CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025346	Bordetella pertussis strain H742 chromosome, complete genome	4 crisprs	csa3,cas3,DinG,DEDDh	0	0	31	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025346_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025346_1

252690-252774

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025346_1

>merge|CP025346|1|252690-252774|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP025346|1|1|252690-252774|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP025346.1\|AZW77305.1\|248136_248628_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP025346.1\|AZW77306.1\|248624_249980_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
CP025346.1\|AZW77304.1\|247161_248118_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025346.1\|AZW80515.1\|256479_257724_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP025346.1\|AZW77311.1\|253722_255612_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP025346.1\|AZW77308.1\|250675_251377_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP025346.1\|AZW77315.1\|259891_260872_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
CP025346.1\|AZW77301.1\|241647_242391_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP025346.1\|AZW77313.1\|257795_258332_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP025346.1\|AZW77318.1\|263061_264816_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP025346.1\|AZW77300.1\|240215_240626_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
CP025346.1\|AZW77317.1\|262055_262955_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025346.1\|AZW77312.1\|255698_256337_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP025346.1\|AZW77307.1\|249980_250679_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP025346.1\|AZW77316.1\|261007_261991_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295
CP025346.1\|AZW77309.1\|251629_252679_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP025346.1\|AZW77303.1\|243648_245751_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP025346.1\|AZW77310.1\|252784_253726_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP025346.1\|AZW77302.1\|242434_243478_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP025346.1\|AZW77314.1\|258483_259875_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779

Protein	Function_ID	Function_description	E-value
CP025346.1\|AZW77305.1\|248136_248628_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP025346.1\|AZW77306.1\|248624_249980_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP025346.1\|AZW77304.1\|247161_248118_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP025346.1\|AZW80515.1\|256479_257724_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	7.29619e-86
CP025346.1\|AZW77311.1\|253722_255612_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP025346.1\|AZW77308.1\|250675_251377_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP025346.1\|AZW77315.1\|259891_260872_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP025346.1\|AZW77301.1\|241647_242391_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP025346.1\|AZW77313.1\|257795_258332_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP025346.1\|AZW77318.1\|263061_264816_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP025346.1\|AZW77300.1\|240215_240626_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
CP025346.1\|AZW77317.1\|262055_262955_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
CP025346.1\|AZW77312.1\|255698_256337_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
CP025346.1\|AZW77307.1\|249980_250679_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP025346.1\|AZW77316.1\|261007_261991_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP025346.1\|AZW77309.1\|251629_252679_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP025346.1\|AZW77303.1\|243648_245751_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
CP025346.1\|AZW77310.1\|252784_253726_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP025346.1\|AZW77302.1\|242434_243478_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP025346.1\|AZW77314.1\|258483_259875_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0

>CP025346.1|AZW77309.1|251629_252679_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP025346.1|AZW77308.1|250675_251377_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP025346.1|AZW77307.1|249980_250679_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP025346.1|AZW77306.1|248624_249980_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP025346.1|AZW77305.1|248136_248628_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP025346.1|AZW77304.1|247161_248118_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP025346.1|AZW77303.1|243648_245751_+|hypothetical-protein
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP025346.1|AZW77302.1|242434_243478_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP025346.1|AZW77301.1|241647_242391_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP025346.1|AZW77300.1|240215_240626_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>CP025346.1|AZW77310.1|252784_253726_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP025346.1|AZW77311.1|253722_255612_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP025346.1|AZW77312.1|255698_256337_+|hypothetical-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP025346.1|AZW80515.1|256479_257724_-|N-acetylmuramoyl-L-alanine-amidase
MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP025346.1|AZW77313.1|257795_258332_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP025346.1|AZW77314.1|258483_259875_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP025346.1|AZW77315.1|259891_260872_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP025346.1|AZW77316.1|261007_261991_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP025346.1|AZW77317.1|262055_262955_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP025346.1|AZW77318.1|263061_264816_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025346_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025346_2

434133-434226

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP025346_2

>merge|CP025346|2|434133-434226|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP025346|2|2|434133-434226|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025346.1\|AZW77474.1\|434871_435216_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
CP025346.1\|AZW77464.1\|421472_422531_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP025346.1\|AZW77467.1\|424420_425626_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP025346.1\|AZW77468.1\|425622_427134_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP025346.1\|AZW77481.1\|443143_444121_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP025346.1\|AZW77480.1\|442161_443133_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP025346.1\|AZW77476.1\|438504_439023_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP025346.1\|AZW77469.1\|428653_428833_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP025346.1\|AZW77473.1\|434312_434783_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP025346.1\|AZW77472.1\|433503_433902_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP025346.1\|AZW77479.1\|441309_442095_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP025346.1\|AZW77478.1\|440084_441317_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP025346.1\|AZW77471.1\|432421_433372_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025346.1\|AZW80525.1\|427149_428463_-\|short-chain-fatty-acids-transporter	unknown	unknown	gnl\|CDD\|224942
CP025346.1\|AZW77470.1\|429242_429977_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP025346.1\|AZW77477.1\|439133_439889_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
CP025346.1\|AZW77465.1\|422660_423155_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP025346.1\|AZW77475.1\|435315_436716_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP025346.1\|AZW77482.1\|444246_445419_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP025346.1\|AZW77466.1\|423247_424225_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
CP025346.1\|AZW77474.1\|434871_435216_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP025346.1\|AZW77464.1\|421472_422531_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
CP025346.1\|AZW77467.1\|424420_425626_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP025346.1\|AZW77468.1\|425622_427134_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP025346.1\|AZW77481.1\|443143_444121_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP025346.1\|AZW77480.1\|442161_443133_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP025346.1\|AZW77476.1\|438504_439023_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP025346.1\|AZW77469.1\|428653_428833_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
CP025346.1\|AZW77473.1\|434312_434783_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP025346.1\|AZW77472.1\|433503_433902_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP025346.1\|AZW77479.1\|441309_442095_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP025346.1\|AZW77478.1\|440084_441317_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP025346.1\|AZW77471.1\|432421_433372_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
CP025346.1\|AZW80525.1\|427149_428463_-\|short-chain-fatty-acids-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP025346.1\|AZW77470.1\|429242_429977_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP025346.1\|AZW77477.1\|439133_439889_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP025346.1\|AZW77465.1\|422660_423155_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP025346.1\|AZW77475.1\|435315_436716_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP025346.1\|AZW77482.1\|444246_445419_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP025346.1\|AZW77466.1\|423247_424225_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23

>CP025346.1|AZW77472.1|433503_433902_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP025346.1|AZW77471.1|432421_433372_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP025346.1|AZW77470.1|429242_429977_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP025346.1|AZW77469.1|428653_428833_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP025346.1|AZW80525.1|427149_428463_-|short-chain-fatty-acids-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP025346.1|AZW77468.1|425622_427134_+|TRAP-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP025346.1|AZW77467.1|424420_425626_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP025346.1|AZW77466.1|423247_424225_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP025346.1|AZW77465.1|422660_423155_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP025346.1|AZW77464.1|421472_422531_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP025346.1|AZW77473.1|434312_434783_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP025346.1|AZW77474.1|434871_435216_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP025346.1|AZW77475.1|435315_436716_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP025346.1|AZW77476.1|438504_439023_-|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP025346.1|AZW77477.1|439133_439889_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP025346.1|AZW77478.1|440084_441317_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP025346.1|AZW77479.1|441309_442095_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP025346.1|AZW77480.1|442161_443133_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP025346.1|AZW77481.1|443143_444121_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP025346.1|AZW77482.1|444246_445419_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025346_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025346_3

997402-997496

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025346_3

>merge|CP025346|3|997402-997496|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP025346|3|3|997402-997496|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP025346.1\|AZW77951.1\|984091_985918_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
CP025346.1\|AZW77967.1\|1010901_1011153_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
CP025346.1\|AZW77961.1\|999421_1000471_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP025346.1\|AZW77952.1\|986000_986642_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
CP025346.1\|AZW80548.1\|991564_992473_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
CP025346.1\|AZW77966.1\|1009449_1010832_+\|multidrug-transporter	unknown	unknown	gnl\|CDD\|273830
CP025346.1\|AZW77953.1\|986831_987866_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
CP025346.1\|AZW77964.1\|1003765_1004497_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
CP025346.1\|AZW77963.1\|1003133_1003706_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703
CP025346.1\|AZW77954.1\|989702_990767_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	unknown	unknown	gnl\|CDD\|213263
CP025346.1\|AZW77957.1\|995776_996649_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP025346.1\|AZW77956.1\|995388_995769_+\|hypothetical-protein	unknown	unknown	unknown
CP025346.1\|AZW77965.1\|1006273_1009453_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
CP025346.1\|AZW77960.1\|998366_999317_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025346.1\|AZW77958.1\|996954_997335_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP025346.1\|AZW77950.1\|982918_983848_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
CP025346.1\|AZW77962.1\|1000608_1001625_-\|IS110-family-transposase-IS1663	unknown	unknown	gnl\|CDD\|376773
CP025346.1\|AZW77955.1\|993960_995235_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP025346.1\|AZW80549.1\|1004548_1005466_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP025346.1\|AZW77959.1\|997545_998271_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518

Protein	Function_ID	Function_description	E-value
CP025346.1\|AZW77953.1\|986831_987866_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP025346.1\|AZW77967.1\|1010901_1011153_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP025346.1\|AZW77962.1\|1000608_1001625_-\|IS110-family-transposase-IS1663	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23
CP025346.1\|AZW77961.1\|999421_1000471_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP025346.1\|AZW77954.1\|989702_990767_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP025346.1\|AZW80548.1\|991564_992473_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP025346.1\|AZW77966.1\|1009449_1010832_+\|multidrug-transporter	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
CP025346.1\|AZW77952.1\|986000_986642_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132
CP025346.1\|AZW77964.1\|1003765_1004497_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP025346.1\|AZW77963.1\|1003133_1003706_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
CP025346.1\|AZW77960.1\|998366_999317_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025346.1\|AZW77957.1\|995776_996649_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP025346.1\|AZW77959.1\|997545_998271_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
CP025346.1\|AZW77965.1\|1006273_1009453_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP025346.1\|AZW77958.1\|996954_997335_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP025346.1\|AZW77950.1\|982918_983848_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
CP025346.1\|AZW77951.1\|984091_985918_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
CP025346.1\|AZW77955.1\|993960_995235_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP025346.1\|AZW80549.1\|1004548_1005466_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67

>CP025346.1|AZW77958.1|996954_997335_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP025346.1|AZW77957.1|995776_996649_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP025346.1|AZW77956.1|995388_995769_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP025346.1|AZW77955.1|993960_995235_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP025346.1|AZW80548.1|991564_992473_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP025346.1|AZW77954.1|989702_990767_+|sulfate/thiosulfate-import-ATP-binding-protein-CysA
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP025346.1|AZW77953.1|986831_987866_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP025346.1|AZW77952.1|986000_986642_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>CP025346.1|AZW77951.1|984091_985918_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>CP025346.1|AZW77950.1|982918_983848_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>CP025346.1|AZW77959.1|997545_998271_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP025346.1|AZW77960.1|998366_999317_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025346.1|AZW77961.1|999421_1000471_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP025346.1|AZW77962.1|1000608_1001625_-|IS110-family-transposase-IS1663
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>CP025346.1|AZW77963.1|1003133_1003706_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP025346.1|AZW77964.1|1003765_1004497_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP025346.1|AZW80549.1|1004548_1005466_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP025346.1|AZW77965.1|1006273_1009453_+|multidrug-efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP025346.1|AZW77966.1|1009449_1010832_+|multidrug-transporter
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>CP025346.1|AZW77967.1|1010901_1011153_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025346_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025346_4

3429345-3429454

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025346_4

>merge|CP025346|4|3429345-3429454|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP025346|4|4|3429345-3429454|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP025346.1\|AZW79912.1\|3416011_3418990_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP025346.1\|AZW79916.1\|3424200_3424971_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025346.1\|AZW79924.1\|3431737_3432688_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025346.1\|AZW79925.1\|3434192_3434894_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|181883
CP025346.1\|AZW79913.1\|3419916_3420795_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP025346.1\|AZW79915.1\|3423690_3424158_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP025346.1\|AZW79923.1\|3430670_3431669_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025346.1\|AZW79918.1\|3425802_3427212_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP025346.1\|AZW79910.1\|3414707_3415658_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025346.1\|AZW79930.1\|3441709_3442525_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP025346.1\|AZW79922.1\|3429985_3430666_+\|DUF533-domain-containing-protein	unknown	unknown	gnl\|CDD\|377342
CP025346.1\|AZW79921.1\|3429455_3429848_-\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|224679
CP025346.1\|AZW79917.1\|3424991_3425792_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP025346.1\|AZW79911.1\|3415644_3416013_-\|hypothetical-protein	unknown	unknown	unknown
CP025346.1\|AZW79914.1\|3422743_3423694_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025346.1\|AZW79926.1\|3434893_3436318_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236531
CP025346.1\|AZW79927.1\|3437387_3438728_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP025346.1\|AZW79929.1\|3440718_3441597_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP025346.1\|AZW79919.1\|3427306_3428092_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
CP025346.1\|AZW79928.1\|3438843_3440607_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424

Protein	Function_ID	Function_description	E-value
CP025346.1\|AZW79912.1\|3416011_3418990_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP025346.1\|AZW79916.1\|3424200_3424971_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP025346.1\|AZW79924.1\|3431737_3432688_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
CP025346.1\|AZW79925.1\|3434192_3434894_+\|DNA-binding-response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP025346.1\|AZW79913.1\|3419916_3420795_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP025346.1\|AZW79915.1\|3423690_3424158_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP025346.1\|AZW79923.1\|3430670_3431669_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76869e-129
CP025346.1\|AZW79918.1\|3425802_3427212_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP025346.1\|AZW79910.1\|3414707_3415658_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.27808e-22
CP025346.1\|AZW79930.1\|3441709_3442525_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP025346.1\|AZW79922.1\|3429985_3430666_+\|DUF533-domain-containing-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP025346.1\|AZW79921.1\|3429455_3429848_-\|OsmC-family-peroxiredoxin	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP025346.1\|AZW79917.1\|3424991_3425792_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP025346.1\|AZW79914.1\|3422743_3423694_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025346.1\|AZW79926.1\|3434893_3436318_+\|ATP-binding-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP025346.1\|AZW79927.1\|3437387_3438728_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP025346.1\|AZW79929.1\|3440718_3441597_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP025346.1\|AZW79919.1\|3427306_3428092_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP025346.1\|AZW79928.1\|3438843_3440607_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0

>CP025346.1|AZW79919.1|3427306_3428092_+|enoyl-[acyl-carrier-protein]-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP025346.1|AZW79918.1|3425802_3427212_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP025346.1|AZW79917.1|3424991_3425792_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP025346.1|AZW79916.1|3424200_3424971_-|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP025346.1|AZW79915.1|3423690_3424158_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP025346.1|AZW79914.1|3422743_3423694_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025346.1|AZW79913.1|3419916_3420795_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP025346.1|AZW79912.1|3416011_3418990_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP025346.1|AZW79911.1|3415644_3416013_-|hypothetical-protein
MHVGQGLGDAVHGNAPGGRVGANLGNAQRQDDFLAPRIEHDAVLAPDEILQACAPVEWRGRVLRAAAQLPRQGLAQIQPHAQLDASCEDSIGCMHGSSEPDLRNWKSPPPQFTQGARPDEHP
>CP025346.1|AZW79910.1|3414707_3415658_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025346.1|AZW79921.1|3429455_3429848_-|OsmC-family-peroxiredoxin
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP025346.1|AZW79922.1|3429985_3430666_+|DUF533-domain-containing-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP025346.1|AZW79923.1|3430670_3431669_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRPVAPMTTMKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP025346.1|AZW79924.1|3431737_3432688_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025346.1|AZW79925.1|3434192_3434894_+|DNA-binding-response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP025346.1|AZW79926.1|3434893_3436318_+|ATP-binding-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP025346.1|AZW79927.1|3437387_3438728_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP025346.1|AZW79928.1|3438843_3440607_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP025346.1|AZW79929.1|3440718_3441597_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP025346.1|AZW79930.1|3441709_3442525_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 122073

110

Planktothrix_phage(16.67%)

tRNA,protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77105.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZW77106.1\|1916_2609_+	ribosomal RNA small subunit methyltransferase G	NA	NA	NA	NA
AZW77107.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZW77108.1\|3409_4171_+	N-acetyltransferase	NA	NA	NA	NA
AZW77109.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZW77110.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZW77111.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZW77112.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZW77113.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZW77114.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZW77115.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZW77116.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZW77117.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZW77118.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZW80501.1\|20126_20531_-	lipoprotein	NA	NA	NA	NA
AZW77119.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZW77120.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZW77121.1\|26470_27286_+	DNA-binding response regulator	NA	NA	NA	NA
AZW77122.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77123.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
AZW77124.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AZW77125.1\|29141_30368_-	thiolase family protein	NA	NA	NA	NA
AZW77126.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AZW80502.1\|31069_31978_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77127.1\|32163_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW77128.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW77129.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77130.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AZW77131.1\|36949_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZW77132.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW77133.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZW77134.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW77135.1\|41318_42212_+	M48 family peptidase	NA	NA	NA	NA
AZW77136.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AZW77137.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZW77138.1\|43346_43646_-	hypothetical protein	NA	NA	NA	NA
AZW77139.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77140.1\|45113_45749_+	hypothetical protein	NA	NA	NA	NA
AZW77141.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW77142.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AZW77143.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZW77144.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZW77145.1\|50141_51092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77146.1\|51134_52391_+	MFS transporter	NA	NA	NA	NA
AZW77147.1\|53622_54357_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
AZW77148.1\|54362_54953_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZW77149.1\|54977_55667_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW77150.1\|55663_56425_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW77151.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77152.1\|57497_58448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77153.1\|59248_60475_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW77154.1\|60474_60894_-	transcriptional regulator	NA	NA	NA	NA
AZW77155.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
AZW77156.1\|62442_63279_-	hypothetical protein	NA	NA	NA	NA
AZW77157.1\|63473_64055_-\|protease	protease	NA	NA	NA	NA
AZW77158.1\|64067_64385_-	ferredoxin	NA	NA	NA	NA
AZW77159.1\|64488_65547_-	oxidoreductase	NA	NA	NA	NA
AZW77160.1\|65581_66853_-	TRAP transporter large permease	NA	NA	NA	NA
AZW77161.1\|67482_68664_-	hypothetical protein	NA	NA	NA	NA
AZW77162.1\|69085_70036_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
AZW77163.1\|70129_70444_+\|transposase	transposase	NA	NA	NA	NA
AZW77164.1\|71636_73544_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AZW77165.1\|73705_74326_-	glutathione S-transferase	NA	NA	NA	NA
AZW77166.1\|74357_74939_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AZW77167.1\|75027_75279_-	hypothetical protein	NA	NA	NA	NA
AZW80503.1\|75280_76030_-	hypothetical protein	NA	NA	NA	NA
AZW77168.1\|76228_77638_+	signal recognition particle protein	NA	NA	NA	NA
AZW77169.1\|77634_78585_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80504.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77170.1\|79600_81475_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZW77171.1\|82822_83527_-	DUF2837 domain-containing protein	NA	NA	NA	NA
AZW77172.1\|83523_84630_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZW77173.1\|84891_85485_-	sugar transferase	NA	NA	NA	NA
AZW77174.1\|85481_86714_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZW77175.1\|86731_87991_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZW77176.1\|88014_89103_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZW77177.1\|89110_90211_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZW77178.1\|90214_90790_-	N-acetyltransferase	NA	NA	NA	NA
AZW77179.1\|90793_91846_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZW80505.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZW77180.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZW77181.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
AZW77182.1\|94468_95272_-	type III pantothenate kinase	NA	NA	NA	NA
AZW77183.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZW77184.1\|96203_97340_+	ABC transporter permease	NA	NA	NA	NA
AZW77185.1\|97339_98179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZW77186.1\|99111_99714_+	hypothetical protein	NA	NA	NA	NA
AZW77187.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW77188.1\|100529_101786_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
AZW77189.1\|101788_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZW77190.1\|102808_103084_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZW77191.1\|103091_103754_+	octanoyltransferase	NA	NA	NA	NA
AZW77192.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
AZW77193.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZW77194.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZW77195.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZW77196.1\|107427_108378_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77197.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
AZW77198.1\|110552_111182_-	thiol:disulfide interchange protein DsbA	NA	NA	NA	NA
AZW77199.1\|111243_111927_-	SPOR domain-containing protein	NA	NA	NA	NA
AZW77200.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZW80506.1\|113906_114254_+	DUF1840 domain-containing protein	NA	NA	NA	NA
AZW77201.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
AZW77202.1\|114944_115961_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW77203.1\|116036_116837_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW77204.1\|116833_117709_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW77205.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77206.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZW77207.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
AZW77208.1\|121122_122073_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

135157 : 207636

Bacillus_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77216.1\|135157_136108_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77217.1\|136526_138035_-	threonine ammonia-lyase, biosynthetic	NA	NA	NA	NA
AZW77218.1\|138781_142744_+	FAD-linked oxidase	NA	NA	NA	NA
AZW77219.1\|142796_143579_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW77220.1\|143666_144890_-	CoA transferase	NA	NA	NA	NA
AZW80510.1\|144873_145806_-	lipase	NA	NA	NA	NA
AZW77221.1\|145811_146624_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW77222.1\|146644_147088_-	hypothetical protein	NA	NA	NA	NA
AZW77223.1\|147106_147865_-	hypothetical protein	NA	NA	NA	NA
AZW80511.1\|147937_148861_-	hypothetical protein	NA	NA	NA	NA
AZW77224.1\|149027_149810_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW77225.1\|150576_151557_-	carboxylase	NA	NA	NA	NA
AZW77226.1\|151553_152282_-	allophanate hydrolase subunit 1	NA	NA	NA	NA
AZW77227.1\|152306_152738_-	glyoxalase	NA	NA	NA	NA
AZW77228.1\|152839_153715_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77229.1\|153766_154987_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	3.2e-91	42.6
AZW77230.1\|155070_155532_-	metal-binding protein	NA	NA	NA	NA
AZW77231.1\|155637_157035_-	two-component sensor histidine kinase	NA	NA	NA	NA
AZW77232.1\|157031_157709_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	1.5e-29	35.2
AZW77233.1\|157764_159075_-	phosphate regulon sensor histidine kinase PhoR	A0A1V0SGX0	Hokovirus	6.2e-16	25.5
AZW77234.1\|159086_159785_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	8.6e-33	37.1
AZW77235.1\|159948_160725_+	ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE	NA	NA	NA	NA
AZW77236.1\|160890_161913_+	Tim44 domain-containing protein	NA	NA	NA	NA
AZW77237.1\|162141_162777_+	hypothetical protein	NA	NA	NA	NA
AZW77238.1\|162773_164336_+	ubiquinone biosynthesis regulatory protein kinase UbiB	A0A2N9QVT9	Dishui_lake_phycodnavirus	1.0e-33	28.7
AZW77239.1\|164894_165845_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77240.1\|167288_168191_-	hypothetical protein	NA	NA	NA	NA
AZW77241.1\|168168_168798_-	LemA family protein	NA	NA	NA	NA
AZW77242.1\|169128_170511_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.3e-42	29.5
AZW77243.1\|170544_171174_+	threonine transporter RhtB	NA	NA	NA	NA
AZW77244.1\|171222_172830_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZW77245.1\|172854_173538_+	hypothetical protein	NA	NA	NA	NA
AZW80512.1\|173619_174096_-	bacterioferritin	NA	NA	NA	NA
AZW77246.1\|174302_175253_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77247.1\|176368_176896_+	lipoprotein	NA	NA	NA	NA
AZW77248.1\|176987_177803_+	lipoprotein	NA	NA	NA	NA
AZW77249.1\|177863_178598_+	sulfurtransferase	NA	NA	NA	NA
AZW77250.1\|178635_180714_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZW77251.1\|180963_181236_-	hypothetical protein	NA	NA	NA	NA
AZW77252.1\|181334_182423_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW77253.1\|182426_184331_+	outer membrane protein assembly factor	NA	NA	NA	NA
AZW77254.1\|184327_188002_+	DUF490 domain-containing protein	NA	NA	NA	NA
AZW77255.1\|188062_188626_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZW77256.1\|188633_189056_-	glyoxalase	NA	NA	NA	NA
AZW77257.1\|189083_189503_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AZW80513.1\|189531_189978_-	N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
AZW77258.1\|190104_190602_+	hypothetical protein	NA	NA	NA	NA
AZW77259.1\|190756_193027_+	lysine decarboxylase	NA	NA	NA	NA
AZW77260.1\|193075_194308_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW77261.1\|194406_195357_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77262.1\|195455_196406_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77263.1\|196451_197144_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.4e-83	73.8
AZW77264.1\|197140_198034_+	ZIP family metal transporter	NA	NA	NA	NA
AZW77265.1\|198428_199529_+	aminomethyltransferase	NA	NA	NA	NA
AZW77266.1\|199610_199985_+	glycine cleavage system protein H	NA	NA	NA	NA
AZW77267.1\|200044_202909_+	glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZW77268.1\|203053_203794_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW77269.1\|203863_205075_+	CoA transferase	NA	NA	NA	NA
AZW77270.1\|205103_206072_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77271.1\|206685_207636_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

216715 : 268623

uncultured_Caudovirales_phage(33.33%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77282.1\|216715_219511_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
AZW77283.1\|220104_223047_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZW77284.1\|223118_223838_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZW77285.1\|223876_224425_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZW77286.1\|224579_225479_+	virginiamycin B lyase	NA	NA	NA	NA
AZW77287.1\|225503_226454_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77288.1\|226552_227503_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77289.1\|227489_227669_-	hypothetical protein	NA	NA	NA	NA
AZW77290.1\|227721_228417_+	FadR family transcriptional regulator	NA	NA	NA	NA
AZW77291.1\|228433_229846_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW77292.1\|229958_231389_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AZW77293.1\|231430_233344_-	phosphomethylpyrimidine synthase	NA	NA	NA	NA
AZW77294.1\|233662_234229_+	preprotein translocase subunit SecD	NA	NA	NA	NA
AZW77295.1\|234319_235321_+	HindIII family type II restriction endonuclease	NA	NA	NA	NA
AZW77296.1\|235435_236386_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77297.1\|236472_237423_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77298.1\|237419_238370_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77299.1\|238468_239266_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW77300.1\|240215_240626_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZW77301.1\|241647_242391_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW77302.1\|242434_243478_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77303.1\|243648_245751_+	hypothetical protein	NA	NA	NA	NA
AZW77304.1\|247161_248118_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77305.1\|248136_248628_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZW77306.1\|248624_249980_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZW77307.1\|249980_250679_-	HAD-IB family hydrolase	NA	NA	NA	NA
AZW77308.1\|250675_251377_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZW77309.1\|251629_252679_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZW77310.1\|252784_253726_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZW77311.1\|253722_255612_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZW77312.1\|255698_256337_+	hypothetical protein	NA	NA	NA	NA
AZW80515.1\|256479_257724_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.1e-17	30.3
AZW77313.1\|257795_258332_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZW77314.1\|258483_259875_+	class II fumarate hydratase	NA	NA	NA	NA
AZW77315.1\|259891_260872_-	AEC family transporter	NA	NA	NA	NA
AZW77316.1\|261007_261991_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
AZW77317.1\|262055_262955_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77318.1\|263061_264816_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW77319.1\|264823_265948_-	CoA transferase	NA	NA	NA	NA
AZW77320.1\|265961_266942_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77321.1\|267672_268623_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

279239 : 333434

Pithovirus(14.29%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77330.1\|279239_280190_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77331.1\|280176_280392_-	hypothetical protein	NA	NA	NA	NA
AZW77332.1\|280467_280629_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZW77333.1\|280636_280777_+	hypothetical protein	NA	NA	NA	NA
AZW77334.1\|281295_281745_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZW77335.1\|281754_282366_-	glutathione S-transferase	NA	NA	NA	NA
AZW77336.1\|282524_283379_-	cytochrome c1	NA	NA	NA	NA
AZW77337.1\|283398_284781_-	cytochrome b	NA	NA	NA	NA
AZW77338.1\|284845_285487_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZW77339.1\|285626_286085_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZW77340.1\|286109_286886_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZW80516.1\|286939_288076_+	PDZ domain-containing protein	W5SAB9	Pithovirus	1.2e-07	31.2
AZW77341.1\|288072_289023_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77342.1\|289121_289748_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW77343.1\|289770_290697_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AZW77344.1\|290705_292292_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77345.1\|292288_293293_-	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
AZW77346.1\|293492_294353_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW77347.1\|294384_295386_-	2-isopropylmalate synthase	NA	NA	NA	NA
AZW77348.1\|295456_296266_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW77349.1\|296343_298203_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZW77350.1\|298331_299534_-	MFS transporter	NA	NA	NA	NA
AZW77351.1\|299647_300529_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77352.1\|302031_302592_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
AZW77353.1\|302651_303602_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77354.1\|303793_304054_-	hypothetical protein	NA	NA	NA	NA
AZW77355.1\|304169_305120_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77356.1\|305116_306115_-	hypothetical protein	NA	NA	NA	NA
AZW77357.1\|306157_306661_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW77358.1\|306664_307555_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW77359.1\|307777_308941_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77360.1\|309037_309958_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW77361.1\|309961_310927_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW77362.1\|310923_311718_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.6e-09	23.5
AZW77363.1\|311711_312416_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-16	32.2
AZW77364.1\|315779_316643_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW77365.1\|316645_317815_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW77366.1\|317855_319505_+	2-aminobenzoate-CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.6e-56	31.2
AZW77367.1\|319506_319941_+	acyl-CoA thioesterase	NA	NA	NA	NA
AZW77368.1\|319965_320367_+	RidA family protein	NA	NA	NA	NA
AZW77369.1\|320460_322086_-	DUF342 domain-containing protein	NA	NA	NA	NA
AZW77370.1\|322325_323609_-	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
AZW77371.1\|323625_324279_-	thiamine phosphate synthase	NA	NA	NA	NA
AZW77372.1\|324275_325124_-	hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	NA	NA	NA	NA
AZW80517.1\|325240_325405_+	rubredoxin	NA	NA	NA	NA
AZW77373.1\|325420_326098_+	YqgE/AlgH family protein	NA	NA	NA	NA
AZW77374.1\|326090_326492_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
AZW77375.1\|326505_327459_+	aspartate carbamoyltransferase catalytic subunit	A7RB08	Paramecium_bursaria_Chlorella_virus	2.5e-30	35.8
AZW77376.1\|327455_328631_+	dihydroorotase	NA	NA	NA	NA
AZW77377.1\|328750_329491_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW77378.1\|329527_330361_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	NA	NA	NA	NA
AZW77379.1\|330357_331626_-	LPS export ABC transporter permease LptG	NA	NA	NA	NA
AZW77380.1\|331632_332361_-	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
AZW77381.1\|332483_333434_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

392956 : 450465

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77440.1\|392956_393907_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77441.1\|394043_394961_+	reductase	NA	NA	NA	NA
AZW77442.1\|394957_395206_+	glutaredoxin family protein	NA	NA	NA	NA
AZW77443.1\|395202_396408_+	CoA transferase	NA	NA	NA	NA
AZW77444.1\|396480_397476_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77445.1\|397498_398719_-	CoA transferase	NA	NA	NA	NA
AZW77446.1\|398715_399360_-	hypothetical protein	NA	NA	NA	NA
AZW77447.1\|401090_401900_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW80522.1\|402117_403158_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-59	42.5
AZW77448.1\|403256_404240_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77449.1\|404166_404868_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77450.1\|404916_405687_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW77451.1\|405683_406925_-	CoA transferase	NA	NA	NA	NA
AZW77452.1\|407029_408736_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW77453.1\|408732_409629_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77454.1\|409669_411259_-	sulfurtransferase	NA	NA	NA	NA
AZW77455.1\|411308_412301_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77456.1\|412369_412969_-	hypothetical protein	NA	NA	NA	NA
AZW80523.1\|413429_414407_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77457.1\|414485_415436_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77458.1\|415524_416439_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW77459.1\|416435_417095_+	LysE family translocator	NA	NA	NA	NA
AZW77460.1\|417184_418108_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AZW77461.1\|418113_418569_-	hypothetical protein	NA	NA	NA	NA
AZW77462.1\|418565_419669_-	ChbG/HpnK family deacetylase	NA	NA	NA	NA
AZW80524.1\|419588_419897_+	GtrA family protein	NA	NA	NA	NA
AZW77463.1\|419856_421476_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
AZW77464.1\|421472_422531_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AZW77465.1\|422660_423155_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW77466.1\|423247_424225_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77467.1\|424420_425626_+	sodium/glutamate symporter	NA	NA	NA	NA
AZW77468.1\|425622_427134_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
AZW80525.1\|427149_428463_-	short-chain fatty acids transporter	NA	NA	NA	NA
AZW77469.1\|428653_428833_-	hypothetical protein	NA	NA	NA	NA
AZW77470.1\|429242_429977_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AZW77471.1\|432421_433372_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77472.1\|433503_433902_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZW77473.1\|434312_434783_-	universal stress protein	NA	NA	NA	NA
AZW77474.1\|434871_435216_-	TIGR01244 family phosphatase	NA	NA	NA	NA
AZW77475.1\|435315_436716_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW77476.1\|438504_439023_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.1e-12	38.9
AZW77477.1\|439133_439889_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZW77478.1\|440084_441317_+	CoA transferase	NA	NA	NA	NA
AZW77479.1\|441309_442095_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW77480.1\|442161_443133_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77481.1\|443143_444121_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77482.1\|444246_445419_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW77483.1\|445445_446474_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW77484.1\|446539_447733_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW77485.1\|449514_450465_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

621852 : 722316

111

uncultured_Caudovirales_phage(13.79%)

terminase,tail,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77636.1\|621852_622803_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77637.1\|623501_623885_+	hypothetical protein	NA	NA	NA	NA
AZW77638.1\|623942_624545_+	DUF2946 domain-containing protein	NA	NA	NA	NA
AZW80531.1\|624562_624964_-	DoxX family protein	NA	NA	NA	NA
AZW80532.1\|625097_625991_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77639.1\|625987_626569_+	NUDIX hydrolase	NA	NA	NA	NA
AZW77640.1\|627363_628098_+	arginyltransferase	NA	NA	NA	NA
AZW77641.1\|628138_629188_+	dihydroorotate dehydrogenase (quinone)	NA	NA	NA	NA
AZW77642.1\|629335_629914_-	Phasin (PHA-granule associated protein)	NA	NA	NA	NA
AZW77643.1\|630300_631278_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
AZW77644.1\|631371_635766_-	dermonecrotic toxin	NA	NA	NA	NA
AZW77645.1\|635966_636815_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW77646.1\|636973_637786_-	competence/damage-inducible protein A	NA	NA	NA	NA
AZW77647.1\|637841_638792_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77648.1\|638890_639691_-	hypothetical protein	NA	NA	NA	NA
AZW77649.1\|639752_640136_+	thioredoxin	NA	NA	NA	NA
AZW77650.1\|640147_641581_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZW77651.1\|641787_642117_-	AzlD domain-containing protein	NA	NA	NA	NA
AZW80533.1\|642119_642788_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW77652.1\|643051_643972_+	branched-chain amino acid transaminase	NA	NA	NA	NA
AZW77653.1\|644018_644231_+	zinc-finger domain-containing protein	NA	NA	NA	NA
AZW77654.1\|644253_644676_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AZW77655.1\|644692_645793_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW77656.1\|645889_647407_-	peptidase	NA	NA	NA	NA
AZW77657.1\|647482_648322_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZW77658.1\|648343_649225_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
AZW77659.1\|649306_650401_-	porin	NA	NA	NA	NA
AZW77660.1\|650694_651645_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80534.1\|651719_652661_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77661.1\|652744_653104_-	hypothetical protein	NA	NA	NA	NA
AZW77662.1\|653485_654523_-	hypothetical protein	NA	NA	NA	NA
AZW77663.1\|654839_656180_+	peptidase M24 family protein	NA	NA	NA	NA
AZW77664.1\|656189_656642_-	hypothetical protein	NA	NA	NA	NA
AZW77665.1\|656738_657920_+	monooxygenase	NA	NA	NA	NA
AZW77666.1\|657979_659011_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZW77667.1\|659051_659291_+	Fis family transcriptional regulator	NA	NA	NA	NA
AZW77668.1\|659360_660950_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZW77669.1\|660949_661498_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZW77670.1\|661578_662151_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AZW77671.1\|662169_663081_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZW77672.1\|663154_664123_-	threonine/serine dehydratase	NA	NA	NA	NA
AZW77673.1\|664245_665319_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZW77674.1\|665323_667144_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZW77675.1\|667220_668171_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77676.1\|668259_668595_+	ASCH domain-containing protein	NA	NA	NA	NA
AZW77677.1\|668728_669379_+	carbonic anhydrase	NA	NA	NA	NA
AZW77678.1\|669400_670819_-	amidase	NA	NA	NA	NA
AZW77679.1\|670888_671644_-	hypothetical protein	NA	NA	NA	NA
AZW80535.1\|671612_672371_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW77680.1\|672381_673263_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW77681.1\|673279_673987_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AZW77682.1\|673989_674748_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AZW77683.1\|674957_676700_+	sulfite reductase	NA	NA	NA	NA
AZW77684.1\|676692_677217_+	DUF934 domain-containing protein	NA	NA	NA	NA
AZW77685.1\|677256_678051_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77686.1\|678218_679292_+	hypothetical protein	NA	NA	NA	NA
AZW77687.1\|679390_680341_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77688.1\|680592_680805_-	hypothetical protein	NA	NA	NA	NA
AZW80536.1\|680870_681482_-	LexA family transcriptional repressor	NA	NA	NA	NA
AZW77689.1\|681961_682282_-	hypothetical protein	NA	NA	NA	NA
AZW77690.1\|682274_682973_-	hypothetical protein	NA	NA	NA	NA
AZW77691.1\|682987_683209_-	hypothetical protein	NA	NA	NA	NA
AZW77692.1\|683226_684177_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80537.1\|684852_685302_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	5.2e-39	61.5
AZW77693.1\|685288_686566_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZW77694.1\|686568_687987_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZW80538.1\|688015_689071_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
AZW77695.1\|689076_689319_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZW77696.1\|689441_690044_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZW77697.1\|690472_691423_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77698.1\|691440_692088_+	hypothetical protein	R9TJ64	Synechococcus_phage	2.7e-65	71.1
AZW77699.1\|692097_692349_+	hypothetical protein	NA	NA	NA	NA
AZW77700.1\|692411_692894_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZW77701.1\|692895_693096_+	hypothetical protein	NA	NA	NA	NA
AZW77702.1\|693095_693491_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZW77703.1\|693487_693886_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZW77704.1\|693882_694305_+	hypothetical protein	NA	NA	NA	NA
AZW77705.1\|694312_694813_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZW77706.1\|695067_695586_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZW77707.1\|695595_695925_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZW77708.1\|695942_696233_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZW77709.1\|696258_698871_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AZW77710.1\|698880_699240_+	hypothetical protein	NA	NA	NA	NA
AZW77711.1\|699307_699841_+	DUF1833 domain-containing protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZW77712.1\|699837_700227_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZW77713.1\|700219_704176_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZW77714.1\|704180_704597_+	hypothetical protein	NA	NA	NA	NA
AZW77715.1\|704815_705079_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AZW77716.1\|705078_705891_+	hypothetical protein	NA	NA	NA	NA
AZW77717.1\|705895_706138_+	hypothetical protein	NA	NA	NA	NA
AZW77718.1\|706116_706668_+	lysozyme	NA	NA	NA	NA
AZW77719.1\|706649_707183_+	DUF2514 domain-containing protein	NA	NA	NA	NA
AZW77720.1\|707179_707461_-	hypothetical protein	NA	NA	NA	NA
AZW77721.1\|707803_708004_+	hypothetical protein	NA	NA	NA	NA
AZW77722.1\|708010_708682_-	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZW77723.1\|709037_709724_-	DNA-binding response regulator	NA	NA	NA	NA
AZW77724.1\|709704_710277_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZW77725.1\|710342_712073_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AZW77726.1\|712125_712554_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AZW77727.1\|712556_713237_+	protein TolQ	NA	NA	NA	NA
AZW77728.1\|713236_713695_+	protein TolR	NA	NA	NA	NA
AZW77729.1\|713731_714706_+	cell envelope integrity protein TolA	NA	NA	NA	NA
AZW77730.1\|714722_716039_+	protein TolB	NA	NA	NA	NA
AZW77731.1\|716070_716568_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
AZW77732.1\|716654_717344_+	tol-pal system protein YbgF	NA	NA	NA	NA
AZW77733.1\|717343_718393_+	iron ABC transporter permease	NA	NA	NA	NA
AZW77734.1\|718389_719184_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AZW77735.1\|719352_719703_+	hypothetical protein	NA	NA	NA	NA
AZW77736.1\|719678_720236_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77737.1\|721160_721379_+	hypothetical protein	NA	NA	NA	NA
AZW77738.1\|721365_722316_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

749241 : 822403

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77759.1\|749241_750192_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77760.1\|750846_751944_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
AZW77761.1\|751977_753243_+	saccharopine dehydrogenase	NA	NA	NA	NA
AZW77762.1\|753400_754351_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77763.1\|754594_755185_+	polyisoprenoid-binding protein	NA	NA	NA	NA
AZW80540.1\|755200_757645_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW77764.1\|757764_758736_-	hypothetical protein	NA	NA	NA	NA
AZW77765.1\|758867_759392_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AZW77766.1\|759351_760302_-\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
AZW77767.1\|760523_762719_-	DNA methylase	NA	NA	NA	NA
AZW77768.1\|762791_763199_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZW77769.1\|763321_764272_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77770.1\|764387_764831_-	transcriptional regulator	NA	NA	NA	NA
AZW77771.1\|764893_765688_+	DNA-binding response regulator	NA	NA	NA	NA
AZW77772.1\|765853_766990_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.8e-63	44.8
AZW77773.1\|767060_768194_-	GTPase ObgE	NA	NA	NA	NA
AZW77774.1\|768343_768604_-	50S ribosomal protein L27	NA	NA	NA	NA
AZW77775.1\|768637_768949_-	50S ribosomal protein L21	NA	NA	NA	NA
AZW77776.1\|769373_770522_+	fumarylacetoacetate hydrolase	NA	NA	NA	NA
AZW77777.1\|770636_771602_+	octaprenyl diphosphate synthase	NA	NA	NA	NA
AZW77778.1\|771870_772737_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77779.1\|772867_774916_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW77780.1\|774933_776931_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW77781.1\|776965_778303_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW77782.1\|778565_780419_+	hypothetical protein	NA	NA	NA	NA
AZW77783.1\|780473_781955_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW77784.1\|781970_782558_-	cyclolysin-activating lysine-acyltransferase CyaC	NA	NA	NA	NA
AZW80541.1\|782640_782820_+	hypothetical protein	NA	NA	NA	NA
AZW77785.1\|783006_788127_+	bifunctional adenylate cyclase toxin/hemolysin CyaA	NA	NA	NA	NA
AZW77786.1\|788204_790343_+	cyclolysin secretion/processing ATP-binding protein CyaB	W8CYL7	Bacillus_phage	2.7e-45	29.2
AZW77787.1\|790339_791662_+	protein CyaD	NA	NA	NA	NA
AZW77788.1\|791663_793088_+	protein CyaE	NA	NA	NA	NA
AZW77789.1\|793178_794087_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77790.1\|794151_795066_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW77791.1\|795903_796587_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW77792.1\|796603_797347_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-32	42.4
AZW77793.1\|797376_798237_+	aminotransferase	NA	NA	NA	NA
AZW77794.1\|798244_798811_-	hypothetical protein	NA	NA	NA	NA
AZW77795.1\|798899_799856_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77796.1\|799900_800653_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW77797.1\|800649_802395_-	acetolactate synthase catalytic subunit	NA	NA	NA	NA
AZW77798.1\|802479_803214_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW77799.1\|803530_804553_+	autotransporter domain-containing protein	NA	NA	NA	NA
AZW77800.1\|804568_805291_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW77801.1\|805435_806443_-	zinc-binding dehydrogenase	NA	NA	NA	NA
AZW77802.1\|806483_808016_-	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
AZW77803.1\|808012_809131_-	DUF2817 domain-containing protein	NA	NA	NA	NA
AZW77804.1\|809127_809910_-	ABC transporter permease	NA	NA	NA	NA
AZW77805.1\|809921_810785_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-34	38.9
AZW80542.1\|810803_811901_-	hypothetical protein	NA	NA	NA	NA
AZW77806.1\|811969_812896_-	VOC family protein	NA	NA	NA	NA
AZW77807.1\|812930_814625_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW77808.1\|814824_815760_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AZW77809.1\|815865_816816_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77810.1\|816914_817571_-	DUF4136 domain-containing protein	NA	NA	NA	NA
AZW77811.1\|817718_820427_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.8e-15	24.0
AZW77812.1\|820436_821456_+	fructose 1,6-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.5e-49	35.7
AZW77813.1\|821452_822403_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

855150 : 904414

Vibrio_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77842.1\|855150_856101_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80543.1\|856073_856673_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW77843.1\|856674_857109_+	PaaI family thioesterase	NA	NA	NA	NA
AZW77844.1\|857105_857540_+	hypothetical protein	NA	NA	NA	NA
AZW77845.1\|857523_858327_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AZW77846.1\|858343_859159_-	DNA repair exonuclease	NA	NA	NA	NA
AZW77847.1\|859155_859971_-	diacylglycerol kinase	NA	NA	NA	NA
AZW77848.1\|860117_860819_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77849.1\|860846_862805_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AZW77850.1\|862887_863838_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77851.1\|864058_864727_+	transcriptional regulator	NA	NA	NA	NA
AZW77852.1\|864850_865957_+	MexH family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW77853.1\|865969_869083_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.5e-57	21.5
AZW77854.1\|869079_870573_+	RND transporter	NA	NA	NA	NA
AZW77855.1\|870587_871259_+	transcriptional regulator	NA	NA	NA	NA
AZW77856.1\|871302_871797_-	azurin	NA	NA	NA	NA
AZW77857.1\|871937_872585_-	transcriptional regulator	NA	NA	NA	NA
AZW80544.1\|872688_874737_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW77858.1\|874733_876746_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW77859.1\|876771_878106_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW77860.1\|878214_879207_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77861.1\|879273_881358_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZW77862.1\|881382_882354_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77863.1\|882482_883484_-	peptidase M14	NA	NA	NA	NA
AZW77864.1\|883517_884759_-	cystathionine beta-lyase	NA	NA	NA	NA
AZW77865.1\|884839_885763_+	transcriptional regulator LrhA	NA	NA	NA	NA
AZW77866.1\|885840_886665_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW77867.1\|886861_887878_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW77868.1\|888074_889058_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77869.1\|890656_892045_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW77870.1\|892075_893065_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77871.1\|893175_894408_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW77872.1\|894689_895490_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW77873.1\|895512_897744_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZW77874.1\|898531_898978_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZW77875.1\|898999_899746_-	triose-phosphate isomerase	NA	NA	NA	NA
AZW77876.1\|899889_900867_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZW77877.1\|901500_902112_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZW77878.1\|902105_903323_-	threonine ammonia-lyase	NA	NA	NA	NA
AZW77879.1\|903463_904414_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

914026 : 978966

Bacillus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77888.1\|914026_914977_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77889.1\|914973_916824_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.4
AZW77890.1\|917204_917864_+	thiopurine S-methyltransferase	NA	NA	NA	NA
AZW77891.1\|917951_918104_+	hypothetical protein	NA	NA	NA	NA
AZW77892.1\|918212_918380_+	hypothetical protein	NA	NA	NA	NA
AZW77893.1\|918391_919072_-	DUF3313 domain-containing protein	NA	NA	NA	NA
AZW77894.1\|919353_920070_+	flagellar brake protein	NA	NA	NA	NA
AZW77895.1\|920084_921386_-	phospholipase	NA	NA	NA	NA
AZW77896.1\|923530_926419_+	metal-dependent phosphohydrolase	NA	NA	NA	NA
AZW77897.1\|926642_927995_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW77898.1\|928023_928545_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AZW77899.1\|928541_929996_+	carboxylase	NA	NA	NA	NA
AZW77900.1\|930030_930279_+	hypothetical protein	NA	NA	NA	NA
AZW77901.1\|930384_931260_+	hypothetical protein	NA	NA	NA	NA
AZW77902.1\|931285_932341_+	hypothetical protein	NA	NA	NA	NA
AZW77903.1\|932353_933145_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW77904.1\|933177_934548_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AZW77905.1\|935724_936675_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77906.1\|936727_936949_+	hypothetical protein	NA	NA	NA	NA
AZW77907.1\|937108_937321_+	hypothetical protein	NA	NA	NA	NA
AZW77908.1\|937440_938559_+	mannose-6-phosphate isomerase	NA	NA	NA	NA
AZW77909.1\|938655_938871_+	hypothetical protein	NA	NA	NA	NA
AZW77910.1\|939064_939316_+	hypothetical protein	NA	NA	NA	NA
AZW77911.1\|939428_940379_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77912.1\|940375_940759_-	ferredoxin	NA	NA	NA	NA
AZW77913.1\|940813_942631_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
AZW80546.1\|942777_943605_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
AZW77914.1\|943650_944631_+	aldo/keto reductase	NA	NA	NA	NA
AZW77915.1\|944627_944840_-	hypothetical protein	NA	NA	NA	NA
AZW77916.1\|944836_946018_-	PepSY domain-containing protein	NA	NA	NA	NA
AZW77917.1\|946181_946916_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
AZW77918.1\|946917_949530_-	penicillin-binding protein	NA	NA	NA	NA
AZW77919.1\|949665_951579_-	S9 family peptidase	NA	NA	NA	NA
AZW77920.1\|952194_952605_-	PaaI family thioesterase	NA	NA	NA	NA
AZW77921.1\|952702_953788_+	DNA polymerase IV	NA	NA	NA	NA
AZW77922.1\|953886_954837_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77923.1\|954833_955808_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW77924.1\|955932_956844_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
AZW80547.1\|957120_957513_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZW77925.1\|957642_958593_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77926.1\|958622_958805_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZW77927.1\|958843_959101_-	hypothetical protein	NA	NA	NA	NA
AZW77928.1\|959577_960759_-	MFS transporter	NA	NA	NA	NA
AZW77929.1\|960974_961652_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW77930.1\|961648_962422_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AZW77931.1\|962499_963081_-	OmpA family protein	NA	NA	NA	NA
AZW77932.1\|963451_966133_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZW77933.1\|966132_967266_+	phosphoserine aminotransferase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
AZW77934.1\|967258_968344_+	prephenate dehydratase	NA	NA	NA	NA
AZW77935.1\|968430_969330_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AZW77936.1\|969326_970655_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZW77937.1\|970669_971341_+	cytidylate kinase	NA	NA	NA	NA
AZW77938.1\|971513_973244_+	30S ribosomal protein S1	NA	NA	NA	NA
AZW77939.1\|973245_973605_+	integration host factor subunit beta	NA	NA	NA	NA
AZW77940.1\|973796_974111_+	DUF1049 domain-containing protein	NA	NA	NA	NA
AZW77941.1\|974153_975374_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZW77942.1\|975370_976312_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZW77943.1\|976308_977298_+	ADP-L-glycero-D-mannoheptose-6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZW77944.1\|977332_977917_+	DUF655 domain-containing protein	NA	NA	NA	NA
AZW77945.1\|978015_978966_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

998366 : 1061517

Enterococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW77960.1\|998366_999317_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77961.1\|999421_1000471_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
AZW77962.1\|1000608_1001625_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW77963.1\|1003133_1003706_-	chorismate--pyruvate lyase	NA	NA	NA	NA
AZW77964.1\|1003765_1004497_+	rRNA pseudouridine synthase	NA	NA	NA	NA
AZW80549.1\|1004548_1005466_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW77965.1\|1006273_1009453_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AZW77966.1\|1009449_1010832_+	multidrug transporter	NA	NA	NA	NA
AZW77967.1\|1010901_1011153_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AZW77968.1\|1011298_1011949_-	SCO family protein	NA	NA	NA	NA
AZW77969.1\|1012099_1014214_-	M3 family peptidase	NA	NA	NA	NA
AZW77970.1\|1014289_1015141_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
AZW77971.1\|1015137_1015764_-	DNA-binding response regulator	NA	NA	NA	NA
AZW77972.1\|1015760_1017515_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
AZW77973.1\|1017807_1020513_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AZW77974.1\|1020525_1022187_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
AZW77975.1\|1022199_1023990_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
AZW77976.1\|1024211_1025387_-	flagellin FliC	NA	NA	NA	NA
AZW77977.1\|1025429_1026380_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77978.1\|1026478_1027219_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AZW77979.1\|1027413_1029450_+	transketolase	NA	NA	NA	NA
AZW77980.1\|1029467_1030478_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZW77981.1\|1030595_1031789_+	phosphoglycerate kinase	NA	NA	NA	NA
AZW77982.1\|1031818_1032592_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW77983.1\|1032588_1033779_-	acetate kinase	NA	NA	NA	NA
AZW77984.1\|1033804_1034743_-	phosphate acetyltransferase	NA	NA	NA	NA
AZW80550.1\|1034739_1037088_-	DUF3141 domain-containing protein	NA	NA	NA	NA
AZW77985.1\|1037242_1037950_-	glutathione S-transferase	NA	NA	NA	NA
AZW77986.1\|1037987_1039121_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77987.1\|1039397_1039946_-	damage-inducible protein DinB	NA	NA	NA	NA
AZW77988.1\|1039964_1040450_-	N-acetyltransferase	NA	NA	NA	NA
AZW77989.1\|1040627_1041566_+	curved DNA-binding protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
AZW77990.1\|1041568_1041886_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZW77991.1\|1041931_1042876_+	hypothetical protein	NA	NA	NA	NA
AZW77992.1\|1044556_1045207_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AZW77993.1\|1045260_1045596_+	hypothetical protein	NA	NA	NA	NA
AZW77994.1\|1045592_1046453_+	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
AZW77995.1\|1046469_1046751_-	hypothetical protein	NA	NA	NA	NA
AZW77996.1\|1046824_1047088_-	translation initiation factor IF-1	NA	NA	NA	NA
AZW77997.1\|1047331_1048282_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW77998.1\|1048580_1049318_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AZW77999.1\|1049753_1050077_+	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AZW78000.1\|1050111_1050672_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
AZW78001.1\|1050792_1051668_+	flagellar motor stator protein MotA	NA	NA	NA	NA
AZW78002.1\|1051680_1052628_+	motility protein MotB	NA	NA	NA	NA
AZW78003.1\|1052729_1053023_+	response regulator	NA	NA	NA	NA
AZW78004.1\|1053049_1055107_+	chemotaxis protein CheA	NA	NA	NA	NA
AZW78005.1\|1055121_1055622_+	chemotaxis protein CheW	NA	NA	NA	NA
AZW78006.1\|1055695_1057402_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AZW78007.1\|1058265_1059318_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AZW78008.1\|1059370_1059760_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AZW78009.1\|1059768_1060401_+	protein phosphatase CheZ	NA	NA	NA	NA
AZW78010.1\|1060500_1061517_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1067501 : 1135663

uncultured_Mediterranean_phage(25.0%)

tRNA,holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78015.1\|1067501_1068929_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZW78016.1\|1069866_1070883_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW78017.1\|1071215_1072151_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AZW78018.1\|1072200_1074081_-	protein translocase subunit SecD	NA	NA	NA	NA
AZW78019.1\|1074147_1074492_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AZW78020.1\|1074636_1075773_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZW78021.1\|1075769_1076843_-\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AZW78022.1\|1077000_1078437_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZW80552.1\|1078527_1079169_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZW78023.1\|1079504_1080521_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW78024.1\|1080853_1083601_+	pertactin autotransporter	NA	NA	NA	NA
AZW80553.1\|1083667_1085089_-	siroheme synthase	NA	NA	NA	NA
AZW78025.1\|1085352_1086069_+	hypothetical protein	NA	NA	NA	NA
AZW78026.1\|1086153_1086471_+	DUF883 domain-containing protein	NA	NA	NA	NA
AZW78027.1\|1086511_1086925_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW78028.1\|1086926_1087286_+	hypothetical protein	NA	NA	NA	NA
AZW78029.1\|1087328_1088873_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
AZW78030.1\|1088956_1089787_+	transglycosylase	NA	NA	NA	NA
AZW78031.1\|1089821_1090976_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZW78032.1\|1091018_1091891_+	hypothetical protein	NA	NA	NA	NA
AZW78033.1\|1092007_1094296_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW78034.1\|1095502_1095967_+	barstar family protein 2	NA	NA	NA	NA
AZW78035.1\|1095993_1096944_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80554.1\|1097311_1098088_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-17	28.7
AZW78036.1\|1098132_1098990_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AZW78037.1\|1099011_1100028_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZW78038.1\|1100162_1101203_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
AZW78039.1\|1101397_1103479_-	polyphosphate kinase 1	NA	NA	NA	NA
AZW78040.1\|1103714_1105208_+	exopolyphosphatase	NA	NA	NA	NA
AZW78041.1\|1105438_1106233_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW78042.1\|1106453_1107812_-	phosphoglucosamine mutase	NA	NA	NA	NA
AZW78043.1\|1107808_1108651_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
AZW78044.1\|1108669_1110556_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
AZW78045.1\|1110793_1111426_-	ribosomal RNA large subunit methyltransferase E	NA	NA	NA	NA
AZW78046.1\|1111444_1112047_+	hypothetical protein	NA	NA	NA	NA
AZW78047.1\|1112198_1113149_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78048.1\|1113951_1114752_-	hypothetical protein	NA	NA	NA	NA
AZW78049.1\|1114795_1115782_-	homoserine kinase	NA	NA	NA	NA
AZW78050.1\|1115921_1116935_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AZW78051.1\|1116931_1117882_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78052.1\|1117994_1118453_-	CBS domain-containing protein	NA	NA	NA	NA
AZW78053.1\|1118489_1119803_-	hypothetical protein	NA	NA	NA	NA
AZW78054.1\|1119820_1120192_+	DUF2069 domain-containing protein	NA	NA	NA	NA
AZW78055.1\|1120188_1121652_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
AZW78056.1\|1121744_1122521_+	DNA-binding response regulator	NA	NA	NA	NA
AZW78057.1\|1122502_1125382_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AZW78058.1\|1125564_1126515_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78059.1\|1126682_1127507_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
AZW78060.1\|1127506_1128385_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW78061.1\|1129289_1130405_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78062.1\|1130412_1131228_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.5e-12	23.7
AZW78063.1\|1131224_1133090_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
AZW78064.1\|1133168_1133801_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW78065.1\|1133797_1134100_-	hypothetical protein	NA	NA	NA	NA
AZW78066.1\|1134142_1135663_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0

DBSCAN-SWA_12

1316904 : 1382333

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78207.1\|1316904_1317855_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78208.1\|1318623_1319262_-	glutathione S-transferase	NA	NA	NA	NA
AZW80565.1\|1320151_1320598_+	glutamate racemase	NA	NA	NA	NA
AZW78209.1\|1320679_1321381_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
AZW78210.1\|1321381_1322149_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
AZW78211.1\|1322145_1323384_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
AZW78212.1\|1323383_1324310_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
AZW78213.1\|1324412_1325528_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78214.1\|1325543_1326494_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78215.1\|1326847_1327429_-	hypothetical protein	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
AZW78216.1\|1327425_1328259_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AZW80566.1\|1328469_1329783_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AZW78217.1\|1329959_1330841_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
AZW78218.1\|1330860_1331712_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
AZW78219.1\|1331764_1332853_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
AZW78220.1\|1332963_1334091_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW80567.1\|1334325_1334937_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW78221.1\|1335035_1335986_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78222.1\|1336207_1336585_-	DUF423 domain-containing protein	NA	NA	NA	NA
AZW80568.1\|1336732_1337230_+	DUF2384 domain-containing protein	NA	NA	NA	NA
AZW78223.1\|1337226_1337754_+	RES domain-containing protein	NA	NA	NA	NA
AZW78224.1\|1337887_1338703_+	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78225.1\|1338715_1339897_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AZW78226.1\|1339944_1340838_-	phosphatidylserine decarboxylase proenzyme	NA	NA	NA	NA
AZW80569.1\|1340964_1341435_-	hypothetical protein	NA	NA	NA	NA
AZW78227.1\|1341560_1342388_-	DUF3298 domain-containing protein	NA	NA	NA	NA
AZW78228.1\|1342416_1343193_-	lipoate--protein ligase family protein	NA	NA	NA	NA
AZW78229.1\|1343189_1343483_-	biotin--protein ligase	NA	NA	NA	NA
AZW78230.1\|1343479_1343944_-	N-acetyltransferase	NA	NA	NA	NA
AZW78231.1\|1343955_1344741_-	thiol:disulfide oxidoreductase	NA	NA	NA	NA
AZW78232.1\|1344766_1345267_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
AZW78233.1\|1345349_1346528_-	DUF1501 domain-containing protein	NA	NA	NA	NA
AZW78234.1\|1348155_1348491_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AZW78235.1\|1348678_1350127_+	CoA transferase	NA	NA	NA	NA
AZW78236.1\|1350184_1350529_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
AZW78237.1\|1350635_1351175_-	peroxiredoxin	NA	NA	NA	NA
AZW78238.1\|1351267_1352218_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78239.1\|1352316_1353267_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78240.1\|1353253_1353736_-	hypothetical protein	NA	NA	NA	NA
AZW78241.1\|1354005_1354437_-	hypothetical protein	NA	NA	NA	NA
AZW78242.1\|1354618_1355023_-	DoxX family protein	NA	NA	NA	NA
AZW78243.1\|1356259_1356583_+	hypothetical protein	NA	NA	NA	NA
AZW78244.1\|1356585_1357473_-	aldo/keto reductase	NA	NA	NA	NA
AZW78245.1\|1357505_1357931_-	universal stress protein	NA	NA	NA	NA
AZW78246.1\|1358002_1358356_-	hypothetical protein	NA	NA	NA	NA
AZW78247.1\|1358595_1359102_-	hypothetical protein	NA	NA	NA	NA
AZW78248.1\|1359140_1360472_-	transcriptional regulator PtsJ	NA	NA	NA	NA
AZW78249.1\|1360531_1361347_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AZW78250.1\|1361343_1362198_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AZW80570.1\|1365260_1367804_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
AZW78251.1\|1369170_1370925_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
AZW78252.1\|1370921_1373042_-	glycogen debranching enzyme GlgX	NA	NA	NA	NA
AZW78253.1\|1373046_1375242_-	1,4-alpha-glucan-branching protein	NA	NA	NA	NA
AZW80571.1\|1375238_1378580_-	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
AZW78254.1\|1381382_1382333_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1446931 : 1502419

Mollivirus(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78306.1\|1446931_1447882_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78307.1\|1449083_1449530_-	flagellar export protein FliJ	NA	NA	NA	NA
AZW78308.1\|1449522_1450998_-	flagellar protein export ATPase FliI	NA	NA	NA	NA
AZW78309.1\|1450994_1451750_-	flagellar assembly protein FliH	NA	NA	NA	NA
AZW78310.1\|1451742_1452753_-	flagellar motor switch protein FliG	NA	NA	NA	NA
AZW78311.1\|1452742_1454419_-	flagellar basal body M-ring protein FliF	NA	NA	NA	NA
AZW78312.1\|1454731_1455064_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
AZW78313.1\|1455077_1455473_-	hypothetical protein	NA	NA	NA	NA
AZW78314.1\|1455482_1455809_-	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
AZW78315.1\|1455805_1456132_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW78316.1\|1456058_1457081_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW78317.1\|1457077_1457458_-	flagellar protein FliT	NA	NA	NA	NA
AZW78318.1\|1457475_1457904_-	flagellar export chaperone FliS	NA	NA	NA	NA
AZW78319.1\|1457911_1459285_-	flagellar hook protein FliD	NA	NA	NA	NA
AZW80575.1\|1459425_1459803_-	flagellar protein	NA	NA	NA	NA
AZW78320.1\|1460065_1461373_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
AZW78321.1\|1461433_1462264_+	SPOR domain-containing protein	NA	NA	NA	NA
AZW78322.1\|1462260_1462749_+	colicin V synthesis protein	NA	NA	NA	NA
AZW78323.1\|1462790_1464311_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.8e-97	43.7
AZW80576.1\|1464354_1464831_-	disulfide bond formation protein B	NA	NA	NA	NA
AZW78324.1\|1465634_1468232_-	bifunctional uridylyltransferase/uridylyl-removing protein	NA	NA	NA	NA
AZW78325.1\|1468261_1469083_-	type I methionyl aminopeptidase	NA	NA	NA	NA
AZW78326.1\|1469809_1470559_+	30S ribosomal protein S2	NA	NA	NA	NA
AZW78327.1\|1470691_1471621_+	elongation factor Ts	NA	NA	NA	NA
AZW78328.1\|1471718_1472435_+	UMP kinase	NA	NA	NA	NA
AZW78329.1\|1472449_1473010_+	ribosome-recycling factor	NA	NA	NA	NA
AZW78330.1\|1473047_1473941_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.0e-18	36.1
AZW78331.1\|1473960_1474818_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AZW78332.1\|1474814_1476014_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
AZW78333.1\|1476053_1477388_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AZW78334.1\|1477440_1479777_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
AZW80577.1\|1479902_1480466_+	outer membrane protein chaperone	NA	NA	NA	NA
AZW78335.1\|1480474_1481566_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
AZW78336.1\|1481637_1482093_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZW78337.1\|1482093_1482888_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZW78338.1\|1482884_1484066_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
AZW78339.1\|1484052_1484658_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	8.8e-26	40.2
AZW78340.1\|1484654_1485428_+	RNA methyltransferase	NA	NA	NA	NA
AZW78341.1\|1485439_1486267_-	phosphoenolpyruvate synthase regulatory protein	NA	NA	NA	NA
AZW78342.1\|1486428_1488792_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.2e-165	35.9
AZW78343.1\|1488859_1489579_-	GMP synthase	NA	NA	NA	NA
AZW78344.1\|1489702_1490128_+	NfeD-like family protein 1	NA	NA	NA	NA
AZW78345.1\|1490162_1491113_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78346.1\|1491230_1492157_+	paraslipin	NA	NA	NA	NA
AZW78347.1\|1492222_1493380_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AZW78348.1\|1493360_1493828_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AZW78349.1\|1493975_1494926_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78350.1\|1494942_1495377_+	ubiquinone-binding protein	NA	NA	NA	NA
AZW78351.1\|1495366_1495717_+	RnfH family protein	NA	NA	NA	NA
AZW78352.1\|1495913_1497068_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW78353.1\|1497064_1498237_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW78354.1\|1498284_1499178_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AZW78355.1\|1499223_1499661_+	PaaI family thioesterase	NA	NA	NA	NA
AZW78356.1\|1499720_1500410_+	VIT family protein	NA	NA	NA	NA
AZW78357.1\|1500419_1501370_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78358.1\|1501468_1502419_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1541742 : 1599824

Planktothrix_phage(15.38%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78391.1\|1541742_1542555_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AZW78392.1\|1542699_1543794_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78393.1\|1544005_1544635_+	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78394.1\|1544637_1546305_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW78395.1\|1546319_1546976_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
AZW78396.1\|1547455_1548406_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78397.1\|1548432_1549206_+	peroxide stress protein YaaA	NA	NA	NA	NA
AZW78398.1\|1549217_1550459_+	MFS transporter	NA	NA	NA	NA
AZW78399.1\|1552240_1553191_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78400.1\|1553222_1554320_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.5e-20	37.3
AZW78401.1\|1554316_1555267_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78402.1\|1555688_1556081_-	hypothetical protein	NA	NA	NA	NA
AZW78403.1\|1556086_1556863_-	DNA-binding response regulator	NA	NA	NA	NA
AZW78404.1\|1557250_1559200_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.1e-125	36.0
AZW78405.1\|1559220_1559766_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.1e-14	29.9
AZW78406.1\|1559902_1560859_+	glutathione synthetase	NA	NA	NA	NA
AZW78407.1\|1560869_1561268_+	PTS mannose transporter subunit IIA	NA	NA	NA	NA
AZW78408.1\|1561383_1561653_+	HPr family phosphocarrier protein	NA	NA	NA	NA
AZW78409.1\|1561774_1563469_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AZW78410.1\|1563633_1563858_-	hypothetical protein	NA	NA	NA	NA
AZW78411.1\|1564456_1565407_+	ornithine cyclodeaminase	NA	NA	NA	NA
AZW78412.1\|1565448_1566609_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78413.1\|1566769_1567690_+	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
AZW78414.1\|1567702_1568344_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
AZW78415.1\|1568340_1569012_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
AZW78416.1\|1569008_1569779_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-29	39.5
AZW78417.1\|1569877_1570828_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78418.1\|1571044_1571449_-	GFA family protein	NA	NA	NA	NA
AZW78419.1\|1571522_1572713_-	formate dehydrogenase	NA	NA	NA	NA
AZW78420.1\|1572746_1573073_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
AZW78421.1\|1573095_1573611_-	transporter	NA	NA	NA	NA
AZW78422.1\|1573669_1574896_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	5.2e-134	58.8
AZW78423.1\|1575073_1576204_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW78424.1\|1576438_1577020_+	MOSC domain-containing protein	NA	NA	NA	NA
AZW78425.1\|1577156_1578221_+	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
AZW78426.1\|1578305_1578752_-	GFA family protein	NA	NA	NA	NA
AZW78427.1\|1578976_1579858_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.8e-51	36.1
AZW78428.1\|1579912_1580164_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
AZW78429.1\|1580166_1580568_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
AZW78430.1\|1580587_1580824_+	hypothetical protein	NA	NA	NA	NA
AZW78431.1\|1580831_1581311_+	disulfide bond formation protein B	NA	NA	NA	NA
AZW78432.1\|1581496_1581976_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.5e-16	42.5
AZW78433.1\|1581978_1583169_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AZW78434.1\|1583173_1584226_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	4.8e-35	37.8
AZW78435.1\|1584362_1585385_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.6e-67	40.7
AZW78436.1\|1585476_1586313_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW78437.1\|1586505_1587411_+	agmatinase	NA	NA	NA	NA
AZW78438.1\|1587437_1588229_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78439.1\|1588251_1588944_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW78440.1\|1588965_1589718_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-29	39.7
AZW78441.1\|1589846_1591406_+	acetolactate synthase large subunit	NA	NA	NA	NA
AZW78442.1\|1591437_1591983_+	acyl dehydratase	NA	NA	NA	NA
AZW78443.1\|1592120_1593377_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW78444.1\|1593393_1595088_-	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	3.8e-26	24.5
AZW78445.1\|1595245_1596133_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.4e-18	28.7
AZW78446.1\|1596170_1597103_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.3e-25	29.5
AZW80579.1\|1597116_1597605_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AZW78447.1\|1597722_1598301_+\|protease	protease	NA	NA	NA	NA
AZW78448.1\|1598373_1598775_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AZW78449.1\|1598873_1599824_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1655027 : 1726181

Ectocarpus_siliculosus_virus(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78496.1\|1655027_1655978_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78497.1\|1655999_1657220_+	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
AZW78498.1\|1657405_1658818_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZW78499.1\|1658881_1659949_+	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZW78500.1\|1659945_1661436_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZW80582.1\|1661445_1662390_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78501.1\|1662549_1663248_+	pirin family protein	NA	NA	NA	NA
AZW78502.1\|1663325_1664231_+	pirin family protein	NA	NA	NA	NA
AZW78503.1\|1664250_1665201_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78504.1\|1665299_1666094_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AZW78505.1\|1666098_1667769_-	iron ABC transporter permease	NA	NA	NA	NA
AZW78506.1\|1667892_1668942_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78507.1\|1669263_1670040_+	ferredoxin--NADP reductase	NA	NA	NA	NA
AZW78508.1\|1670104_1671007_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78509.1\|1672300_1673104_+	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AZW78510.1\|1675797_1676184_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
AZW78511.1\|1676199_1678290_+	DNA helicase RecG	NA	NA	NA	NA
AZW78512.1\|1678341_1679295_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AZW80583.1\|1679309_1680197_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78513.1\|1680334_1681861_+	methylmalonate-semialdehyde dehydrogenase (CoA acylating)	NA	NA	NA	NA
AZW80584.1\|1681959_1682460_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AZW78514.1\|1682783_1684739_-	capsular biosynthesis protein	NA	NA	NA	NA
AZW78515.1\|1684906_1686991_-	hypothetical protein	NA	NA	NA	NA
AZW78516.1\|1687017_1687803_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-12	32.0
AZW78517.1\|1688658_1689429_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AZW78518.1\|1689428_1690169_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW78519.1\|1690210_1691380_+	capsule biosynthesis protein	NA	NA	NA	NA
AZW78520.1\|1691411_1693496_+	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AZW78521.1\|1693492_1694383_+	capsular biosynthesis protein	NA	NA	NA	NA
AZW78522.1\|1694379_1695477_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW78523.1\|1695499_1696789_+	nucleotide sugar dehydrogenase	NA	NA	NA	NA
AZW78524.1\|1696800_1697826_+	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AZW78525.1\|1697822_1699880_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW78526.1\|1699893_1701069_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZW78527.1\|1701150_1702101_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78528.1\|1702159_1702933_+	oxidoreductase	NA	NA	NA	NA
AZW78529.1\|1702925_1704482_+	LTA synthase family protein	NA	NA	NA	NA
AZW78530.1\|1704478_1705429_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78531.1\|1706755_1707358_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW78532.1\|1707597_1708299_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW78533.1\|1708292_1709075_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZW78534.1\|1709259_1710210_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78535.1\|1710308_1711046_-	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZW78536.1\|1711235_1711994_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW78537.1\|1712040_1713030_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW78538.1\|1713207_1714176_-	transporter	NA	NA	NA	NA
AZW78539.1\|1715715_1716684_+	AAA family ATPase	NA	NA	NA	NA
AZW78540.1\|1716692_1717634_+	DUF58 domain-containing protein	NA	NA	NA	NA
AZW78541.1\|1718107_1719118_+	hypothetical protein	NA	NA	NA	NA
AZW80585.1\|1719108_1720623_+	VWA domain-containing protein	NA	NA	NA	NA
AZW78542.1\|1720619_1721966_+	hypothetical protein	NA	NA	NA	NA
AZW80586.1\|1721968_1723003_+	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
AZW78543.1\|1723052_1724678_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZW78544.1\|1725230_1726181_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1746972 : 1808320

uncultured_Caudovirales_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78558.1\|1746972_1747923_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80592.1\|1748216_1748939_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AZW78559.1\|1749377_1750565_-	MFS transporter	NA	NA	NA	NA
AZW78560.1\|1750568_1750949_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AZW78561.1\|1752668_1753640_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW78562.1\|1753653_1754367_+	NAD-dependent oxidoreductase	NA	NA	NA	NA
AZW78563.1\|1754371_1755289_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78564.1\|1755395_1755692_+	hypothetical protein	NA	NA	NA	NA
AZW78565.1\|1755790_1756741_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78566.1\|1757899_1760833_+	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AZW78567.1\|1760832_1761177_+	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AZW78568.1\|1761173_1762802_+	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AZW78569.1\|1762798_1763278_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AZW78570.1\|1763274_1763559_+	K+/H+ antiporter subunit F	NA	NA	NA	NA
AZW78571.1\|1763555_1763882_+	cation:proton antiporter	NA	NA	NA	NA
AZW78572.1\|1764037_1764988_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78573.1\|1765031_1765574_+	hypothetical protein	NA	NA	NA	NA
AZW78574.1\|1765671_1766520_+	hydrolase	NA	NA	NA	NA
AZW78575.1\|1766512_1767019_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.4e-07	38.4
AZW78576.1\|1767015_1768017_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
AZW78577.1\|1768029_1768824_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW78578.1\|1768872_1770774_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW78579.1\|1770770_1771394_-	hypothetical protein	NA	NA	NA	NA
AZW78580.1\|1771520_1772645_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78581.1\|1772962_1774630_+	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.6e-53	28.9
AZW78582.1\|1774785_1775562_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
AZW78583.1\|1775646_1776645_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78584.1\|1776641_1777415_+	ABC transporter permease	NA	NA	NA	NA
AZW78585.1\|1778399_1779350_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78586.1\|1779373_1779838_-	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
AZW78587.1\|1779984_1781193_+	flavohemoprotein	NA	NA	NA	NA
AZW78588.1\|1781203_1781674_+	DNA-binding protein	NA	NA	NA	NA
AZW78589.1\|1781792_1783082_+	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW78590.1\|1785822_1786773_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78591.1\|1786871_1787888_-	folate-binding protein	NA	NA	NA	NA
AZW78592.1\|1788054_1789101_+	endolytic transglycosylase MltG	NA	NA	NA	NA
AZW78593.1\|1789097_1789724_+	thymidylate kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
AZW78594.1\|1789720_1790773_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
AZW78595.1\|1790822_1791593_+	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW78596.1\|1791643_1792480_+	hypothetical protein	NA	NA	NA	NA
AZW78597.1\|1792675_1793416_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW78598.1\|1793490_1794234_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78599.1\|1794895_1795669_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	37.7
AZW78600.1\|1796806_1798096_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AZW78601.1\|1799706_1800954_-	Zn-dependent hydrolase	NA	NA	NA	NA
AZW78602.1\|1800963_1802673_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
AZW78603.1\|1802669_1803608_-	CoA ester lyase	NA	NA	NA	NA
AZW78604.1\|1803604_1804888_-	TRAP transporter large permease	NA	NA	NA	NA
AZW78605.1\|1804891_1805374_-	TRAP transporter small permease	NA	NA	NA	NA
AZW78606.1\|1805374_1806361_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78607.1\|1806533_1807253_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW78608.1\|1807369_1808320_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

1989505 : 2059157

Staphylococcus_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78741.1\|1989505_1992163_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	3.3e-173	39.0
AZW78742.1\|1992240_1993443_-	MFS transporter	NA	NA	NA	NA
AZW78743.1\|1993439_1993952_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW80600.1\|1994074_1994413_-	DNA-binding protein	NA	NA	NA	NA
AZW78744.1\|1994788_1995739_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78745.1\|1995837_1996788_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78746.1\|1996951_1998847_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	2.3e-19	27.5
AZW78747.1\|1998960_1999128_-	50S ribosomal protein L33	NA	NA	NA	NA
AZW78748.1\|1999191_1999428_-	50S ribosomal protein L28	NA	NA	NA	NA
AZW78749.1\|1999796_2000996_-	Bcr/CflA family drug resistance efflux transporter	NA	NA	NA	NA
AZW78750.1\|2002511_2003462_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78751.1\|2003913_2004915_+	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78752.1\|2005087_2005945_+	ABC transporter permease	NA	NA	NA	NA
AZW78753.1\|2005941_2007204_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.8e-28	36.6
AZW78754.1\|2007304_2007679_+	4-oxalocrotonate tautomerase	NA	NA	NA	NA
AZW78755.1\|2007727_2008939_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW78756.1\|2009023_2009794_+	spermidine synthase	NA	NA	NA	NA
AZW78757.1\|2009907_2010672_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW80601.1\|2010787_2011924_+	malonyl-CoA decarboxylase	NA	NA	NA	NA
AZW78758.1\|2011920_2012727_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW78759.1\|2014471_2015443_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW78760.1\|2015599_2016112_+	superoxide dismutase [Cu-Zn] SodC1	Q9MC02	Salmonella_phage	1.8e-43	52.3
AZW78761.1\|2016270_2017245_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78762.1\|2018245_2019040_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	5.1e-05	25.7
AZW80602.1\|2019065_2019872_-	molybdenum-dependent transcriptional regulator	NA	NA	NA	NA
AZW78763.1\|2019982_2020573_+	DUF4136 domain-containing protein	NA	NA	NA	NA
AZW78764.1\|2020583_2021762_+	hypothetical protein	NA	NA	NA	NA
AZW78765.1\|2021864_2022239_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZW78766.1\|2022491_2023823_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW78767.1\|2023889_2027120_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AZW78768.1\|2028610_2029357_+	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
AZW78769.1\|2029441_2029903_+	holo-ACP synthase	NA	NA	NA	NA
AZW78770.1\|2029940_2030999_+	beta-hexosaminidase	NA	NA	NA	NA
AZW78771.1\|2030961_2032791_+	UvrABC system protein C	NA	NA	NA	NA
AZW78772.1\|2032830_2033403_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
AZW78773.1\|2034827_2035739_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	5.9e-42	37.6
AZW78774.1\|2035967_2037290_+	isocitrate lyase	NA	NA	NA	NA
AZW78775.1\|2037649_2038285_+	hypothetical protein	NA	NA	NA	NA
AZW78776.1\|2038244_2039195_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78777.1\|2040065_2040938_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW78778.1\|2041015_2042155_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW78779.1\|2042504_2043770_+	ring-hydroxylating oxygenase subunit alpha	NA	NA	NA	NA
AZW78780.1\|2043775_2044303_+	ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
AZW78781.1\|2044307_2045126_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW78782.1\|2045125_2045848_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW78783.1\|2045869_2046184_+	ferredoxin	NA	NA	NA	NA
AZW78784.1\|2046180_2047350_+	CoA transferase	NA	NA	NA	NA
AZW78785.1\|2047380_2048256_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW78786.1\|2048252_2049572_-	phenylacetate--CoA ligase family protein	NA	NA	NA	NA
AZW78787.1\|2049644_2050841_-	acetyl-CoA acetyltransferase	NA	NA	NA	NA
AZW78788.1\|2050851_2052339_-	hypothetical protein	NA	NA	NA	NA
AZW78789.1\|2054933_2055833_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78790.1\|2055970_2056936_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW78791.1\|2057034_2057985_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78792.1\|2058028_2058220_+	hypothetical protein	NA	NA	NA	NA
AZW78793.1\|2058206_2059157_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2070653 : 2120049

Erysipelothrix_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78805.1\|2070653_2071604_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78806.1\|2072741_2073038_-	hypothetical protein	NA	NA	NA	NA
AZW78807.1\|2073212_2074565_+	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-45	27.6
AZW78808.1\|2074707_2075724_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW80604.1\|2077703_2078717_-	flavin-nucleotide-binding protein	NA	NA	NA	NA
AZW78809.1\|2078803_2079709_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78810.1\|2079865_2080210_+	hypothetical protein	NA	NA	NA	NA
AZW78811.1\|2080367_2080826_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
AZW78812.1\|2080839_2083056_+	xanthine dehydrogenase family protein molybdopterin-binding subunit	NA	NA	NA	NA
AZW78813.1\|2083052_2084114_+	hypothetical protein	NA	NA	NA	NA
AZW78814.1\|2084142_2085117_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW78815.1\|2085068_2085887_-	hypothetical protein	A0A1B1INV8	uncultured_Mediterranean_phage	2.3e-16	28.8
AZW78816.1\|2085899_2086508_-	peptidase S16	NA	NA	NA	NA
AZW78817.1\|2086682_2087078_+	VOC family protein	NA	NA	NA	NA
AZW78818.1\|2087096_2088536_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	7.4e-55	37.4
AZW78819.1\|2088564_2088912_+	GFA family protein	NA	NA	NA	NA
AZW78820.1\|2088930_2089881_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78821.1\|2090533_2091484_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78822.1\|2091567_2093385_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
AZW78823.1\|2093458_2094106_+	hypothetical protein	NA	NA	NA	NA
AZW78824.1\|2094118_2095048_-	ZIP family metal transporter	NA	NA	NA	NA
AZW78825.1\|2095217_2095682_+	hypothetical protein	NA	NA	NA	NA
AZW78826.1\|2095929_2096610_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW78827.1\|2096658_2098350_+	sodium-independent anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.0e-42	27.3
AZW78828.1\|2098365_2098917_-	ATPase	NA	NA	NA	NA
AZW78829.1\|2098913_2099285_-	transcriptional regulator	NA	NA	NA	NA
AZW78830.1\|2099397_2100234_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW78831.1\|2100244_2100769_-	DUF302 domain-containing protein	NA	NA	NA	NA
AZW78832.1\|2100866_2101046_+	DUF3008 domain-containing protein	NA	NA	NA	NA
AZW78833.1\|2101175_2102207_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW78834.1\|2102280_2102637_+	DUF1428 domain-containing protein	NA	NA	NA	NA
AZW80605.1\|2102626_2103502_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
AZW78835.1\|2103600_2104485_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78836.1\|2104506_2105802_-	DUF445 domain-containing protein	NA	NA	NA	NA
AZW78837.1\|2106750_2107401_+	flavodoxin family protein	NA	NA	NA	NA
AZW80606.1\|2107488_2109009_-	aldehyde dehydrogenase	NA	NA	NA	NA
AZW78838.1\|2109266_2111132_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AZW78839.1\|2112177_2113128_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78840.1\|2114100_2114460_-	CidA/LrgA family protein	NA	NA	NA	NA
AZW78841.1\|2114447_2115884_-	dethiobiotin synthase	NA	NA	NA	NA
AZW78842.1\|2115880_2116534_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW78843.1\|2116530_2117730_-	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
AZW78844.1\|2117827_2119102_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.6e-14	28.9
AZW78845.1\|2119098_2120049_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2131253 : 2171944

Klosneuvirus(25.0%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78859.1\|2131253_2132204_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78860.1\|2132302_2133253_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78861.1\|2133212_2133626_-	transcriptional regulator	A0A222YXG1	Escherichia_phage	3.8e-36	59.0
AZW78862.1\|2133910_2134210_+	hypothetical protein	NA	NA	NA	NA
AZW80608.1\|2134619_2136788_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	3.1e-36	30.1
AZW78863.1\|2137587_2139618_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	1.0e-65	41.9
AZW78864.1\|2139637_2139850_-	30S ribosomal protein S21	NA	NA	NA	NA
AZW78865.1\|2140127_2140667_-	phosphoribosyltransferase	NA	NA	NA	NA
AZW78866.1\|2140780_2142088_-	adenylosuccinate synthetase	A0A160ER07	Powai_lake_megavirus	3.0e-63	33.5
AZW78867.1\|2142152_2143310_-	ATP phosphoribosyltransferase regulatory subunit	NA	NA	NA	NA
AZW78868.1\|2143493_2144393_-\|protease	protease modulator HflC	NA	NA	NA	NA
AZW78869.1\|2144411_2145716_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
AZW78870.1\|2145681_2146788_-	GTPase HflX	NA	NA	NA	NA
AZW78871.1\|2146875_2147112_-	RNA-binding protein Hfq	NA	NA	NA	NA
AZW78872.1\|2147250_2148321_-	histidinol-phosphate aminotransferase 1	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
AZW78873.1\|2148324_2149680_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
AZW78874.1\|2149706_2150867_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
AZW78875.1\|2150869_2151508_-	hypothetical protein	NA	NA	NA	NA
AZW78876.1\|2151509_2152814_-\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
AZW78877.1\|2152854_2154150_-	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)	NA	NA	NA	NA
AZW78878.1\|2154156_2154663_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZW78879.1\|2154659_2155808_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
AZW78880.1\|2155835_2156261_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
AZW78881.1\|2156583_2159466_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
AZW78882.1\|2159558_2160314_-	MipA/OmpV family protein	NA	NA	NA	NA
AZW78883.1\|2161079_2162429_+	two-component sensor histidine kinase	NA	NA	NA	NA
AZW78884.1\|2162527_2163478_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78885.1\|2163576_2164527_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78886.1\|2164600_2165074_+	RidA family protein	NA	NA	NA	NA
AZW78887.1\|2165099_2166308_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
AZW78888.1\|2166304_2167078_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AZW78889.1\|2167077_2167701_-	ribosome maturation factor RimM	NA	NA	NA	NA
AZW78890.1\|2167866_2168127_-	30S ribosomal protein S16	NA	NA	NA	NA
AZW78891.1\|2168430_2169012_+	hypothetical protein	NA	NA	NA	NA
AZW78892.1\|2169078_2169333_-	sulfurtransferase TusA family protein	NA	NA	NA	NA
AZW78893.1\|2169319_2171944_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4

DBSCAN-SWA_20

2199727 : 2260933

Lake_Baikal_phage(21.43%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW78913.1\|2199727_2200678_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78914.1\|2200878_2201688_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW78915.1\|2201812_2202763_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78916.1\|2202759_2203653_-	methylglyoxal synthase	NA	NA	NA	NA
AZW78917.1\|2203777_2203972_-	Fe-S assembly protein IscX	NA	NA	NA	NA
AZW78918.1\|2203971_2204313_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AZW78919.1\|2204322_2206185_-	chaperone protein HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
AZW78920.1\|2206314_2206827_-	co-chaperone protein HscB	NA	NA	NA	NA
AZW78921.1\|2206829_2207153_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
AZW78922.1\|2207154_2207565_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
AZW78923.1\|2207602_2208814_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
AZW78924.1\|2208831_2209344_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
AZW78925.1\|2209559_2210051_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
AZW78926.1\|2210303_2212340_-	UvrABC system protein B	NA	NA	NA	NA
AZW78927.1\|2212417_2213620_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW78928.1\|2213670_2214399_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	2.8e-10	50.7
AZW78929.1\|2215956_2216907_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78930.1\|2217477_2217690_-	hypothetical protein	NA	NA	NA	NA
AZW78931.1\|2217707_2218439_-	hypothetical protein	NA	NA	NA	NA
AZW78932.1\|2218473_2219115_-	CoA transferase subunit B	NA	NA	NA	NA
AZW78933.1\|2219107_2219824_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW78934.1\|2221988_2222765_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW78935.1\|2222786_2223944_-	thiolase	NA	NA	NA	NA
AZW78936.1\|2223940_2224372_-	hypothetical protein	NA	NA	NA	NA
AZW78937.1\|2224368_2225172_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW78938.1\|2225185_2225641_-	MaoC family dehydratase	NA	NA	NA	NA
AZW78939.1\|2225653_2226625_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW78940.1\|2226690_2227914_-	CoA transferase	NA	NA	NA	NA
AZW78941.1\|2228141_2229092_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW78942.1\|2229215_2231669_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZW78943.1\|2231857_2233162_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZW78944.1\|2233266_2233920_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZW78945.1\|2233922_2235233_-	trigger factor	NA	NA	NA	NA
AZW78946.1\|2235411_2235990_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZW78947.1\|2236101_2236302_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZW78948.1\|2236647_2237214_-	DUF924 domain-containing protein	NA	NA	NA	NA
AZW78949.1\|2237297_2237501_-	cold-shock protein CspA	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZW78950.1\|2237807_2238128_-	hypothetical protein	NA	NA	NA	NA
AZW78951.1\|2238169_2238451_-	hypothetical protein	NA	NA	NA	NA
AZW78952.1\|2238525_2239782_-	autotransporter Phg	NA	NA	NA	NA
AZW78953.1\|2240164_2240494_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW78954.1\|2242065_2242887_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZW78955.1\|2242886_2244026_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZW78956.1\|2244032_2244929_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZW78957.1\|2244925_2246851_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZW78958.1\|2247210_2249823_+	TonB-dependent receptor	NA	NA	NA	NA
AZW78959.1\|2249875_2252176_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZW78960.1\|2252172_2253381_-	acyl-CoA desaturase	NA	NA	NA	NA
AZW78961.1\|2253642_2254017_+	hypothetical protein	NA	NA	NA	NA
AZW78962.1\|2254013_2254964_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW78963.1\|2255062_2257057_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.4e-21	33.3
AZW78964.1\|2257116_2258082_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AZW78965.1\|2258071_2260933_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5

DBSCAN-SWA_21

2541027 : 2605243

Salmonella_phage(16.67%)

protease,tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79199.1\|2541027_2542515_-\|protease	serine protease	W5SAB9	Pithovirus	1.2e-07	31.5
AZW79200.1\|2542552_2543614_-	siderophore-interacting protein	NA	NA	NA	NA
AZW79201.1\|2543610_2544111_-	hypothetical protein	NA	NA	NA	NA
AZW79202.1\|2544123_2544723_-	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	2.2e-05	26.1
AZW79203.1\|2544719_2545220_-	hypothetical protein	NA	NA	NA	NA
AZW79204.1\|2545221_2546451_-	beta-ketoacyl-[acyl-carrier-protein] synthase II	NA	NA	NA	NA
AZW80622.1\|2546640_2546880_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	5.4e-11	46.6
AZW79205.1\|2547062_2547815_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	6.9e-12	31.3
AZW79206.1\|2547816_2548752_-	[acyl-carrier-protein] S-malonyltransferase	NA	NA	NA	NA
AZW79207.1\|2548833_2549820_-	3-oxoacyl-ACP synthase III	NA	NA	NA	NA
AZW79208.1\|2549819_2550878_-	phosphate acyltransferase PlsX	NA	NA	NA	NA
AZW79209.1\|2550934_2551117_-	50S ribosomal protein L32	NA	NA	NA	NA
AZW80623.1\|2551168_2551762_-	DUF177 domain-containing protein	NA	NA	NA	NA
AZW79210.1\|2551870_2552470_+	septum formation inhibitor Maf	NA	NA	NA	NA
AZW79211.1\|2552466_2553177_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AZW79212.1\|2553178_2554006_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
AZW79213.1\|2555822_2557064_-	MFS transporter	NA	NA	NA	NA
AZW79214.1\|2557075_2557849_-	peroxide stress protein YaaA	NA	NA	NA	NA
AZW79215.1\|2557875_2558826_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79216.1\|2558924_2559707_-	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW79217.1\|2559795_2561022_-	transporter	NA	NA	NA	NA
AZW79218.1\|2561747_2563133_+	alcaligin biosynthesis enzyme	NA	NA	NA	NA
AZW79219.1\|2563151_2563757_+	N-acetyltransferase	NA	NA	NA	NA
AZW79220.1\|2563753_2565610_+	IucA/IucC family siderophore biosynthesis protein	NA	NA	NA	NA
AZW79221.1\|2565606_2566407_+	siderophore ferric iron reductase	NA	NA	NA	NA
AZW79222.1\|2566421_2567615_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
AZW79223.1\|2567682_2568657_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW79224.1\|2568779_2570003_+	MFS transporter	S4TR35	Salmonella_phage	9.8e-24	29.4
AZW79225.1\|2570113_2572318_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW79226.1\|2572612_2573272_+	antibiotic resistance protein	NA	NA	NA	NA
AZW79227.1\|2573279_2573486_-	hypothetical protein	NA	NA	NA	NA
AZW79228.1\|2573824_2574580_+	GGDEF domain-containing protein	NA	NA	NA	NA
AZW79229.1\|2574595_2574757_-	hypothetical protein	NA	NA	NA	NA
AZW79230.1\|2574850_2575366_+	hypothetical protein	T1SAR8	Salmonella_phage	5.1e-06	44.6
AZW79231.1\|2575638_2575956_+	virulence factor	NA	NA	NA	NA
AZW79232.1\|2576143_2576392_-	hypothetical protein	NA	NA	NA	NA
AZW79233.1\|2576670_2578026_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-83	47.5
AZW79234.1\|2578072_2579452_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-75	38.9
AZW79235.1\|2579514_2580147_-	outer-membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AZW80624.1\|2580146_2582507_-	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	7.6e-81	48.0
AZW79236.1\|2582548_2583508_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.1e-57	40.2
AZW79237.1\|2583494_2584181_+	DNA mismatch repair protein MutS	NA	NA	NA	NA
AZW79238.1\|2584177_2584510_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AZW79239.1\|2584625_2585576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79240.1\|2585674_2586625_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79241.1\|2586621_2588688_-	cation acetate symporter	NA	NA	NA	NA
AZW79242.1\|2588687_2588960_-	DUF4212 domain-containing protein	NA	NA	NA	NA
AZW79243.1\|2589654_2589744_+	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
AZW79244.1\|2589743_2591528_+	potassium-transporting ATPase A chain	NA	NA	NA	NA
AZW79245.1\|2591551_2593717_+	K(+)-transporting ATPase subunit B	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.2e-24	27.1
AZW79246.1\|2593727_2594327_+	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
AZW79247.1\|2597148_2597844_+	two-component system response regulator KdpE	NA	NA	NA	NA
AZW79248.1\|2597852_2598803_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79249.1\|2598901_2600143_-	hypothetical protein	NA	NA	NA	NA
AZW79250.1\|2600292_2601273_-	hypothetical protein	NA	NA	NA	NA
AZW79251.1\|2601471_2602728_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.2e-11	64.8
AZW79252.1\|2602930_2603356_+	DUF1841 domain-containing protein	NA	NA	NA	NA
AZW79253.1\|2603397_2603760_-	cytochrome	NA	NA	NA	NA
AZW79254.1\|2603772_2604126_-	cytochrome C	NA	NA	NA	NA
AZW79255.1\|2604292_2605243_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2684920 : 2725589

Salmonella_phage(33.33%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79323.1\|2684920_2685871_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79324.1\|2685981_2686164_+	hypothetical protein	NA	NA	NA	NA
AZW79325.1\|2686263_2686860_-	lipoprotein	NA	NA	NA	NA
AZW79326.1\|2687043_2688135_+	hypothetical protein	NA	NA	NA	NA
AZW79327.1\|2688634_2689045_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW79328.1\|2689103_2689445_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.8e-13	42.2
AZW79329.1\|2689450_2691868_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW79330.1\|2691880_2692903_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
AZW79331.1\|2692977_2693337_-	50S ribosomal protein L20	NA	NA	NA	NA
AZW79332.1\|2693352_2693550_-	50S ribosomal protein L35	NA	NA	NA	NA
AZW79333.1\|2693885_2694836_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79334.1\|2694822_2695011_-	hypothetical protein	NA	NA	NA	NA
AZW79335.1\|2695030_2695480_+	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AZW79336.1\|2695476_2696427_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79337.1\|2696537_2697986_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW79338.1\|2698100_2698382_-	hypothetical protein	NA	NA	NA	NA
AZW79339.1\|2698485_2699436_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79340.1\|2699680_2700394_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW79341.1\|2700516_2700744_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW79342.1\|2701038_2701677_-	DedA family protein	NA	NA	NA	NA
AZW79343.1\|2701749_2702820_+	metal-dependent hydrolase	NA	NA	NA	NA
AZW79344.1\|2702816_2703767_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79345.1\|2704182_2704707_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZW79346.1\|2704710_2704980_-	hypothetical protein	NA	NA	NA	NA
AZW79347.1\|2705178_2706240_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZW79348.1\|2706323_2707958_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZW79349.1\|2707959_2708763_-	ABC transporter permease	NA	NA	NA	NA
AZW79350.1\|2708791_2709751_-	ABC transporter permease	NA	NA	NA	NA
AZW79351.1\|2709754_2711269_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79352.1\|2711305_2712310_-	peptidase M20	NA	NA	NA	NA
AZW79353.1\|2712741_2713212_-	DUF1801 domain-containing protein	NA	NA	NA	NA
AZW79354.1\|2713247_2713859_-	LysE family translocator	NA	NA	NA	NA
AZW79355.1\|2713889_2714513_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW79356.1\|2714593_2716126_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW79357.1\|2716160_2717402_-	MFS transporter	NA	NA	NA	NA
AZW79358.1\|2717445_2718477_-	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZW79359.1\|2718473_2719643_-	amine oxidase	NA	NA	NA	NA
AZW79360.1\|2719636_2720317_-	anti-sigma factor	NA	NA	NA	NA
AZW79361.1\|2720478_2721321_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW79362.1\|2721483_2722455_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW79363.1\|2722626_2723505_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW79364.1\|2723527_2724598_-	FUSC family protein	NA	NA	NA	NA
AZW79365.1\|2724638_2725589_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

2781054 : 2853924

Moraxella_phage(16.67%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79409.1\|2781054_2781471_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AZW79410.1\|2781581_2782214_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
AZW79411.1\|2782242_2782686_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AZW79412.1\|2782707_2783799_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79413.1\|2783853_2784654_-	aldolase	NA	NA	NA	NA
AZW79414.1\|2784789_2785410_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZW79415.1\|2785549_2786023_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZW79416.1\|2787162_2788113_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79417.1\|2788109_2795771_-	adhesin	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
AZW79418.1\|2796011_2800058_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
AZW79419.1\|2800370_2800952_+	TRAP transporter small permease	NA	NA	NA	NA
AZW79420.1\|2800948_2802247_+	TRAP transporter large permease	NA	NA	NA	NA
AZW79421.1\|2802326_2803355_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW79422.1\|2803278_2803629_+	hypothetical protein	NA	NA	NA	NA
AZW79423.1\|2803615_2804566_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79424.1\|2804562_2805513_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79425.1\|2805829_2806435_+	fimbrial protein FimX	NA	NA	NA	NA
AZW79426.1\|2806488_2807802_-	phenylacetate--CoA ligase	NA	NA	NA	NA
AZW79427.1\|2807876_2808347_-	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AZW79428.1\|2808346_2809135_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AZW79429.1\|2809145_2810798_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AZW79430.1\|2810885_2811836_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80634.1\|2812997_2813504_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AZW79431.1\|2813500_2814265_-	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AZW79432.1\|2814280_2814565_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AZW79433.1\|2814629_2815619_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AZW79434.1\|2815790_2816720_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AZW79435.1\|2816691_2817378_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AZW79436.1\|2817411_2817957_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AZW79437.1\|2818001_2819267_+	peptidase M48	NA	NA	NA	NA
AZW79438.1\|2819263_2820166_+	ribosome biogenesis GTPase	NA	NA	NA	NA
AZW79439.1\|2821347_2822292_-	ABC transporter permease	NA	NA	NA	NA
AZW79440.1\|2822386_2823904_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79441.1\|2823945_2825574_-	gamma-glutamyltransferase	NA	NA	NA	NA
AZW79442.1\|2825681_2826563_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW79443.1\|2829675_2830050_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AZW79444.1\|2830074_2830413_-	P-II family nitrogen regulator	NA	NA	NA	NA
AZW79445.1\|2830456_2832091_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AZW79446.1\|2832129_2833476_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AZW80635.1\|2833583_2835005_+	argininosuccinate lyase	NA	NA	NA	NA
AZW79447.1\|2835074_2835659_-	nitroreductase	NA	NA	NA	NA
AZW79448.1\|2835761_2836712_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79449.1\|2836846_2837953_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW79450.1\|2837963_2839061_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
AZW79451.1\|2839205_2840411_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZW79452.1\|2840417_2840939_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AZW79453.1\|2840935_2841427_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AZW79454.1\|2841423_2841675_-	MoaD/ThiS family protein	NA	NA	NA	NA
AZW79455.1\|2841655_2842141_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
AZW79456.1\|2842276_2845738_+	hypothetical protein	NA	NA	NA	NA
AZW79457.1\|2845734_2846640_+	dienelactone hydrolase family protein	NA	NA	NA	NA
AZW79458.1\|2846649_2847081_-	lipoprotein	NA	NA	NA	NA
AZW80636.1\|2847327_2847831_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AZW79459.1\|2847842_2849309_+	MFS transporter	NA	NA	NA	NA
AZW79460.1\|2849383_2850259_-	hypothetical protein	NA	NA	NA	NA
AZW80637.1\|2850255_2851263_-	biotin synthase	NA	NA	NA	NA
AZW79461.1\|2851730_2852036_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW79462.1\|2852126_2852717_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW79463.1\|2852907_2853924_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

2857067 : 2923877

uncultured_Mediterranean_phage(28.57%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79466.1\|2857067_2858018_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79467.1\|2858116_2859067_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79468.1\|2859063_2859858_-	N-formylglutamate deformylase	NA	NA	NA	NA
AZW79469.1\|2859889_2860594_-	oxidoreductase	NA	NA	NA	NA
AZW79470.1\|2860668_2861469_-	SURF1 family protein	NA	NA	NA	NA
AZW79471.1\|2861465_2861873_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AZW79472.1\|2861869_2862511_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AZW79473.1\|2862503_2864525_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW79474.1\|2865764_2867096_+	MFS transporter	NA	NA	NA	NA
AZW79475.1\|2867092_2868043_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79476.1\|2869749_2870055_-	hypothetical protein	NA	NA	NA	NA
AZW79477.1\|2870723_2871062_+	transcriptional regulator	NA	NA	NA	NA
AZW79478.1\|2875614_2876217_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW79479.1\|2876313_2877603_+	MFS transporter	NA	NA	NA	NA
AZW79480.1\|2877660_2878392_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
AZW79481.1\|2878388_2879192_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
AZW79482.1\|2879188_2880277_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW79483.1\|2880273_2881203_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW79484.1\|2881351_2882497_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79485.1\|2882518_2883469_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79486.1\|2883799_2887621_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW79487.1\|2887777_2888446_-	lipoprotein	NA	NA	NA	NA
AZW79488.1\|2888450_2890124_-	MCE family protein	NA	NA	NA	NA
AZW79489.1\|2890142_2891462_-	paraquat-inducible membrane protein A	NA	NA	NA	NA
AZW79490.1\|2891466_2893818_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.2e-164	41.9
AZW80638.1\|2893837_2896006_-	penicillin-binding protein 1C	NA	NA	NA	NA
AZW79491.1\|2896002_2901192_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
AZW79492.1\|2901281_2901596_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AZW79493.1\|2901823_2902069_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AZW79494.1\|2902163_2902682_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
AZW79495.1\|2902781_2903987_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AZW79496.1\|2904102_2905500_-	chloride channel protein EriC	NA	NA	NA	NA
AZW79497.1\|2905616_2906195_-	superoxide dismutase [Fe]	NA	NA	NA	NA
AZW79498.1\|2906267_2907659_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AZW79499.1\|2907826_2908777_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79500.1\|2909057_2909678_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AZW79501.1\|2909674_2910088_+	biopolymer transporter ExbD	NA	NA	NA	NA
AZW79502.1\|2910084_2911128_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZW79503.1\|2911183_2911372_+	hypothetical protein	NA	NA	NA	NA
AZW79504.1\|2911381_2912146_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZW79505.1\|2912236_2912893_+	adenylate kinase	NA	NA	NA	NA
AZW79506.1\|2912984_2913743_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW79507.1\|2913768_2915370_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZW79508.1\|2915570_2916575_+	DUF4880 domain-containing protein	NA	NA	NA	NA
AZW79509.1\|2916675_2916939_+	30S ribosomal protein S20	NA	NA	NA	NA
AZW79510.1\|2917056_2917833_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZW79511.1\|2918423_2919374_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79512.1\|2921757_2922870_-	malate dehydrogenase	NA	NA	NA	NA
AZW79513.1\|2922926_2923877_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

2954263 : 2993452

Planktothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79542.1\|2954263_2955214_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79543.1\|2955200_2955446_-	hypothetical protein	NA	NA	NA	NA
AZW79544.1\|2955334_2956231_-	inositol monophosphatase	NA	NA	NA	NA
AZW79545.1\|2958508_2960734_+	glycosyl hydrolase	NA	NA	NA	NA
AZW79546.1\|2960898_2961987_+	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZW79547.1\|2961943_2962597_+	ABC transporter permease	NA	NA	NA	NA
AZW79548.1\|2962644_2963442_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79549.1\|2963973_2964924_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79550.1\|2965004_2966153_+	alcohol dehydrogenase	NA	NA	NA	NA
AZW79551.1\|2966209_2967160_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79552.1\|2967146_2967365_-	hypothetical protein	NA	NA	NA	NA
AZW79553.1\|2967258_2967564_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW79554.1\|2967592_2968027_-	DUF126 domain-containing protein	NA	NA	NA	NA
AZW79555.1\|2968028_2969273_-	DUF521 domain-containing protein	NA	NA	NA	NA
AZW79556.1\|2969269_2969980_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW80640.1\|2969994_2970906_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW79557.1\|2971268_2971673_+	hypothetical protein	NA	NA	NA	NA
AZW79558.1\|2971669_2972128_+	hypothetical protein	NA	NA	NA	NA
AZW79559.1\|2972134_2973043_+	hypothetical protein	NA	NA	NA	NA
AZW80641.1\|2973039_2973906_+	sugar ABC transporter permease	NA	NA	NA	NA
AZW79560.1\|2973892_2974720_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW79561.1\|2974730_2975858_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
AZW79562.1\|2976935_2978174_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79563.1\|2978215_2979478_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79564.1\|2979484_2980237_+	DNA-binding protein	NA	NA	NA	NA
AZW79565.1\|2980288_2980474_-	hypothetical protein	NA	NA	NA	NA
AZW80642.1\|2980749_2981214_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AZW79566.1\|2981245_2981905_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AZW79567.1\|2982049_2984158_+	AsmA family protein	NA	NA	NA	NA
AZW79568.1\|2984154_2985105_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79569.1\|2985208_2985829_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW80643.1\|2985932_2986673_+	oxidoreductase	NA	NA	NA	NA
AZW79570.1\|2987807_2988932_-	hypothetical protein	NA	NA	NA	NA
AZW79571.1\|2988977_2989346_-	hypothetical protein	NA	NA	NA	NA
AZW79572.1\|2989587_2990538_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79573.1\|2991573_2992116_-	hypothetical protein	NA	NA	NA	NA
AZW79574.1\|2992320_2992515_+	hypothetical protein	NA	NA	NA	NA
AZW79575.1\|2992501_2993452_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_26

3182371 : 3243400

Xanthomonas_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79726.1\|3182371_3183322_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79727.1\|3183330_3183879_+	phospholipid:lipid A palmitoyltransferase	NA	NA	NA	NA
AZW79728.1\|3183875_3184484_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW79729.1\|3184666_3185137_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW79730.1\|3185143_3186403_-	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW79731.1\|3186455_3187268_-	oxidoreductase	NA	NA	NA	NA
AZW79732.1\|3187382_3187937_+	cysteine dioxygenase	NA	NA	NA	NA
AZW79733.1\|3187946_3188936_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW79734.1\|3189115_3189835_-	VOC family protein	NA	NA	NA	NA
AZW79735.1\|3189851_3192587_-	protein translocase subunit SecA	NA	NA	NA	NA
AZW79736.1\|3192766_3193753_-	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	3.4e-27	51.8
AZW79737.1\|3193794_3194289_+	DUF721 domain-containing protein	NA	NA	NA	NA
AZW79738.1\|3194400_3195324_-	UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase	NA	NA	NA	NA
AZW79739.1\|3195552_3196737_-	cell division protein FtsZ	NA	NA	NA	NA
AZW79740.1\|3196925_3198152_-	cell division protein FtsA	NA	NA	NA	NA
AZW79741.1\|3198156_3198978_-	cell division protein FtsQ	NA	NA	NA	NA
AZW79742.1\|3198990_3199941_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
AZW79743.1\|3199937_3201344_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AZW79744.1\|3201340_3202414_-	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase	NA	NA	NA	NA
AZW79745.1\|3202410_3203604_-	putative lipid II flippase FtsW	NA	NA	NA	NA
AZW79746.1\|3203600_3205133_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
AZW79747.1\|3205129_3206299_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
AZW79748.1\|3206288_3209126_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AZW80659.1\|3209122_3210823_-	penicillin-binding protein 2	NA	NA	NA	NA
AZW79749.1\|3210849_3211128_-	cell division protein FtsL	NA	NA	NA	NA
AZW79750.1\|3211127_3212222_-	ribosomal RNA small subunit methyltransferase H	NA	NA	NA	NA
AZW79751.1\|3212230_3212722_-	transcriptional regulator MraZ	NA	NA	NA	NA
AZW79752.1\|3213461_3215270_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	1.6e-43	28.6
AZW79753.1\|3215309_3216389_-	dihydroorotase	NA	NA	NA	NA
AZW79754.1\|3216385_3217579_-	amidohydrolase	NA	NA	NA	NA
AZW79755.1\|3217728_3218007_+	DNA topoisomerase III	NA	NA	NA	NA
AZW79756.1\|3218335_3218728_-	hypothetical protein	NA	NA	NA	NA
AZW80660.1\|3225452_3225929_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW79757.1\|3226081_3227194_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
AZW79758.1\|3227261_3227822_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AZW79759.1\|3227845_3228178_-	cytochrome C	NA	NA	NA	NA
AZW79760.1\|3228161_3229850_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZW79761.1\|3229969_3230758_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AZW79762.1\|3231465_3232416_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79763.1\|3232860_3233172_-	cell division protein ZapA	NA	NA	NA	NA
AZW79764.1\|3233171_3233702_-	hypothetical protein	NA	NA	NA	NA
AZW79765.1\|3233864_3234815_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79766.1\|3234913_3235864_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79767.1\|3236153_3236618_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AZW79768.1\|3236632_3238138_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
AZW79769.1\|3238391_3239999_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW79770.1\|3240054_3240960_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW79771.1\|3241400_3242351_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79772.1\|3242449_3243400_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_27

3265125 : 3303540

Tupanvirus(16.67%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79794.1\|3265125_3265461_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW79795.1\|3265460_3266303_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZW79796.1\|3266401_3267352_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79797.1\|3267416_3268388_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW79798.1\|3268451_3269471_-	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
AZW80663.1\|3269472_3270846_-	MFS transporter	NA	NA	NA	NA
AZW79799.1\|3271123_3271804_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AZW79800.1\|3271816_3273943_+	lytic transglycosylase	A0A0S2SXL7	Bacillus_phage	5.5e-14	36.6
AZW79801.1\|3273939_3275034_+	CCA-adding enzyme	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
AZW79802.1\|3275048_3276308_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZW79803.1\|3276327_3278052_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.5e-49	32.9
AZW79804.1\|3278290_3279043_-	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
AZW79805.1\|3279181_3280132_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80664.1\|3280444_3281923_+	phospholipase D family protein	NA	NA	NA	NA
AZW79806.1\|3281929_3283039_-	molybdenum import ATP-binding protein ModC	G9BWD6	Planktothrix_phage	7.5e-23	34.5
AZW79807.1\|3283050_3283731_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AZW79808.1\|3283752_3284508_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW80665.1\|3284643_3285528_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW79809.1\|3285615_3286197_+	hypothetical protein	NA	NA	NA	NA
AZW79810.1\|3286289_3286412_-	hypothetical protein	NA	NA	NA	NA
AZW79811.1\|3286457_3286757_-	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW80666.1\|3286908_3287334_-	hypothetical protein	NA	NA	NA	NA
AZW79812.1\|3289540_3290044_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW79813.1\|3290059_3291010_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79814.1\|3290996_3291194_-	hypothetical protein	NA	NA	NA	NA
AZW79815.1\|3291537_3292311_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79816.1\|3292443_3293454_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW79817.1\|3293605_3295261_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW79818.1\|3295315_3295657_-	cupin domain-containing protein	NA	NA	NA	NA
AZW79819.1\|3295670_3297110_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW79820.1\|3297242_3298058_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW79821.1\|3298076_3298265_+	hypothetical protein	NA	NA	NA	NA
AZW79822.1\|3298251_3299202_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79823.1\|3300589_3301537_+	hypothetical protein	NA	NA	NA	NA
AZW79824.1\|3301763_3302504_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW79825.1\|3302589_3303540_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

3378947 : 3432688

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79877.1\|3378947_3379898_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79878.1\|3380302_3380947_-	urease accessory protein UreG	NA	NA	NA	NA
AZW79879.1\|3380971_3381556_-	urease accessory protein UreF	NA	NA	NA	NA
AZW79880.1\|3381656_3382274_-	urease accessory protein UreE	NA	NA	NA	NA
AZW79881.1\|3382276_3383992_-	urease subunit alpha	NA	NA	NA	NA
AZW79882.1\|3383988_3384297_-	urease subunit beta	NA	NA	NA	NA
AZW79883.1\|3384313_3384949_-	urease accessory protein UreJ	NA	NA	NA	NA
AZW79884.1\|3384975_3385278_-	urease subunit gamma	NA	NA	NA	NA
AZW79885.1\|3385378_3386233_-	urease accessory protein UreD	NA	NA	NA	NA
AZW79886.1\|3386814_3387087_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW79887.1\|3387504_3387912_-	GFA family protein	NA	NA	NA	NA
AZW79888.1\|3388281_3389076_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW79889.1\|3389176_3390412_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW79890.1\|3390480_3391497_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW79891.1\|3391493_3392885_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW79892.1\|3392881_3394078_+	MFS transporter	NA	NA	NA	NA
AZW79893.1\|3394074_3395613_-	SpoVR family protein	NA	NA	NA	NA
AZW79894.1\|3395609_3396869_-	hypothetical protein	NA	NA	NA	NA
AZW79895.1\|3398809_3399760_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79896.1\|3400526_3401621_-	CoA transferase	NA	NA	NA	NA
AZW79897.1\|3401613_3402948_-	CoA ligase	NA	NA	NA	NA
AZW79898.1\|3402901_3403585_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW79899.1\|3403610_3404774_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW79900.1\|3404770_3405772_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW79901.1\|3405771_3406644_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW79902.1\|3406640_3407390_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZW79903.1\|3407386_3408178_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZW79904.1\|3408174_3409314_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79905.1\|3409622_3410375_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW79906.1\|3410408_3411191_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW79907.1\|3411194_3411584_+	DNA-binding protein	NA	NA	NA	NA
AZW79908.1\|3412723_3413587_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZW79909.1\|3413622_3414711_+	hypothetical protein	NA	NA	NA	NA
AZW79910.1\|3414707_3415658_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79911.1\|3415644_3416013_-	hypothetical protein	NA	NA	NA	NA
AZW79912.1\|3416011_3418990_+	hypothetical protein	NA	NA	NA	NA
AZW79913.1\|3419916_3420795_+	fatty acid desaturase	NA	NA	NA	NA
AZW79914.1\|3422743_3423694_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79915.1\|3423690_3424158_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZW79916.1\|3424200_3424971_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW79917.1\|3424991_3425792_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZW79918.1\|3425802_3427212_+	lytic transglycosylase	NA	NA	NA	NA
AZW79919.1\|3427306_3428092_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW79920.1\|3428331_3429348_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW79921.1\|3429455_3429848_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AZW79922.1\|3429985_3430666_+	DUF533 domain-containing protein	NA	NA	NA	NA
AZW79923.1\|3430670_3431669_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW79924.1\|3431737_3432688_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_29

3438843 : 3498144

Acinetobacter_phage(27.27%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79928.1\|3438843_3440607_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AZW79929.1\|3440718_3441597_+	septum site-determining protein MinC	NA	NA	NA	NA
AZW79930.1\|3441709_3442525_+	septum site-determining protein MinD	NA	NA	NA	NA
AZW79931.1\|3442528_3442780_+	cell division topological specificity factor	NA	NA	NA	NA
AZW79932.1\|3442864_3443881_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW79933.1\|3444211_3444433_-	hypothetical protein	NA	NA	NA	NA
AZW79934.1\|3446793_3447711_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW79935.1\|3448208_3449417_-	ABC transporter permease	NA	NA	NA	NA
AZW79936.1\|3449496_3451068_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW79937.1\|3451185_3452121_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZW79938.1\|3452309_3453254_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZW79939.1\|3453322_3453538_-	hypothetical protein	NA	NA	NA	NA
AZW79940.1\|3453821_3459539_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZW79941.1\|3459544_3460672_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZW79942.1\|3460727_3461354_+	aminotransferase	NA	NA	NA	NA
AZW79943.1\|3461625_3462642_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW79944.1\|3462737_3463448_-	oxidoreductase	NA	NA	NA	NA
AZW80670.1\|3463444_3464434_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW79945.1\|3464565_3466161_+	acyl-CoA synthetase	NA	NA	NA	NA
AZW79946.1\|3466163_3466901_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW79947.1\|3467056_3467929_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZW79948.1\|3468197_3469418_+	MFS transporter	NA	NA	NA	NA
AZW79949.1\|3469414_3470074_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW79950.1\|3470145_3470778_+	pyridoxine/pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZW79951.1\|3470807_3471326_+	flavin reductase	NA	NA	NA	NA
AZW79952.1\|3471336_3472446_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW79953.1\|3472492_3473347_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZW79954.1\|3473348_3474251_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW79955.1\|3475473_3476424_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79956.1\|3478181_3479171_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79957.1\|3479346_3480135_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZW79958.1\|3480131_3481163_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZW79959.1\|3481181_3481745_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZW79960.1\|3481800_3483321_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZW79961.1\|3483584_3484289_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW79962.1\|3484296_3485034_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZW79963.1\|3485139_3485514_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZW79964.1\|3485556_3486846_+	hypothetical protein	NA	NA	NA	NA
AZW79965.1\|3486842_3488012_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZW79966.1\|3488008_3488848_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
AZW79967.1\|3488907_3489843_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZW79968.1\|3489855_3490806_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79969.1\|3490904_3491867_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZW79970.1\|3491898_3492258_-	dihydroneopterin aldolase	NA	NA	NA	NA
AZW79971.1\|3492382_3493285_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZW79972.1\|3493286_3495059_-	PDZ domain-containing protein	NA	NA	NA	NA
AZW79973.1\|3495093_3495870_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW79974.1\|3497193_3498144_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_30

3513082 : 3571155

Planktothrix_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW79986.1\|3513082_3514033_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW79987.1\|3514161_3515295_-	peptidase	NA	NA	NA	NA
AZW79988.1\|3515338_3516244_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW79989.1\|3516246_3517947_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
AZW79990.1\|3517943_3518864_-	ABC transporter permease	NA	NA	NA	NA
AZW79991.1\|3518871_3519849_-	ABC transporter permease	NA	NA	NA	NA
AZW79992.1\|3519907_3520942_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZW79993.1\|3522916_3523153_-	hypothetical protein	NA	NA	NA	NA
AZW79994.1\|3523279_3524143_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZW79995.1\|3524231_3525053_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW79996.1\|3525132_3525870_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW79997.1\|3525866_3526859_-	nitronate monooxygenase	NA	NA	NA	NA
AZW79998.1\|3526972_3527635_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW79999.1\|3527679_3528828_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW80000.1\|3531151_3532102_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80001.1\|3532442_3533393_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80002.1\|3533491_3534442_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80003.1\|3534738_3535236_+	hypothetical protein	NA	NA	NA	NA
AZW80004.1\|3535278_3537054_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
AZW80673.1\|3537100_3537928_+	copper resistance protein B	NA	NA	NA	NA
AZW80005.1\|3537934_3538669_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW80006.1\|3539838_3540633_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW80007.1\|3540922_3541513_+	cysteine dioxygenase	NA	NA	NA	NA
AZW80008.1\|3541546_3542875_-	amidase	NA	NA	NA	NA
AZW80009.1\|3542949_3544095_-	transporter	NA	NA	NA	NA
AZW80010.1\|3544206_3545205_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80011.1\|3545167_3545602_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AZW80012.1\|3547118_3548003_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW80013.1\|3547999_3549205_-	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW80014.1\|3549201_3550062_-	endonuclease	NA	NA	NA	NA
AZW80015.1\|3550174_3551965_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AZW80016.1\|3552005_3552671_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	6.7e-11	28.4
AZW80017.1\|3552671_3552980_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AZW80674.1\|3553145_3554432_-	hypothetical protein	NA	NA	NA	NA
AZW80018.1\|3555865_3556816_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80019.1\|3558767_3559982_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AZW80020.1\|3560087_3561077_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AZW80021.1\|3561073_3561682_+	hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AZW80022.1\|3561694_3562324_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZW80023.1\|3562320_3562941_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZW80024.1\|3562972_3563764_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AZW80025.1\|3564606_3565071_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZW80026.1\|3565089_3566016_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZW80027.1\|3566069_3567356_-	cytochrome c	NA	NA	NA	NA
AZW80028.1\|3568286_3569159_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AZW80029.1\|3569155_3570106_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AZW80030.1\|3570204_3571155_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_31

4003364 : 4068276

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW80416.1\|4003364_4003850_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80417.1\|4004068_4005049_+	protein BugT	NA	NA	NA	NA
AZW80418.1\|4005315_4006125_+	Pertussis toxin subunit 1	NA	NA	NA	NA
AZW80419.1\|4006164_4006845_+	Pertussis toxin subunit 2	NA	NA	NA	NA
AZW80420.1\|4006838_4007297_+	pertussis toxin subunit 4	NA	NA	NA	NA
AZW80421.1\|4007308_4007671_+	Pertussis toxin subunit 5	NA	NA	NA	NA
AZW80422.1\|4007753_4008437_+	Pertussis toxin subunit 3	NA	NA	NA	NA
AZW80423.1\|4008492_4008801_+	type IV secretion protein A	NA	NA	NA	NA
AZW80424.1\|4008819_4009134_+	type IV secretion protein B	NA	NA	NA	NA
AZW80425.1\|4009130_4011605_+	type IV secretion system protein PtlC	NA	NA	NA	NA
AZW80426.1\|4011612_4013004_+	type IV secretion system protein PtlD	NA	NA	NA	NA
AZW80427.1\|4013000_4013186_+	type IV secretion protein I	NA	NA	NA	NA
AZW80428.1\|4013164_4013866_+	type IV secretion protein E	NA	NA	NA	NA
AZW80429.1\|4013862_4014684_+	type IV secretion system protein PtlF	NA	NA	NA	NA
AZW80696.1\|4014664_4015789_+	type IV secretion system protein PtlG	NA	NA	NA	NA
AZW80430.1\|4015781_4016801_+	type IV secretion protein H	NA	NA	NA	NA
AZW80431.1\|4017006_4018041_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW80697.1\|4018141_4018933_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW80432.1\|4019015_4019390_+	DUF1232 domain-containing protein	NA	NA	NA	NA
AZW80433.1\|4019367_4020777_+	DUF2868 domain-containing protein	NA	NA	NA	NA
AZW80434.1\|4020769_4022152_+	DUF3482 domain-containing protein	A0A0R6PHS5	Moraxella_phage	9.9e-57	38.9
AZW80435.1\|4022486_4024091_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW80436.1\|4024126_4025140_+	ABC transporter permease	NA	NA	NA	NA
AZW80437.1\|4025150_4026077_+	ABC transporter permease	NA	NA	NA	NA
AZW80438.1\|4026467_4027418_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80439.1\|4027587_4028814_+	bifunctional glutamate N-acetyltransferase/amino-acid N-acetyltransferase	NA	NA	NA	NA
AZW80440.1\|4029013_4029880_+	DUF815 domain-containing protein	NA	NA	NA	NA
AZW80441.1\|4029872_4030835_+	NUDIX domain-containing protein	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
AZW80442.1\|4030935_4031886_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80443.1\|4031984_4032935_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80444.1\|4033033_4033984_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW80445.1\|4033980_4035474_-	RND transporter	NA	NA	NA	NA
AZW80446.1\|4035470_4038578_-	multidrug transporter subunit MdtC	NA	NA	NA	NA
AZW80447.1\|4038574_4041643_-	multidrug transporter subunit MdtB	NA	NA	NA	NA
AZW80448.1\|4041639_4042890_-	multidrug transporter subunit MdtA	NA	NA	NA	NA
AZW80449.1\|4043070_4043832_-	cell division protein ZapD	NA	NA	NA	NA
AZW80450.1\|4043864_4044515_-	dephospho-CoA kinase	NA	NA	NA	NA
AZW80451.1\|4044517_4045357_-	prepilin peptidase	NA	NA	NA	NA
AZW80452.1\|4045597_4046341_+	hypothetical protein	NA	NA	NA	NA
AZW80453.1\|4046423_4046771_-	LuxR family transcriptional regulator	NA	NA	NA	NA
AZW80454.1\|4046868_4047711_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
AZW80455.1\|4047755_4048643_-	segregation/condensation protein A	NA	NA	NA	NA
AZW80456.1\|4048669_4048858_-	DUF3460 domain-containing protein	NA	NA	NA	NA
AZW80457.1\|4048955_4050413_+	MFS transporter	NA	NA	NA	NA
AZW80458.1\|4050399_4051926_+	glycerol kinase	NA	NA	NA	NA
AZW80459.1\|4051944_4052412_-	hypothetical protein	NA	NA	NA	NA
AZW80460.1\|4052411_4053434_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW80461.1\|4053554_4054295_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-35	39.7
AZW80462.1\|4054349_4055450_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW80463.1\|4055451_4056642_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW80464.1\|4056761_4057778_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
AZW80465.1\|4058096_4058768_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	9.5e-29	38.2
AZW80466.1\|4058764_4059673_+	ABC transporter permease	NA	NA	NA	NA
AZW80467.1\|4059884_4060532_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
AZW80468.1\|4064383_4065460_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
AZW80469.1\|4065470_4066280_-	transcriptional regulator	NA	NA	NA	NA
AZW80470.1\|4066369_4067143_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW80471.1\|4067325_4068276_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025346

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection