2871537_2873526_+\|collagenase-like-protease	unknown	unknown	gnl\|CDD\|223896
CP024646.1\|AZV26846.1\|2870924_2871305_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100004

Protein	Function_ID	Function_description	E-value
CP024646.1\|AZV26831.1\|2855312_2856431_+\|agmatine-deiminase	gnl\|CDD\|377332	pfam04371, PAD_porph, Porphyromonas-type peptidyl-arginine deiminase. Peptidyl-arginine deiminase (PAD) enzymes catalyze the deimination of the guanidino group from carboxy-terminal arginine residues of various peptides to produce ammonia. PAD from Porphyromonas gingivalis (PPAD) appears to be evolutionarily unrelated to mammalian PAD (pfam03068), which is a metalloenzyme. PPAD is thought to belong to the same superfamily as aminotransferase and arginine deiminase, and to form an alpha/beta propeller structure. This family has previously been named PPADH (Porphyromonas peptidyl-arginine deiminase homologs). The predicted catalytic residues in PPAD are Asp130, Asp187, His236, Asp238 and Cys351. These are absolutely conserved with the exception of Asp187 which is absent in two family members. PPAD is also able to catalyze the deimination of free L-arginine, but has primarily peptidyl-arginine specificity. It may have a FMN cofactor.	6.01215e-139
CP024646.1\|AZV26839.1\|2862155_2863838_-\|MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.5939e-126
CP024646.1\|AZV26835.1\|2857945_2858449_-\|thioesterase	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	2.888e-06
CP024646.1\|AZV26837.1\|2859079_2860990_+\|autotransporter-outer-membrane-beta-barrel-domain-containing-protein	gnl\|CDD\|379135	pfam13350, Y_phosphatase3, Tyrosine phosphatase family. This family is closely related to the pfam00102 and pfam00782 families.	3.26065e-73
CP024646.1\|AZV26841.1\|2864784_2865480_-\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	7.87649e-17
CP024646.1\|AZV26844.1\|2869663_2870095_+\|DNA-methylase	gnl\|CDD\|238013	cd00056, ENDO3c, endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases.	0.00016579
CP024646.1\|AZV26840.1\|2864281_2864515_+\|hypothetical-protein	gnl\|CDD\|236499	PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 component; Reviewed.	1.57164e-11
CP024646.1\|AZV26849.1\|2876427_2877492_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	3.35052e-28
CP024646.1\|AZV26836.1\|2858594_2858864_-\|DUF4880-domain-containing-protein	gnl\|CDD\|226235	COG3712, FecR, periplasmic ferric-dicitrate binding protein FecR, regulates iron transport through sigma-19 [Inorganic ion transport and metabolism, Signal transduction mechanisms].	2.75293e-12
CP024646.1\|AZV26838.1\|2861020_2861989_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	6.97101e-23
CP024646.1\|AZV26842.1\|2865816_2866830_+\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	5.16465e-18
CP024646.1\|AZV26848.1\|2873598_2874909_-\|MFS-transporter	gnl\|CDD\|341030	cd17477, MFS_YcaD_like, YcaD and similar transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MFS-type transporter YcaD, Bacillus subtilis MFS-type transporter YfkF, and similar proteins. They are uncharacterized transporters belonging to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.49719e-80
CP024646.1\|AZV29996.1\|2875380_2876406_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	2.00316e-95
CP024646.1\|AZV26832.1\|2856440_2857103_-\|glutathione-S-transferase	gnl\|CDD\|223698	COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].	4.56159e-35
CP024646.1\|AZV26833.1\|2857132_2857540_-\|hypothetical-protein	gnl\|CDD\|100005	cd02198, YjgH_like, YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	1.17177e-62
CP024646.1\|AZV26845.1\|2870091_2870823_+\|hypothetical-protein	gnl\|CDD\|224714	COG1801, COG1801, Uncharacterized conserved protein [Function unknown].	4.91777e-68
CP024646.1\|AZV26847.1\|2871537_2873526_+\|collagenase-like-protease	gnl\|CDD\|223896	COG0826, COG0826, Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones].	1.97812e-95
CP024646.1\|AZV26846.1\|2870924_2871305_+\|RidA-family-protein	gnl\|CDD\|100004	cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	1.11529e-28

>CP024646.1|AZV26840.1|2864281_2864515_+|hypothetical-protein
MGESEYILPELVRKVSERFGVDVIGAEVISNSEVRLKMKMQLRVARDDVAIVRIEQLYPFPEDDLIEFLAPYGLFSN
>CP024646.1|AZV26839.1|2862155_2863838_-|MFS-transporter
MAVLDSMSTGSAPPTNHSISREERKVIFASSLGTVFEWYDFYLYGSLAAIIAKHFFAGVNETTAFIFALLAFAAGFAVRPFGAIVFGRLGDMIGRKHTFLITIVIMGVSTAIVGFLPGYATIGVAAPIILITLRLLQGLALGGEYGGAATYVAEHAPKGKRGFFTSWIQTTATLGLFLSLLVILACRTALGTEAFEAWGWRIPFLLSILLLIVSVYIRLQLSESPVFMKMKAEGKASKAPLTESFARWDNLKIVIMALLGGTAGQAVVWYTGQFYALFFLLQTLKIDPQTANLLIAGSLLIGTPFFVIFGSLSDRIGRKGIIMAGCILAAVTYFPIFHALTQYGNPDVFIAQEKNPVKVIANPDQCSFQFDPVGKAKFTSSCDLAKTILAKRAIPYENVVAEPGTVAQVRIGDKVIESFEGTTLPAADFKTRNDAFTASLTTALKEAGYPEKADPAKTNYPMVLLLLTILVIYVTMVYGPIAAWLVELFPARIRYTSMSLPYHIGNGWFGGFLPTVAFAMVAATGDIYYGLWYPIVIAVMTAILGIFFMPETKDRDIHHT
>CP024646.1|AZV26838.1|2861020_2861989_-|AraC-family-transcriptional-regulator
MYSSPTRQTIILRSADMSCDDFGALFSRMFGNRYGDTPPPPKDIIIGGVYGRYEGVSFRRMHYRGDFTVAFPEPFDEITFVIPTAGKIVFNHESVGLSDVGLAIDKADLRSMRFVDNHAQHGMSISRAALTERLSSLLGRPIVHKLHFEPRVDLNSPAFQGIRALIDLATGTEFDLLLNAGSLMPSRLREMLVDAVLEAWPHNFSEALRRPEAQIAPRHVKQAIEYIQAHPEQMVSGTDLAGLVNVSLRALQEGFRRFVGTSIVAYQRQVRLERACDALKQGPSSSVTDVALQFGFSNVGRFCQYFQDAYGVSPAEMRKGLR
>CP024646.1|AZV26837.1|2859079_2860990_+|autotransporter-outer-membrane-beta-barrel-domain-containing-protein
MFPRLLCSLSVLSLSIAAAHAADLDIPRLKGIDNFRDVAGITTAYSTAHDGTMRAGVFYRSNALTPTASDLATLNGLGIKAVYDLRTPSEIAGTPDTMISGATYQNIDIIGATTSGANITTVSFKSAADATAMMQETNRAFVSDAGMRGQLGVLFNELAGVDGAALFHCTAGKDRTGWTAAVLQSIAGVDNATIMSNYLATNDYTADRVAKTLAMMPPSMAAIYAPLLGVEASYLQAGLDQVTAQYGSMDNYLKQGLGLSQETIYVLRGKMVEYNSLPGQAGLIGNAAAGAQLLQELQNSKLSGTYSAYNYYLQSAIDAGTLGGVESTVGGQVHADAASYLLRQNAMIEQAAAPFASGTDLKVGQYRLWSTALAGYLGTDGSAHAQSSNEHSQGLMVGVTQRFSEQLSARGGIGYSKGSVGGAGGEADTDFTFLDLGARYGFTSLERGLFVDANVSAGYVDYDSKRDLGGGLGSAKGDTHGNLSGATLALGYRMPLNTVILEPSLGVRVSRLDLSGFQEKGSELALDVDDIQETRRSAVANLDVSFAPMPIGAWQLVPGVRVGYERVLGDHQVDSEGHLLGLDIEQRAAFDNSDQFSGGVNLMANLGALSLGAEVGAIGGGDSHGFSGGLKASYQF
>CP024646.1|AZV26836.1|2858594_2858864_-|DUF4880-domain-containing-protein
MNDADDEILTQAAHWCMRLQDETCTPDERQAFQQWIQIDPRHAFEYAKMLEVWELSDQLPDERDKSKKRKATTLPCSFEEFQRNLAQRT
>CP024646.1|AZV26835.1|2857945_2858449_-|thioesterase
MSHDTSLQDTAAPEGVCFGCGSSNPHGLHIKSFWHEDGVHVMAEHVPEDKYCGWPELVYGGLIAMLVDCHSNWTAMAYHYRAEQREPESLPRINCVTGSLGIKFIKPTPMGVPLTLKARVDGEVGRKTRVICEVYAGDVLTAVGDSVFVRVDTEQLAAAAHGRNEDQ
>CP024646.1|AZV26834.1|2857571_2857925_-|hypothetical-protein
MVIIAISVMVVGKLEWLTNSYLLALAQAGGDFDQMIIDIWFGVAFHSLVVIVVPLLLAYFKQTLASYVVLILALSIYILLITGVNTIALVIAGLMIAAVVYAVFTQSINLIRYFRAK
>CP024646.1|AZV26833.1|2857132_2857540_-|hypothetical-protein
MPDRKIIIPDSMKTIVERAGYAPAVLVGDTLYCAGQVGRTADLTVIEAPEQQFIRAWENLDEVLKAGGCTFDDVVEMTTYHVDMSQHMPVFRDVKNRVFPKGFCAWTCIGVSQLAHPGLLVEIKCVAVRRRAIPE
>CP024646.1|AZV26832.1|2856440_2857103_-|glutathione-S-transferase
MDLTLYYHPLSSYCHKALIALYEHGVAFEKRLIDLSSEAERAELQALWPLVKFPVLRDHARQRTVPESSVIIEYLDHQPGQSQRLIPEDWETALDVRLWDRFFDHYVMTPMQQIVADRIQSANGDLSSQRALLATAYGMLEQQLTDREWIASADFSLADCSAAPALFYASTLVPFAAEQPRLSAYFERLVQRPSFSQVIEEAKPWFDFYPFAEALPQRFR
>CP024646.1|AZV26831.1|2855312_2856431_+|agmatine-deiminase
MPTRREFIKQVSVAAGVGAAVMGLGLSPARVLAASEGRWFMPDEGDKHERAYMAFGAQDAIWEDFTEDVQEALGRIARAIARYEPLTIYCRSGERSLAEEICGTSNITYQIANLDDIWMRDISANFVIDDKNGLGAVDFNFSGWGNKQQHSKDAKIAKRVAADAQATYQRSELVGEGGGIEVDGHGTAIMTESCWVNENRNPGWSKADVEAELKARLGLRKIIWLPGIKGKDITDAHVDFYARFVTPGVVIANLDTDPRSYDNKVTLAHLEILKKATDADGRPLQIHTVSPPLKPRKTKFNKDNDDFAAGYINYFVINGAVIAPEFGDKDADKKAFDLLKKLYPNRDVVQINIDAIAAGGGGIHCVTSHQPA
>CP024646.1|AZV26841.1|2864784_2865480_-|transposase
MPRTGRIVLPHYPHHIVQRGHNRQVVFAEPRDFERYLSDLCELKEALGIKVYAYCLMTNHVHLLLAPGESTSSLGQLMKALAARMTRYRNKVEGRTGTLWESRYKSSVVQSDTYLLACSRYIELNPVRAHMVARAEDYRWSSFALRVNDFSENTWLDNDPCFLELGPNDSIRRERYKSFVEMATPTNELQLIRGALQRGQLTGDMKFVEEIEKITGRRIQFRDRGRPEKSA
>CP024646.1|AZV26842.1|2865816_2866830_+|IS110-family-transposase
MKFCGIDLHSNNSVVVVTDETDRVLVSRRCPNQLTPILSLLEPHRAELVGVVVESTYNWYWLVDGLKAAGFEVKLAHPVAMKRYDGLKHSDDKDDATFLAHLLRLGILPTGYIHPPQERALRDLARKRIQLVRSRTQHILSVENIMARQFGQRVSCNEVKGLSATSVDRLGLPTDVALAMKANVAIVQALQIQIDFLEERLLHEAYLRPEFSLLKTMPGIGEVLATVIMLETGNIERFADVGHFASYARCVKSAHYSNGKKKGEGNAKNGNAYLIWAYIEAANFARRFSEDAKRFFEKKKAKTNAVVATKALAHKLARASYHILKEKQPFDARRCFA
>CP024646.1|AZV26843.1|2868822_2869206_-|hypothetical-protein
MIKITPNPPVTEPASITDPTSPYECPDSKRFNEAANRALDYHLGPISAHMMAAPYYPNRLYQANPASNNESLLADAVETLGSANVMLNNFVDLLEGPHRKTAQGIAQIVMLAELAVNQVLDNVVPTE
>CP024646.1|AZV26844.1|2869663_2870095_+|DNA-methylase
MTKTISAEELHIHLHPLSESALFKWLLASFLMGKRIQAEIAAEAYRVIVEQHQRDTPRKLGHCTHRELVRMLGEAHYVRYDETTAERLLALATKLNDEYAGRVMNMVEASANRQDFEKRLQAFDGIGPKTVEIFMREAGKVLF
>CP024646.1|AZV26845.1|2870091_2870823_+|hypothetical-protein
MSASSIFIGCAGWSLPREYWPTFPEQGTHLQRYAAHLNGVEINSSFYRPHKPQTYARWAESVPDGFRFCVKLPKSISHERRLRDCEQELDAFLEQCAGLGDRLGCLLLQLPPSLAFDEAVAEVFFVELRQRYSGAVVLEPRHESWAAAELLLMVYRIAQAVVDPSRISTDAAPRGWPSVRYWRLHGSPRIYYSPYNSVYLERLAGDLRVAAVDGVDTWCIFDNTASGAAIGNALELRRILAHG
>CP024646.1|AZV26846.1|2870924_2871305_+|RidA-family-protein
MANQDITYTPDPDADSISSDVTEFNGILMSTQIPTRADGSLELGDVTAQSECTLQALKVALEKAGSSMDRVLHLTIYLTDMADRAAFNEVYKRYFAKPWPVRAAVGVAALAVEGMKVEVTAMAAKA
>CP024646.1|AZV26847.1|2871537_2873526_+|collagenase-like-protease
MSLPKHHLELLSPARDVAIAREAILHGADAVYIGGPSFGARHNACNEVSEIAELVEFARRYHARIFTTINTILHDNELEPARKLIHQLYDAGVDALIVQDLGVMELDIPPIELHASTQTDIRTLERAKFLDQAGFSQLVLARELNLKEIRAIADETDAAIEFFIHGALCVAFSGQCNISHAQTGRSANRGDCSQACRLPYTLKDEKGGVIAYEKHLLSMKDNNQSANIRALVEAGVRSFKIEGRYKDMGYVKNITAYYRQRLDDVLNDRPDLARASSGRTAHFFMPDPEKTFHRGSTDYFVSERKIDIGAFDSPTFTGLAVGTVEKVGKRDMQVITHEPLSNGDGLNVLVKREVVGFRANIAEAKGEFEEEGEKRYRYRVEPNEMPEGLYKLRPNHPLNRNLDHNWQQALLKTSAERRIGVSWLAKLREERLELTVTSEEGISASVALEGPFGVANKPEQALDTLHDLLGQLGTTEYHATSIKLDAPQAFFIPNSQLKSLRREVIEALTAARVAAHPRGSRKAETTPPPVYPEAHLSFLANVYNQKARDFYHRHGVKLIDAAYEAHEEAGEVPVMITKHCLRFSFNLCPKQAKGVTGVKTKVAPMQLIHGDEVLTLKFDCKPCEMHVIGKMKGHILNLPQPGSVVGHISPEDLMKTIPRAPH
>CP024646.1|AZV26848.1|2873598_2874909_-|MFS-transporter
MTPRLLAMALAPLLGLFIVALGNGFLSSLTTLRLGAAGESATMIGIVSSAYFIGLTLGAIFNDRLILRIGHIRAYSSFASLIAATILLQGLFYDTWGWVVLRLVNGWATVGVFLVIESWLLLAGDAKIRGRLLALYMIVLYGAGVLGQAFLGKITGLGDTAPFMVAGMLATLSVLPIVILPRVSPLLEQVEPLKPRALLGVSPTGLVGCFGSGVTIAAIYTLLPLYLQRIGLNVGEVGSMMAWTILGAMLLQYPVGRWSDRKDRLQVLTVLCAACTVLSLVIVLVPLSSAMLAAMLFLLGGGVFALYPVAVSHAADRAPVETLVPMIQGMLLINSLGSAMSPLLISPAMNAHGETGLFWAFALVNLAMVTFFFWRRGKRPVPANPAPFAAAATFSPTGAELRVTEDLRQAAQEHPPMVDALSGEAASATGSRYEAS
>CP024646.1|AZV29996.1|2875380_2876406_+|AraC-family-transcriptional-regulator
MDHTLIERRQFSGGMKGKNLRYLNEPASGPGRMTRTGFVLLEHFSLPAFTQALDTLVTANLLRPGLFSTRTFGLSDGEVISDLGLVIRPDSRLETSVLQELDLLVICGGYRTELKASDEFINLLKMAAEAGVILAGLWNGAWFLGRAGVLEGYRCAIHPEHRPALAEISKATQVSSEPYVIDRDRLTASSPSGAFHMALDWIKGLHDKALVEGIEDILAFEESRYRRIKPTENICVSAPLREVVKLMDANLEEPLELEQLAVYAGRSRRQLERLFKEQLGTTPQRYYMELRITEARRLLQHTELSQVDVLVACGFVSPSHFSKCYSAYFGYRPSKEKRLVK
>CP024646.1|AZV26849.1|2876427_2877492_-|alpha/beta-hydrolase
MKHAPHATVTTGKNRRRLLGLSILATALLQFGAFAQAQTSAPEPIKTEAASVKADLPFGPLKHVKAGLLDVAYAETGPANGPVVILLHGWPYDIHSYDDVAPLLAAKGYRVLMPYARGYGDTHFLSDKTVRNGQPAALASDVIDFMDALKIKQAVLGGYDWGARSADIVSALWPERVKALVSVSGYLIGNQAAGKNPLPPKAELQWWYQFYFATDRGEAGYTKNTHDFAKLIWQLASPKWAFDDTTFDRSAKALQNPDHVAITVFNYRWRLGLVQGESQYDALEQKLATAPSISVPTITLEGDANGAPHPAPEDYAKRFTGKYQFRLINGGIGHNLPQEDPKAFAQAIIDADHL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP024646_3	3.2\|2302864\|27\|CP024646\|CRISPRCasFinder	2302864-2302890	27	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	495926-495952	4	0.852
CP024646_3	3.2\|2302864\|27\|CP024646\|CRISPRCasFinder	2302864-2302890	27	NZ_CP029834	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence	234542-234568	5	0.815

1. spacer 3.2|2302864|27|CP024646|CRISPRCasFinder matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

gcaggcgtgggagaaggctcatgcggt	CRISPR spacer
gagggcgtgggcgaaggctcgtgcggt	Protospacer
* .******** ********.******

2. spacer 3.2|2302864|27|CP024646|CRISPRCasFinder matches to NZ_CP029834 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

gcaggcgtgggagaaggctcatgcggt	CRISPR spacer
gtgcgcatgggagaaggctcttgcggt	Protospacer
*.. **.************* ******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1325030 : 1441045

112

Pseudomonas_phage(45.45%)

tail,plate,lysis,holin,protease,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV25537.1\|1325030_1325849_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	2.3e-08	33.9
AZV25538.1\|1325984_1326392_-	Fe-S metabolism protein SufE	NA	NA	NA	NA
AZV25539.1\|1326388_1327594_-	cysteine desulfurase CsdA	Q2XUY6	environmental_halophage	1.1e-67	35.8
AZV25540.1\|1327719_1328754_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZV25541.1\|1328785_1329148_-	ArsC family reductase	NA	NA	NA	NA
AZV25542.1\|1329330_1330962_+	Na+/H+ antiporter	NA	NA	NA	NA
AZV25543.1\|1330986_1331745_-	hypothetical protein	NA	NA	NA	NA
AZV25544.1\|1331928_1332657_-	peptidase M12	NA	NA	NA	NA
AZV25545.1\|1332823_1334023_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
AZV25546.1\|1334066_1336769_-	bifunctional uridylyltransferase/uridylyl-removing protein	NA	NA	NA	NA
AZV25547.1\|1336809_1337592_-	type I methionyl aminopeptidase	NA	NA	NA	NA
AZV25548.1\|1337966_1338704_+	30S ribosomal protein S2	NA	NA	NA	NA
AZV25549.1\|1338894_1339758_+	elongation factor Ts	NA	NA	NA	NA
AZV25550.1\|1339969_1340713_+	UMP kinase	NA	NA	NA	NA
AZV25551.1\|1340709_1341267_+	ribosome-recycling factor	NA	NA	NA	NA
AZV25552.1\|1341281_1342037_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	1.1e-17	38.1
AZV25553.1\|1342036_1342843_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AZV25554.1\|1342839_1344030_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
AZV25555.1\|1344083_1345436_+\|protease	sigma E protease regulator RseP	NA	NA	NA	NA
AZV25556.1\|1345510_1347883_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
AZV25557.1\|1347928_1348432_+	hypothetical protein	NA	NA	NA	NA
AZV25558.1\|1348435_1349491_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
AZV25559.1\|1349597_1350038_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZV25560.1\|1350034_1350811_+	acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZV25561.1\|1350813_1351944_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
AZV25562.1\|1351940_1352582_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	3.4e-28	40.0
AZV25563.1\|1352658_1356180_+	DNA polymerase III subunit alpha	A0A1C9LWZ5	Streptomyces_phage	1.1e-200	37.2
AZV25564.1\|1356319_1357267_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
AZV25565.1\|1357400_1358729_+\|tRNA	tRNA lysidine(34) synthetase TilS	A7IXR9	Paramecium_bursaria_Chlorella_virus	1.7e-05	24.2
AZV25566.1\|1359003_1360635_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.4e-158	53.5
AZV25567.1\|1360640_1361486_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	6.1e-49	42.4
AZV25568.1\|1361642_1362932_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	6.9e-137	59.2
AZV25569.1\|1363103_1363382_+	cell division protein FtsB	NA	NA	NA	NA
AZV25570.1\|1363378_1364086_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
AZV25571.1\|1364082_1364979_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV25572.1\|1365094_1366207_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	4.7e-33	29.8
AZV25573.1\|1366262_1367108_+	S-formylglutathione hydrolase	NA	NA	NA	NA
AZV25574.1\|1367151_1367625_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
AZV25575.1\|1367621_1368680_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
AZV25576.1\|1368667_1369417_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.2e-68	53.0
AZV25577.1\|1369416_1370094_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.1e-43	50.2
AZV25578.1\|1370305_1371187_+	peptigoglycan-binding protein LysM	A0A0S2SXL7	Bacillus_phage	6.6e-06	33.3
AZV25579.1\|1371293_1372301_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	5.0e-34	35.8
AZV25580.1\|1372791_1373115_-	ferredoxin family protein	NA	NA	NA	NA
AZV25581.1\|1373278_1375861_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	4.8e-28	22.6
AZV25582.1\|1376071_1376806_+	XRE family transcriptional regulator	B5TK58	Pseudomonas_phage	1.7e-132	95.5
AZV25583.1\|1377361_1377787_+\|tail	phage tail protein	NA	NA	NA	NA
AZV25584.1\|1377936_1378275_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	6.4e-50	86.4
AZV25585.1\|1378348_1378870_+	hypothetical protein	NA	NA	NA	NA
AZV25586.1\|1378873_1379482_+\|plate	baseplate assembly protein	A0A2H4JBW8	uncultured_Caudovirales_phage	3.2e-36	56.7
AZV25587.1\|1379496_1379829_+\|plate	phage baseplate protein	A0A2H4JI46	uncultured_Caudovirales_phage	3.6e-37	70.0
AZV25588.1\|1379825_1380821_+\|plate	baseplate J protein	A0A2H4JC04	uncultured_Caudovirales_phage	3.5e-112	63.5
AZV25589.1\|1380817_1381453_+\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	2.0e-44	52.0
AZV25590.1\|1384167_1384704_+	hypothetical protein	A0A1S5R1J2	Pseudomonas_phage	2.2e-20	41.7
AZV25591.1\|1384805_1384991_+	hypothetical protein	NA	NA	NA	NA
AZV25592.1\|1384993_1386160_+\|tail	phage tail protein	B0ZSG8	Halomonas_phage	3.9e-123	56.4
AZV25593.1\|1386159_1386666_+\|tail	phage tail protein	Q6R4W3	Vibrio_virus	6.2e-25	36.3
AZV25594.1\|1386765_1387347_+	hypothetical protein	B0ZSH0	Halomonas_phage	3.2e-25	37.5
AZV25595.1\|1387475_1389950_+\|tail	phage tail tape measure protein	NA	NA	NA	NA
AZV25596.1\|1389946_1390330_+	hypothetical protein	A0A2H4JAC8	uncultured_Caudovirales_phage	2.8e-33	53.5
AZV25597.1\|1390322_1390535_+\|tail	phage tail protein	A0A2H4JGD9	uncultured_Caudovirales_phage	2.4e-18	64.3
AZV25598.1\|1390544_1391573_+\|tail	phage tail protein	A2I2Y5	Vibrio_virus	1.4e-95	52.6
AZV25599.1\|1391635_1392220_+	hypothetical protein	B5TK65	Pseudomonas_phage	1.9e-81	76.8
AZV25600.1\|1392216_1392396_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	1.5e-18	78.3
AZV25601.1\|1392395_1393892_+\|tail	phage tail protein	B5TK67	Pseudomonas_phage	3.7e-259	91.4
AZV25602.1\|1393959_1394307_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	3.8e-58	93.9
AZV25603.1\|1394303_1394600_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	2.8e-41	90.8
AZV25604.1\|1394730_1396503_+\|tail	phage tail protein	B5TK70	Pseudomonas_phage	2.0e-70	60.6
AZV25605.1\|1396489_1397725_+	hydroxyacid dehydrogenase	B5TK71	Pseudomonas_phage	2.7e-154	66.5
AZV25606.1\|1397728_1398772_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	2.2e-157	79.7
AZV25607.1\|1398799_1399309_+\|plate	phage baseplate assembly protein V	B5TK73	Pseudomonas_phage	6.4e-78	86.4
AZV25608.1\|1399308_1399707_+	hypothetical protein	B5TK74	Pseudomonas_phage	1.2e-68	94.7
AZV25609.1\|1399696_1400740_+\|plate	baseplate J protein	B5TK75	Pseudomonas_phage	9.8e-158	81.5
AZV25610.1\|1400727_1401327_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	3.6e-104	90.5
AZV25611.1\|1402279_1402681_+	hypothetical protein	B5TK82	Pseudomonas_phage	6.9e-11	47.8
AZV25612.1\|1402793_1403945_+\|tail	phage tail protein	B5TK77	Pseudomonas_phage	7.5e-159	71.2
AZV25613.1\|1403941_1404457_+\|tail	phage tail protein	B5TK78	Pseudomonas_phage	4.7e-44	57.0
AZV25614.1\|1404585_1405677_+\|tail	phage tail protein	B5TK79	Pseudomonas_phage	9.6e-164	77.7
AZV25615.1\|1405686_1406253_+\|tail	phage tail protein	B5TK80	Pseudomonas_phage	7.4e-67	62.0
AZV25616.1\|1406267_1407188_+\|tail	phage tail protein	B5TK81	Pseudomonas_phage	3.1e-38	40.8
AZV25617.1\|1407190_1407634_+	hypothetical protein	Q9ZXK5	Pseudomonas_virus	1.5e-19	49.1
AZV25618.1\|1407663_1408866_+	carbohydrate-binding protein CenC	B5TK77	Pseudomonas_phage	2.2e-20	69.6
AZV25619.1\|1408877_1409120_+	hypothetical protein	NA	NA	NA	NA
AZV25620.1\|1409176_1409740_+	lysozyme	B5TK83	Pseudomonas_phage	9.2e-86	81.2
AZV25621.1\|1409721_1410252_+\|lysis	lysis protein	B5TK84	Pseudomonas_phage	9.0e-59	73.5
AZV25622.1\|1410320_1410821_+	damage-inducible protein CinA	B5TK85	Pseudomonas_phage	9.4e-74	87.3
AZV25623.1\|1410904_1411963_+	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	4.5e-110	58.9
AZV25624.1\|1411971_1412442_+	recombination regulator RecX	NA	NA	NA	NA
AZV25625.1\|1412522_1413641_-	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
AZV25626.1\|1413994_1414189_+	hypothetical protein	NA	NA	NA	NA
AZV25627.1\|1414189_1414615_-	hypothetical protein	NA	NA	NA	NA
AZV25628.1\|1414804_1415548_+	DTW domain-containing protein	NA	NA	NA	NA
AZV25629.1\|1415772_1416423_+	DNA-binding response regulator	NA	NA	NA	NA
AZV25630.1\|1416498_1416861_+	diacylglycerol kinase	NA	NA	NA	NA
AZV25631.1\|1416857_1417784_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZV25632.1\|1417928_1418708_+	ferredoxin--NADP reductase	NA	NA	NA	NA
AZV25633.1\|1418833_1419541_-\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
AZV25634.1\|1419591_1420362_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZV25635.1\|1420489_1420957_-	DUF1456 domain-containing protein	Q9EYF4	Enterobacteria_phage	7.7e-38	52.0
AZV25636.1\|1421030_1421741_-	RNA-binding protein	NA	NA	NA	NA
AZV25637.1\|1421824_1422298_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZV25638.1\|1422409_1423747_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
AZV25639.1\|1424035_1425937_+	potassium transporter Kup	M1HZV6	Acanthocystis_turfacea_Chlorella_virus	2.4e-77	34.1
AZV25640.1\|1426113_1426404_+	Phd-YefM	NA	NA	NA	NA
AZV25641.1\|1426415_1426703_+	plasmid stabilization protein	NA	NA	NA	NA
AZV25642.1\|1426769_1429487_-	adenosine deaminase	NA	NA	NA	NA
AZV25643.1\|1429473_1432209_-	hypothetical protein	NA	NA	NA	NA
AZV25644.1\|1432396_1433692_-	virulence factor family protein	NA	NA	NA	NA
AZV25645.1\|1433691_1436331_-	hypothetical protein	NA	NA	NA	NA
AZV25646.1\|1437248_1438310_+	DNA polymerase IV	NA	NA	NA	NA
AZV25647.1\|1438358_1439312_-	hypothetical protein	NA	NA	NA	NA
AZV25648.1\|1439329_1441045_-\|tRNA	proline--tRNA ligase	A0A2K9L0T2	Tupanvirus	1.5e-06	24.9

DBSCAN-SWA_2

4021003 : 4027191

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV30043.1\|4021003_4021396_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	4.6e-52	77.5
AZV27839.1\|4021397_4021754_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.9e-37	65.8
AZV27840.1\|4021753_4022047_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	3.4e-31	68.7
AZV27841.1\|4022043_4022379_+	sulfurtransferase TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	1.8e-44	80.2
AZV27842.1\|4022375_4023377_+	hypothetical protein	A0A2H4JBY5	uncultured_Caudovirales_phage	1.3e-162	85.4
AZV27843.1\|4023468_4024470_+	glutathione-dependent reductase	NA	NA	NA	NA
AZV27844.1\|4024515_4025910_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AZV27845.1\|4025910_4027191_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	5.7e-99	53.9

DBSCAN-SWA_3

5822218 : 5873661

Burkholderia_phage(40.0%)

transposase,holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZV29418.1\|5822218_5822722_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
AZV29419.1\|5822987_5823875_+	acyltransferase	NA	NA	NA	NA
AZV29420.1\|5823876_5824434_-	hypothetical protein	NA	NA	NA	NA
AZV29421.1\|5824681_5825881_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.4e-11	29.7
AZV29422.1\|5826086_5826944_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZV29423.1\|5826957_5827590_-	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
AZV29424.1\|5827737_5830755_-	sarcosine oxidase subunit alpha	NA	NA	NA	NA
AZV29425.1\|5830751_5831081_-	sarcosine oxidase subunit delta family protein	NA	NA	NA	NA
AZV29426.1\|5831094_5832345_-	sarcosine oxidase subunit beta	NA	NA	NA	NA
AZV29427.1\|5832365_5833619_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	1.3e-100	53.0
AZV29428.1\|5833775_5834486_-	conjugal transfer protein TraX	NA	NA	NA	NA
AZV29429.1\|5834614_5835655_+	low specificity L-threonine aldolase	NA	NA	NA	NA
AZV29430.1\|5835924_5836503_+\|transposase	transposase	NA	NA	NA	NA
AZV29431.1\|5836740_5837565_+	short chain dehydrogenase	NA	NA	NA	NA
AZV29432.1\|5837617_5838718_-	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZV30084.1\|5838759_5838954_+	protein GbcA	NA	NA	NA	NA
AZV29433.1\|5838999_5840292_+	Rieske (2Fe-2S) protein	NA	NA	NA	NA
AZV29434.1\|5840355_5841846_-	hypothetical protein	NA	NA	NA	NA
AZV29435.1\|5842171_5843416_-	metallophosphoesterase	NA	NA	NA	NA
AZV29436.1\|5843441_5845310_-	hypothetical protein	NA	NA	NA	NA
AZV29437.1\|5845450_5848903_-\|holin	choline dehydrogenase	NA	NA	NA	NA
AZV29438.1\|5849897_5850668_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
AZV29439.1\|5850677_5851898_-	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
AZV29440.1\|5851897_5853847_-	(Fe-S)-binding protein	NA	NA	NA	NA
AZV29441.1\|5854006_5856067_-	N-methylproline demethylase	NA	NA	NA	NA
AZV29442.1\|5856082_5856613_-	hydrocarbon binding protein	NA	NA	NA	NA
AZV29443.1\|5856690_5857668_-	membrane dipeptidase	NA	NA	NA	NA
AZV30085.1\|5857902_5858304_+	DUF1311 domain-containing protein	NA	NA	NA	NA
AZV29444.1\|5858517_5858772_+	cytotoxic translational repressor of toxin-antitoxin stability system	A0A1S5NR91	Burkholderia_phage	2.6e-24	64.3
AZV29445.1\|5858755_5859079_+	XRE family transcriptional regulator	A0A1S5NNJ5	Burkholderia_phage	5.7e-32	68.5
AZV29446.1\|5859111_5859528_+	DUF3010 domain-containing protein	NA	NA	NA	NA
AZV29447.1\|5859528_5860701_-	hypothetical protein	NA	NA	NA	NA
AZV29448.1\|5860769_5861714_-	GlxA family transcriptional regulator	NA	NA	NA	NA
AZV29449.1\|5861907_5862852_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV29450.1\|5862927_5863815_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
AZV29451.1\|5863885_5864851_+	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZV29452.1\|5864976_5865453_+	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
AZV29453.1\|5865477_5866641_+	gamma-butyrobetaine dioxygenase	NA	NA	NA	NA
AZV29454.1\|5866914_5867175_+	hypothetical protein	NA	NA	NA	NA
AZV29455.1\|5867253_5868357_-	GlxA family transcriptional regulator	NA	NA	NA	NA
AZV29456.1\|5868802_5870179_-	L-serine ammonia-lyase	NA	NA	NA	NA
AZV29457.1\|5870613_5871564_+	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZV29458.1\|5871640_5872486_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
AZV29459.1\|5872482_5873661_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-25	37.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP024646

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection