CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025349	Bordetella pertussis strain H672 chromosome, complete genome	4 crisprs	DEDDh,cas3,csa3,DinG	0	0	25	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025349_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025349_1

250590-250674

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025349_1

>merge|CP025349|1|250590-250674|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP025349|1|1|250590-250674|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP025349.1\|AZW88088.1\|248575_249277_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP025349.1\|AZW88098.1\|260961_262716_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP025349.1\|AZW88080.1\|238115_238526_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
CP025349.1\|AZW88084.1\|245061_246018_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025349.1\|AZW88083.1\|241548_243651_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP025349.1\|AZW88081.1\|239547_240291_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP025349.1\|AZW88094.1\|256383_257775_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
CP025349.1\|AZW88089.1\|249529_250579_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP025349.1\|AZW88082.1\|240334_241378_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP025349.1\|AZW88095.1\|257791_258772_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
CP025349.1\|AZW88085.1\|246036_246528_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP025349.1\|AZW88093.1\|255695_256232_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP025349.1\|AZW88086.1\|246524_247880_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
CP025349.1\|AZW88090.1\|250684_251626_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP025349.1\|AZW88087.1\|247880_248579_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP025349.1\|AZW88097.1\|259955_260855_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025349.1\|AZW88091.1\|251622_253512_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP025349.1\|AZW91286.1\|254379_255624_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP025349.1\|AZW88092.1\|253598_254237_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP025349.1\|AZW88096.1\|258907_259891_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295

Protein	Function_ID	Function_description	E-value
CP025349.1\|AZW88088.1\|248575_249277_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP025349.1\|AZW88098.1\|260961_262716_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP025349.1\|AZW88080.1\|238115_238526_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
CP025349.1\|AZW88084.1\|245061_246018_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP025349.1\|AZW88083.1\|241548_243651_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
CP025349.1\|AZW88081.1\|239547_240291_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP025349.1\|AZW88094.1\|256383_257775_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP025349.1\|AZW88089.1\|249529_250579_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP025349.1\|AZW88082.1\|240334_241378_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP025349.1\|AZW88095.1\|257791_258772_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP025349.1\|AZW88085.1\|246036_246528_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP025349.1\|AZW88093.1\|255695_256232_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP025349.1\|AZW88086.1\|246524_247880_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP025349.1\|AZW88090.1\|250684_251626_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP025349.1\|AZW88087.1\|247880_248579_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP025349.1\|AZW88097.1\|259955_260855_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
CP025349.1\|AZW88091.1\|251622_253512_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP025349.1\|AZW91286.1\|254379_255624_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	7.29619e-86
CP025349.1\|AZW88092.1\|253598_254237_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
CP025349.1\|AZW88096.1\|258907_259891_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158

>CP025349.1|AZW88089.1|249529_250579_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP025349.1|AZW88088.1|248575_249277_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP025349.1|AZW88087.1|247880_248579_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP025349.1|AZW88086.1|246524_247880_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP025349.1|AZW88085.1|246036_246528_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP025349.1|AZW88084.1|245061_246018_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP025349.1|AZW88083.1|241548_243651_+|hypothetical-protein
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP025349.1|AZW88082.1|240334_241378_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP025349.1|AZW88081.1|239547_240291_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP025349.1|AZW88080.1|238115_238526_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>CP025349.1|AZW88090.1|250684_251626_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP025349.1|AZW88091.1|251622_253512_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP025349.1|AZW88092.1|253598_254237_+|hypothetical-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP025349.1|AZW91286.1|254379_255624_-|N-acetylmuramoyl-L-alanine-amidase
MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP025349.1|AZW88093.1|255695_256232_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP025349.1|AZW88094.1|256383_257775_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP025349.1|AZW88095.1|257791_258772_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP025349.1|AZW88096.1|258907_259891_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP025349.1|AZW88097.1|259955_260855_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP025349.1|AZW88098.1|260961_262716_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025349_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025349_2

623998-624107

Orphan

Consensus_repeat	Method
GGGGACAGATACCGTCTTGGCCGTCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025349_2

>merge|CP025349|2|623998-624107|CRISPRCasFinder
GGGGACAGATACCGTCTTGGCCGTCAAGCGTCGATGGCGTACAGCAGTGTGCCTGTCCCGGCGGGGACAGGCACCCTCCCTGCGGGGACAGATACCGTCTTGGCAGTCAA

>CP025349|2|2|623998-624107|CRISPRCasFinder
GGGGACAGATACCGTCTTGGCCGTCAA	GCGTCGATGGCGTACAGCAGTGTGCCTGTCCCGGCGGGGACAGGCACCCTCCCTGC
GGGGACAGATACCGTCTTGGCAGTCAA

Protein	Signature genes	Signature genes Name	Protein_function
CP025349.1\|AZW88403.1\|637438_637807_+\|hypothetical-protein	unknown	unknown	unknown
CP025349.1\|AZW88396.1\|626239_627649_-\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP025349.1\|AZW88387.1\|612844_614608_-\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP025349.1\|AZW88401.1\|632656_633535_-\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP025349.1\|AZW88402.1\|634461_637440_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP025349.1\|AZW88400.1\|629757_630708_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025349.1\|AZW88389.1\|617133_618558_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236531
CP025349.1\|AZW88393.1\|622785_623466_-\|DUF533-domain-containing-protein	unknown	unknown	gnl\|CDD\|377342
CP025349.1\|AZW88397.1\|627659_628460_-\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP025349.1\|AZW88399.1\|629293_629761_+\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP025349.1\|AZW88404.1\|637793_638744_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025349.1\|AZW88398.1\|628480_629251_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025349.1\|AZW88391.1\|620763_621714_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025349.1\|AZW88386.1\|611854_612733_-\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP025349.1\|AZW88385.1\|610926_611742_-\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP025349.1\|AZW88392.1\|621782_622781_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025349.1\|AZW88390.1\|618557_619259_-\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|181883
CP025349.1\|AZW88395.1\|625359_626145_-\|enoyl-[acyl-carrier-protein]-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
CP025349.1\|AZW88394.1\|623603_623996_+\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|224679
CP025349.1\|AZW88388.1\|614723_616064_+\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587

Protein	Function_ID	Function_description	E-value
CP025349.1\|AZW88396.1\|626239_627649_-\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP025349.1\|AZW88387.1\|612844_614608_-\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP025349.1\|AZW88401.1\|632656_633535_-\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP025349.1\|AZW88402.1\|634461_637440_-\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP025349.1\|AZW88400.1\|629757_630708_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025349.1\|AZW88389.1\|617133_618558_-\|ATP-binding-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP025349.1\|AZW88393.1\|622785_623466_-\|DUF533-domain-containing-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP025349.1\|AZW88397.1\|627659_628460_-\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP025349.1\|AZW88399.1\|629293_629761_+\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP025349.1\|AZW88404.1\|637793_638744_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.27808e-22
CP025349.1\|AZW88398.1\|628480_629251_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP025349.1\|AZW88391.1\|620763_621714_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
CP025349.1\|AZW88386.1\|611854_612733_-\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP025349.1\|AZW88385.1\|610926_611742_-\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP025349.1\|AZW88392.1\|621782_622781_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76869e-129
CP025349.1\|AZW88390.1\|618557_619259_-\|DNA-binding-response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP025349.1\|AZW88395.1\|625359_626145_-\|enoyl-[acyl-carrier-protein]-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP025349.1\|AZW88394.1\|623603_623996_+\|OsmC-family-peroxiredoxin	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP025349.1\|AZW88388.1\|614723_616064_+\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123

>CP025349.1|AZW88394.1|623603_623996_+|OsmC-family-peroxiredoxin
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP025349.1|AZW88393.1|622785_623466_-|DUF533-domain-containing-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP025349.1|AZW88392.1|621782_622781_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRPVAPMTTMKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP025349.1|AZW88391.1|620763_621714_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025349.1|AZW88390.1|618557_619259_-|DNA-binding-response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP025349.1|AZW88389.1|617133_618558_-|ATP-binding-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP025349.1|AZW88388.1|614723_616064_+|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP025349.1|AZW88387.1|612844_614608_-|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP025349.1|AZW88386.1|611854_612733_-|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP025349.1|AZW88385.1|610926_611742_-|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK
>CP025349.1|AZW88395.1|625359_626145_-|enoyl-[acyl-carrier-protein]-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP025349.1|AZW88396.1|626239_627649_-|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP025349.1|AZW88397.1|627659_628460_-|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP025349.1|AZW88398.1|628480_629251_+|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP025349.1|AZW88399.1|629293_629761_+|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP025349.1|AZW88400.1|629757_630708_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025349.1|AZW88401.1|632656_633535_-|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP025349.1|AZW88402.1|634461_637440_-|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP025349.1|AZW88403.1|637438_637807_+|hypothetical-protein
MHVGQGLGDAVHGNAPGGRVGANLGNAQRQDDFLAPRIEHDAVLAPDEILQACAPVEWRGRVLRAAAQLPRQGLAQIQPHAQLDASCEDSIGCMHGSSEPDLRNWKSPPPQFTQGARPDEHP
>CP025349.1|AZW88404.1|637793_638744_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025349_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025349_3

2908636-2908752

Orphan

Consensus_repeat	Method
TTTTTTGCCTTGGGGCGGCCCGGCGGCAAAAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025349_3

>merge|CP025349|3|2908636-2908752|CRISPRCasFinder
TTTTTTGCCTTGGGGCGGCCCGGCGGCAAAAAAAGGCCCCCACGCTGCGCCCGCTGTGCGGGCTTGCTGCCCCCCAAGGGGGTTTTTTTGCCTTGGGGCGGCCCGGCGGCAAAAAAA

>CP025349|3|3|2908636-2908752|CRISPRCasFinder
TTTTTTGCCTTGGGGCGGCCCGGCGGCAAAAAAA	GGCCCCCACGCTGCGCCCGCTGTGCGGGCTTGCTGCCCCCCAAGGGGGT
TTTTTTGCCTTGGGGCGGCCCGGCGGCAAAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP025349.1\|AZW90234.1\|2900505_2902302_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225212
CP025349.1\|AZW90233.1\|2899537_2900506_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP025349.1\|AZW90227.1\|2890974_2893671_+\|alpha-ketoglutarate-dehydrogenase	unknown	unknown	gnl\|CDD\|237267
CP025349.1\|AZW90235.1\|2904201_2908128_-\|inverse-autotransporter-beta-barrel-domain-containing-protein	unknown	unknown	gnl\|CDD\|378762
CP025349.1\|AZW90238.1\|2912375_2913203_-\|TatD-family-deoxyribonuclease	unknown	unknown	gnl\|CDD\|238635
CP025349.1\|AZW90237.1\|2908863_2912094_-\|autotransporter-SphB3	unknown	unknown	gnl\|CDD\|377133
CP025349.1\|AZW90236.1\|2908418_2908595_-\|hypothetical-protein	unknown	unknown	unknown
CP025349.1\|AZW90242.1\|2917976_2919081_+\|peptide-chain-release-factor-2	unknown	unknown	gnl\|CDD\|234799
CP025349.1\|AZW90229.1\|2896272_2896905_+\|fimbrial-protein	unknown	unknown	gnl\|CDD\|339870
CP025349.1\|AZW90243.1\|2919110_2919866_+\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|180796
CP025349.1\|AZW90228.1\|2893825_2896108_+\|NADP-dependent-malic-enzyme	unknown	unknown	gnl\|CDD\|235976
CP025349.1\|AZW91434.1\|2916173_2917874_+\|single-stranded-DNA-specific-exonuclease-RecJ	unknown	unknown	gnl\|CDD\|182944
CP025349.1\|AZW90230.1\|2897003_2897954_+\|IS481-like-element-IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025349.1\|AZW90241.1\|2915214_2916192_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226706
CP025349.1\|AZW90245.1\|2921435_2921738_+\|hypothetical-protein	unknown	unknown	unknown
CP025349.1\|AZW90232.1\|2898622_2899468_-\|PHP-domain-containing-protein	unknown	unknown	gnl\|CDD\|223686
CP025349.1\|AZW90240.1\|2913924_2915205_-\|lipoprotein-releasing-system-transmembrane-subunit-LolC	unknown	unknown	gnl\|CDD\|274034
CP025349.1\|AZW90231.1\|2898000_2898555_-\|transcription-elongation-factor-GreB	unknown	unknown	gnl\|CDD\|179345
CP025349.1\|AZW90239.1\|2913236_2913932_-\|lipoprotein-releasing-system-ATP-binding-protein-LolD	unknown	unknown	gnl\|CDD\|213222
CP025349.1\|AZW90244.1\|2919872_2921393_+\|lysine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234778

Protein	Function_ID	Function_description	E-value
CP025349.1\|AZW90234.1\|2900505_2902302_-\|hypothetical-protein	gnl\|CDD\|225212	COG2333, ComEC, Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only].	2.40146e-57
CP025349.1\|AZW90233.1\|2899537_2900506_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	2.0858e-13
CP025349.1\|AZW90227.1\|2890974_2893671_+\|alpha-ketoglutarate-dehydrogenase	gnl\|CDD\|237267	PRK13012, PRK13012, 2-oxoacid dehydrogenase subunit E1; Provisional.	0
CP025349.1\|AZW90240.1\|2913924_2915205_-\|lipoprotein-releasing-system-transmembrane-subunit-LolC	gnl\|CDD\|274034	TIGR02212, releasing_system_transmembrane_protein_lolC., lipoprotein releasing system, transmembrane protein, LolC/E family. This model describes the LolC protein, and its paralog LolE found in some species. These proteins are homologous to permease proteins of ABC transporters. In some species, two paralogs occur, designated LolC and LolE. In others, a single form is found and tends to be designated LolC. [Protein fate, Protein and peptide secretion and trafficking].	6.22467e-159
CP025349.1\|AZW90238.1\|2912375_2913203_-\|TatD-family-deoxyribonuclease	gnl\|CDD\|238635	cd01310, TatD_DNAse, TatD like proteins; E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity.	1.42767e-89
CP025349.1\|AZW90237.1\|2908863_2912094_-\|autotransporter-SphB3	gnl\|CDD\|377133	pfam03797, Autotransporter, Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.	3.21051e-45
CP025349.1\|AZW90229.1\|2896272_2896905_+\|fimbrial-protein	gnl\|CDD\|339870	pfam16970, FimA, Type-1 fimbrial protein, A. FimA is a family of Gram-negative fimbrial component A proteins that form part of the pili. There are usually up to 1000 copies of this subunit in one pilus that form a helically wound rod onto which the tip fibrillum (FimF.FimG, FimH) is attached. Pilus subunits are translocated from the cytoplasm to the periplasm via the general secretory pathway SecYEG.	3.93152e-22
CP025349.1\|AZW90242.1\|2917976_2919081_+\|peptide-chain-release-factor-2	gnl\|CDD\|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0
CP025349.1\|AZW90235.1\|2904201_2908128_-\|inverse-autotransporter-beta-barrel-domain-containing-protein	gnl\|CDD\|378762	pfam11924, IAT_beta, Inverse autotransporter, beta-domain. This is a family of beta-barrel porin-like outer membrane proteins from enteropathogenic Gram-negative bacteria. Intimins and invasins are virulence factors produced by pathogenic Gram-negative bacteria. They carry C-terminal extracellular passenger domains that are involved in adhesion to host cells and N-terminal beta domains that are embedded in the outer membrane. This family represents the beta-barrel porin-like domain in the outer membrane that can be found in intimins, invasins and some inverse autotransporters.	8.97198e-85
CP025349.1\|AZW90243.1\|2919110_2919866_+\|short-chain-dehydrogenase	gnl\|CDD\|180796	PRK07023, PRK07023, SDR family oxidoreductase.	5.47641e-103
CP025349.1\|AZW90228.1\|2893825_2896108_+\|NADP-dependent-malic-enzyme	gnl\|CDD\|235976	PRK07232, PRK07232, bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed.	0
CP025349.1\|AZW91434.1\|2916173_2917874_+\|single-stranded-DNA-specific-exonuclease-RecJ	gnl\|CDD\|182944	PRK11070, PRK11070, single-stranded-DNA-specific exonuclease RecJ.	0
CP025349.1\|AZW90230.1\|2897003_2897954_+\|IS481-like-element-IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.17356e-23
CP025349.1\|AZW90241.1\|2915214_2916192_+\|hypothetical-protein	gnl\|CDD\|226706	COG4255, COG4255, Uncharacterized protein conserved in bacteria [Function unknown].	1.08896e-20
CP025349.1\|AZW90232.1\|2898622_2899468_-\|PHP-domain-containing-protein	gnl\|CDD\|223686	COG0613, COG0613, Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only].	1.79612e-72
CP025349.1\|AZW90231.1\|2898000_2898555_-\|transcription-elongation-factor-GreB	gnl\|CDD\|179345	PRK01885, greB, transcription elongation factor GreB; Reviewed.	4.04513e-99
CP025349.1\|AZW90239.1\|2913236_2913932_-\|lipoprotein-releasing-system-ATP-binding-protein-LolD	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	2.7791e-114
CP025349.1\|AZW90244.1\|2919872_2921393_+\|lysine--tRNA-ligase	gnl\|CDD\|234778	PRK00484, lysS, lysyl-tRNA synthetase; Reviewed.	0

>CP025349.1|AZW90236.1|2908418_2908595_-|hypothetical-protein
MGAFCLFEECVAGIASRHPQWADVALPGDIQAEVLPRAPLPVHGAPAARYPGLFDVPD
>CP025349.1|AZW90235.1|2904201_2908128_-|inverse-autotransporter-beta-barrel-domain-containing-protein
MNKNIYRVVWSLVRGAWVVAGEWARAGRKSSSPRRQNRQRARRGVAAMVGGSILAQALLPLSALAQGAPTLRPARVAQEEAGQDAAWTRKLAAQAESLARRQAERQPGARVDGDYLKREAQAQVNDVLRDGVNLARESGLPFLRNLQGGLSHDFESGRTSLQLNTIDEVYRAGRNTGLLQLGAHNQNDRPTANAGAVYRREVNDALMVGANGFLDYEFGKQHLRGSVGLEVIAPEFSLYGNVYAPLSDWKGAKRNNRREEKPASGMDVGVGYRPAFAPGLSLSATHFRWNGAEVDYFDNGRTQAGAKGFKVGVEYRPVSLVSVGLEQTKVIGGGRETRMQLGLNINLSEPLSKQLRRDASGTPAFSPDARRHALVERENRIVLNTRRKEIILPLVVSKVSTLQADGRVTVIGATQPFATVTVRMPDGMTGTATADASGRFAYTSAGDQPSGVLALRARNAEGDSSREVTYRYVDEVVLGDLQVAVMALVPLPADRALEVRGKTEPKVDVKVSFSNGESVLAKADAKGLFTVRSTRKVTQGKVLVQATHPQTRKEARAVADYLPPATLAPTIDAVTAQADTGRVTVTGQAEPGAQVDVHFPDGTAKTVDAGADGAYAATSDGDMVSGDIHAQATDKAGNQSPEATRHYGDTTDITPPAAPTIANVATDATSGRVTAAGMAEPGANVTVNFPDGTRKTVVAGGDGAYTATSDRDMVSGDIRVQATDKAGNQSPEATRAYADAVDRTAPEVPTVTHVATDAKSGRITVTGMAEPGANVTVNFPDGTRKTAVAGGDGAYTATSDGDMVSGDIRVQATDKAGNRSPEATRAYADTVDTTPPAVPTITDVTTDATNGRITVTGVAEPGANVTVDFPDGTRKTVVAGGDGAYTATSDRDMASGDVRVQAIDKGGNRSPEATRAYADTVDKTAPAAPTITNVTTDAASGRITVTGMAEPGANVAVNFPDGTRKTVVADGAGAYAADSDGDMVAGDIHVQATDKAGNRSPEGTRAYVDTVDKTPSAAPTIVRVTTDRSSGVVTVAGTADPDNDVTVQFPDGGRKTVKAGKDGSYSVTSDNDIFSGIIQVSARNPAGNASPEVRQDYRDEFVPANAITNIETNSRNGIVTVSGKTSPDATVVVSFPGGDEARTRAKGDGTFSVSSPMDIPRGVVSLSTEVNGVQTVVATRTYEDKFTKGGLDFTAFLPYTPKFNGVSTSDTSAVLLSIPRYFYSGGAPVAKIMPPEADGSEFAKRAAAAMRAQVTPGRDSSEYDVRVSWPAGTFTPADVGQRADLAVKVFDKGTGKYMLLLAPVNFPY
>CP025349.1|AZW90234.1|2900505_2902302_-|hypothetical-protein
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYWTLTALDVGQGGAVVLETARHVLLFDTGPRHGDASDAGERVIAPFLWARGYRHIDTLVVSHADLDHTGGLRSVLAALPVGQAYASFDLAAWLARQARVRPDGWRAAPRMPPATRGCEAGVQWRVDGVRLRFVYPPSLAAPLPWRSSNARSCVLLVEGVGHRALLTGDVGLVQEAAFAAALPPVDLVMAPHHGSAMSSGSLLTAATRPAHAIAQAGYLNRFGHPAASAINRWRRAGAAVWRTDLDGAVRADSTPRGLFASGQRQVARRYWRDSRAGPDAPLR
>CP025349.1|AZW90233.1|2899537_2900506_-|alpha/beta-hydrolase
MGHRRPSGPRRGDIMQEPRLDFVTCASPTGFHRMAYWEWGDPLNDRVLVCVHGLTRTGRDFDHLARRLAGQWRVVCPDVAGRGKSDWLSNPALYAVPQYVSDMATLIARVWPATLAWVGTSMGGLIGLGLAGAATMMRLARAMRPRPDGLPAQADDLRLHRLVLNDVGPRLNVEVLQRIAGNVAAQDSYSTFEAAVAAMRQISTTFGPHTDAQWDELARHIYVRQGGGWVRHFDPALAVPLGAQVAQAFEAGERILWQAYDSLDCPVLIVRGQDSDLLSAATAGEMLARNPRARLHEVPGVGHAPTLMTPEQIEPIARFLQE
>CP025349.1|AZW90232.1|2898622_2899468_-|PHP-domain-containing-protein
MNIAAPNVDLHCHSTVSDGSMPPAAVARRAHANGVDVWALTDHDEIGGVAEAAQAAAALGMRFVAGVEISVTWAGLTVHIVGLRVDPANEALVQGLRDTRAGRAARAVQIGERLAGLGMPGAYEGALPFAGNPELISRTHFARFLVEAGYCPDVQTVFNKYLGDDCPGHVPMQWASLAEAVGWIRGAGGCAVIAHPGRYKYSPMQFDALYDEFLQLGGTGIEVVTGSHTSEEARRYAEVARRHGFLASRGSDFHSPTESRVDLGRLPPLPPDLKPVWHDWF
>CP025349.1|AZW90231.1|2898000_2898555_-|transcription-elongation-factor-GreB
MNKAFVKESDRDDEDDLPEAQALPAGTRNYMTPQGYARLRDELSHLMNVERPSVVQVVSWAASNGDRSENGDYLYGKKRLREIDRRMRFLTKRLDIAEVVDPAAQPNRDQVFFGATVLYMDRAGEERTVTIVGVDEAEPLAGKISWISPVARALTKAHEGDTVTLRTPGGVEELEILEVRYPDA
>CP025349.1|AZW90230.1|2897003_2897954_+|IS481-like-element-IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAHALGVSASTVSRVLARAGLSHLAGLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025349.1|AZW90229.1|2896272_2896905_+|fimbrial-protein
MLPMQIPFQRALRLCLRAALAAIASAAHADDGTIVITGTITDTTCVIEDPSGPNHTKVVQLPKISKNALKANGDQAGRTPFIIKLKDCPSSLGNGVKAYFEPGPTTDYSTGDLRAYKMVYATNPQTQLSNITAATEAQGVQVRISNLNDSKITMGANEATQQAAGFDPEVQTGGTSRTVTMRYLASYVKKNGDVEASAITTYVGFSVVYP
>CP025349.1|AZW90228.1|2893825_2896108_+|NADP-dependent-malic-enzyme
MDENLTKLALDYHAYPTPGKISVTPTKTLANQDDLSLAYSPGVAAACMAIFDQGNDAASKYTSRSNLVGVITNGTAVLGLGNIGSLAAKPVMEGKGCLFKKFAGIDVFDIELAENDPDKLVDIIAALEPTLGGVNLEDIKAPECFYIEKKLRERMNIPVFHDDQHGTAIISSAAILNGLKVVGKDIGQVKLACSGAGAAAIACLDLLVHLGIKREHIYVVDSRGVIWEGRDENMEPNKRRYAQKTEARTLADVVNGADVFLGCSTAGVLTPEMVKTMAAQPLILALANPEPEIRPELAKAARPDCIVATGRSDYPNQVNNVLCFPFIFRGALDAGATRITEEMKLACVKAIAELAQAEQNDEVARAYAGQELSFGPDYIIPKPFDPRLIVQIAPAVAQAAADSGVATRPIEDIEAYRQKLMGFVYHSGQLMRPLFQQAKQAPKRVVYADGEDERVLRAVQTVIDEKLAEPILVGRPSVIEMRIKKFGLRMVPGQNVEIVDPEDDSRFNDTWNGYYQLRGREGVTPAIAKAMIRKHNTLIGAMLLRRGDADALLCGVASKYDNQLKYVEEVIGRKPGQTYGALNVLMLPNQTLFVTDTHVNENPSADEIANITIQAAEEMLRFGVMPKIALLSHSNFGSRPTDSSRKMAHARKLVAERAPHLEVDGEMHADAALSESIRLQAYPDSTLKGRANLLVMPNLDTGNITYNMLKMTGSNGIAMGPILLGSARPVHILTTSATVRRIVNMTALAVVDAQQEAAEG
>CP025349.1|AZW90227.1|2890974_2893671_+|alpha-ketoglutarate-dehydrogenase
MCNAQAGATPPQIPDPDPVETAEWCEALDSLTQAGGPERAAYVLQQLLARATALGVRAPGITRTAYLNTIAADQEPPFPGNLSLEERIASINRWNALAMVVRANQAHGELGGHIASYASAADLFEVGFNHFFRAPAPGFGGDLVYMQPHSAPGIYARAYLEGFLNDVDLAHFRQEITAGAQGLRGLSSYPHPWLMPDFWQFPTGSMGIGPINAIYQARFMRYLEHRSLAMPSDRKVWGIFGDGEMDEPESIAALTLAARERLDNLVFVINCNLQRLDGPVRGNGRIIDELETLYAGAGWNVIKLVWGGDWDALLRRDPDGVLAGTFSHTVDGQFQTFAANDGAYNRQHFFGQDPRLSALVADWSDEAIDRLRRGGHDMVKIHAAYHRATHHRGQPTVILAQTKKGFGMGTAGQGKMTTHQQKKLDDEALLAFRDRFALPISDADCLALKFYKPAEDSAELRYLESRRAALGGYLPRRRTEAPRLAPPPVADWARFALQAAGKEMSSTMAIVRMLTALLKDPQLGPRIVPIVADEARTFGMANLFRQVGIYSAQGQLYEPEDIGSVLAYREARDGQILEEGITEAGAISSWTAAGTSYSVNGLPMLPFYIYYSMFGFQRIGDLIWAAADQRTRGFLIGATSGRTTLGGEGLQHQDGYSHLAAAAVPNCRAYDPAYAYEVAVLVEHGMQRMLDEQCDEFYYLTVTNENLAQPDMPEGEETRTGILRGMHRVRAADATPQVRLLGAGPMLDEAMRAAQLLRDEHGLDAEVWSVTSFSELARGGRGAERAQALGLPCPDGNWLAQCLGDQATPVVAVSDYVRAVPEQIRAWVPGPYRVLGTDGFGHSDTRARLRDFFEVGAPWIVLHALDLLAREDSAWQPALQARREQLQAATRNVPSWQS
>CP025349.1|AZW90237.1|2908863_2912094_-|autotransporter-SphB3
MAQASARGMGLRITSLAAALLGVYGAAGAAENRLECIGACPPGQPVAGAHYSGTNLSANREWVVYGEGSNAVFTLQGGSVTASGGLMGAVNAADGARVYLNQVSVRTDAGNGWEAPGVRAEYGALVNVRGGSIATVGGGSYGVQSLDSGTMIELNGTDIRTTDAYSDGLRAEFGGSIRAVGLTINTTGEHAVGAMGADDGTIALRDSRITTSGVDAYGLGTESQVLSPGGVLQVSNTAIQTSGKNAHGVYLQGGSSLNMSGGSIRTTGSGAAGLRVSNGSSVALNGVEVVASGPSLLSTLSATRQQSIVVGAGSNLTRNDGRLLLVRRVAGGELGQVTLTLKSGSYAAGNIENLAADGSRESSALTIVDVQSGAQWAGLVIDDTTAIVNGSQSGQHSGFSTAGDMVLEGGSAPVTFTGVSNIGGSSSLGAGSQTTFGGATTIGQSLAVLPGGSVAFNGPLTIGESVTEGQGTALSFNAPAIIGANVQGAGGAAFTFSGPAQVGGSVQGLDGASFRFSTSAPTAIAGGLSLAGGSSLGGGSPTTPIVVIGGADAVSGAILGGNLDIGGALRMTGASLAPGNSIGTVTVGSVGALSGSTYLAEVNAKGQSDLLVVRSGNVDLAGVSLVVGQENGTGGYVLNHDYTIIKTEAGKIVGEFAAASLDESLASTLVKLDPVKYGAQATQVSLSPDADKLAAARAGLIRNQSAVLDGALSVAGRNASADAVMLMSDTGQRADALDQLSGEVHGSAVSALYSNTQLLNRTVARRMSANLGAGLLAGAPTAQAAGPAAASAMPGTAAYPLWADVVDNWSSFDAKDNAAKAKSNTAGLFIGGDAAVGAGWRVGGALGFTDGRIKADAVDSRSDVTSYTAALYGGNSWAAGKGKLNFLAGVGYTHHDIDSRRSVDVGGAQTLKADYKANTTQLFAELGYQVPVGASSSVEPYAGLAWFNNHSDSFDEDGGPAALHGSGQTDQITTFTLGLRGNTALQLGATETRLSAGLGWRHANGDVDATRKLAFIQGGGTAFTVAGSPVAREAAVLDLAAEVDVGRNAALGLAYGGQFGNGNKENTGSLYLKVRF
>CP025349.1|AZW90238.1|2912375_2913203_-|TatD-family-deoxyribonuclease
MLIDTHCHLDAAEFDADRMAVARAAREAGVQAIVIPAVERANFATVRQLAHAVDSGAYALGIHPLYVARARDEDLDSLRRAIESALPDPRFVAIGEIGLDFFVAEIASGAPRERQERFYAAQLDLAAEYGLPVLLHVRRSQDILLKHLRRRPGVPGGIAHAFNGSAQQAGAFVEQGFALGLGGAMTYPRALQIRRHAADIGLDHLVLETDAPDIPPAWLYEPERRNTPGQLPRIAAELAALRGQAVADVARATTTTALRVLPRLGALLQDRAATP
>CP025349.1|AZW90239.1|2913236_2913932_-|lipoprotein-releasing-system-ATP-binding-protein-LolD
MTEPNDTGPALQAEHLGKVYDEGPARIEVLSDVSLSVARGEMVAIVGASGSGKSTLLHILGLLDVPSSGTVSVDGVPAAGLSEKRKSALRNRSLGFVYQFHHLLPEFSALDNVAMPLIVRRENRDRARAQAREVLELVGLAAREEHFPGQLSGGERQRVALARALVTRPACVLADEPTGNLDRHTAHNMFELLTRVNRESGTAFVIVTHDPELAARADRQLHMENGRLQPD
>CP025349.1|AZW90240.1|2913924_2915205_-|lipoprotein-releasing-system-transmembrane-subunit-LolC
MLKIPYELWIGARYAGMARIRQRRGCRDRFISFIAATSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHIELYIPGAAPERVLQQWRQFAQAARANPEVKGEAPFVAAQGMLVRGQALRGVQVRGIDPATEGNVSDIPRQMVSGKLSDLVAGGFGAVLGSDLADGLGVKTGDTVLMLAPQGSISPAGFAPRMRQFTVVGIFSSGHYEYDSTLVFIDDEDAAKVFRESGTAGVRLRVADMQRAPEVAAELTKVLPPYVMAADWSRNNRTWFAAVQTEKRMMFLILALIVAVAAFNLLSSLVMAVKDKQSDIAILRTLGAGPGEVARIFLVQGALIGVVGTLLGVAGGIAIAYNVDVIVPFIERLLGVQFLPREVYFISALPSDPQADDIITIGLTSLVLSLLATLYPSWRASRLQPAQVLRHD
>CP025349.1|AZW90241.1|2915214_2916192_+|hypothetical-protein
MALTGTRTTIAAMLIVIPGALPAAAVAPELARLLPQHAPTLHGWLQAASARVQAFDAARQGCTPFEGWQLEQAGYQPQPGLPLGAGLGPLRAAGGTPGQPVWLADLAHLMLGADQAALLDPALLDLRADESAQLFEAAAPLFADSGFGATPIDAARWRLTLPAGMAPQTASPAAVAGQRLRAWWTQDVAMRPWRRLLNEIQMVWYEHPVNEARAARGAAPINALWLYGGATPWPAGAPAPARVCDELAATQRAGDWAAWLDALAMLDAAQLAPLAGPHGRPVQPLQLLLLGDDRRAALTLKPRAGLARWLPAPKHNWNAWWSRPV
>CP025349.1|AZW91434.1|2916173_2917874_+|single-stranded-DNA-specific-exonuclease-RecJ
MVSPRLIIRTADLQACQHLEAAGIHPLLSRLWAARGVIHPEQTRMAWPALLPPDRLTHSAHAAAVLADAIEQGKRLLIVADYDCDGATACAVGLRALSAMGADVDFLVPNRFETGYGLSPAVVELACRHRRGKPDIIITVDNGIASVDGVAAANAAGIGVVITDHHLPGDTLPEALAIVNPNQPGCGFGSKHLAGVGVIFYMMLALRAELRRRGVYAPDGGPRLDALSDLVALGTVADVVKLDANNRLLVTQGLQRMRAGRMQPGVRALFAVAGREPRTASGFDLGFALGPRINAAGRLADMSLGIACLTTDDEAQTLEMARELDNINRERRTIEAEMRDQALAAMEAPDAAAGATVCVFDPGWHQGVVGLVASRLKEKFWRPTLAFAPAGEDELRGSGRSIPDVHLRDALDLVSKRHPGLIRKFGGHAMAAGLTLGSGDFAAFAPAFDAAVRELTGRDRFEPLLETDGSLESGYANAEVAGLLQQQVWGAGFAAPLFLDEFTVRSQRLVGGKHLKLALERGHQRFDAIWFGHDQSLPERIQAAYRLEQNIWNGMVSVQLVIEHAA
>CP025349.1|AZW90242.1|2917976_2919081_+|peptide-chain-release-factor-2
MEAERQNQLVARLEDYAEREQALRRYLDYDAKSERLQVVNAELEDPAIWNDPKHAQDLGREKKSLEDVVETLTELGSGLADSCELVELALADSDDATLEAIEHDADRFQEKLETLEFRRMFANPADPLNCFVDIQAGAGGTEAQDWASMLLRQYLKYAERKGFKAEILEESEGDVAGLKSATIKIEGEYAFGYLRTETGVHRLVRKSPFDSSGGRHTSFASVFVYPEVDESFEVEVNPADLRIDTYRASGAGGQHINKTDSAVRITHAPSGIVVQCQNDRSQHRNRAEAMQMLKSKLYELEMRNRMTEQQKLEDSKTDVGWGHQIRSYVLDQSRIKDLRTNVEISNTQKVLDGDLDPFIQASLKQGV
>CP025349.1|AZW90243.1|2919110_2919866_+|short-chain-dehydrogenase
MTDTVAILTGASRGLGAALARGLLAPGTRLITLARRADPDLEAAARTRGASLEQVQVDLSDPAAAGAAAKRLCAALPRDARRYLLINNAGTVSPVAQAAGLTDGAAIAGALNLNVTAVVLLTARFVAALQGLPADRRVLNISSGAGRNPNAGWGVYCAAKAALDMYSRVLKQEQGQDGVRVVALAPGIVDTDMQGAIRASDPADFPALERFREFHATGKLSAPADVAARILAYLDRDDFGTTEIDDIRNYQ
>CP025349.1|AZW90244.1|2919872_2921393_+|lysine--tRNA-ligase
MTDQSPAPTAQDENRLIAERRAKLARLRETGVAFPNNFVPDAHAADLHARYDGLDQEALTAAAVTVKVAGRMMLKRVMGKASFATLQDGSGRIQIYLERGTLGEEAYAAFKQWDIGDIIAIEGPVFKTNKGELSVHANSARLLSKSLRPLPDKFHGVADQELRYRQRYVDLIMTDATRRTFEARSKAVGGIRQAMLNAGFLEVETPMLHPIPGGAAAKPFVTHHNALDMQMFLRIAPELYLKRLIVGGFERVFEINRNFRNEGVSPRHNPEFTMMEFYAAYADYRWLMDFTEDLIRQAAIAATGSAVLSYQDRELDLSQPFDRLTICEAILKYAEGYTQAQLDDPAFVRAELRKLGANVEGPPLARAGLGALQLALFEETAEAKLWRPTYIIDYPVEVSPLARASDTRDGITERFELFITGREIANGFSELNDPEDQAERFRAQVEAKDAGDEEAMYFDADYIRALEYGMPPTGGCGIGIDRLVMLLTDSPSIRDVILFPHLRRED
>CP025349.1|AZW90245.1|2921435_2921738_+|hypothetical-protein
MAALAYLLLSRRARPAAAPRPLRALPAGRRRMPLYLGVAAVLALAGALLSAFLLVTAMAGGSGGGYRGQADFLQQVAIVLLAIGVVCAIAALVSFFRQRG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025349_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025349_4

3623405-3623498

Orphan

Consensus_repeat	Method
GTGCCTGTCCCGGCGGGGACAGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025349_4

>merge|CP025349|4|3623405-3623498|CRISPRCasFinder
GTGCCTGTCCCGGCGGGGACAGGCACGCCCGCACAGCGGGCGCAGCGTGGGGGTTTTCCTGGGCCCGGGTGCCTGTCCCGGCGGGGACAGGCAC

>CP025349|4|4|3623405-3623498|CRISPRCasFinder
GTGCCTGTCCCGGCGGGGACAGGCAC	GCCCGCACAGCGGGCGCAGCGTGGGGGTTTTCCTGGGCCCGG
GTGCCTGTCCCGGCGGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025349.1\|AZW90827.1\|3613509_3614487_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP025349.1\|AZW91467.1\|3620914_3622315_+\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP025349.1\|AZW90839.1\|3627510_3628401_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025349.1\|AZW90829.1\|3615535_3616321_-\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP025349.1\|AZW90837.1\|3625307_3626258_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025349.1\|AZW90828.1\|3614497_3615469_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP025349.1\|AZW90833.1\|3622414_3622759_+\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
CP025349.1\|AZW90842.1\|3630562_3631723_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173849
CP025349.1\|AZW90841.1\|3629553_3630525_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025349.1\|AZW90843.1\|3631733_3632126_-\|acyl-dehydratase	unknown	unknown	gnl\|CDD\|239525
CP025349.1\|AZW90834.1\|3622847_3623318_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP025349.1\|AZW90826.1\|3612211_3613384_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP025349.1\|AZW90838.1\|3626356_3627304_-\|dihydrodipicolinate-synthase-family-protein	unknown	unknown	gnl\|CDD\|188630
CP025349.1\|AZW90840.1\|3628397_3629546_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP025349.1\|AZW90835.1\|3623728_3624127_+\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP025349.1\|AZW90836.1\|3624258_3625209_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025349.1\|AZW90830.1\|3616313_3617546_-\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP025349.1\|AZW90832.1\|3618607_3619126_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP025349.1\|AZW90831.1\|3617741_3618497_-\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
CP025349.1\|AZW90844.1\|3632122_3632518_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP025349.1\|AZW90827.1\|3613509_3614487_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP025349.1\|AZW91467.1\|3620914_3622315_+\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP025349.1\|AZW90839.1\|3627510_3628401_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.25236e-65
CP025349.1\|AZW90829.1\|3615535_3616321_-\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP025349.1\|AZW90837.1\|3625307_3626258_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025349.1\|AZW90828.1\|3614497_3615469_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP025349.1\|AZW90833.1\|3622414_3622759_+\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP025349.1\|AZW90842.1\|3630562_3631723_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173849	cd01160, LCAD, Long chain acyl-CoA dehydrogenase. LCAD is an acyl-CoA dehydrogenases (ACAD), which is found in the mitochondria of eukaryotes and in some prokaryotes. It catalyzes the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of LCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. LCAD acts as a homodimer.	4.16688e-115
CP025349.1\|AZW90841.1\|3629553_3630525_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	5.90573e-128
CP025349.1\|AZW90843.1\|3631733_3632126_-\|acyl-dehydratase	gnl\|CDD\|239525	cd03441, R_hydratase_like, (R)-hydratase [(R)-specific enoyl-CoA hydratase]. Catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway. The structure of the monomer includes a five-strand antiparallel beta-sheet wrapped around a central alpha helix, referred to as a hot dog fold. The active site lies within a substrate-binding tunnel formed by the homodimer. Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.	3.21769e-21
CP025349.1\|AZW90834.1\|3622847_3623318_+\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP025349.1\|AZW90826.1\|3612211_3613384_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP025349.1\|AZW90838.1\|3626356_3627304_-\|dihydrodipicolinate-synthase-family-protein	gnl\|CDD\|188630	cd00408, DHDPS-like, Dihydrodipicolinate synthase family. Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stabilizes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.	1.66209e-66
CP025349.1\|AZW90840.1\|3628397_3629546_-\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	7.23571e-127
CP025349.1\|AZW90835.1\|3623728_3624127_+\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP025349.1\|AZW90836.1\|3624258_3625209_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
CP025349.1\|AZW90830.1\|3616313_3617546_-\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP025349.1\|AZW90832.1\|3618607_3619126_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP025349.1\|AZW90831.1\|3617741_3618497_-\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78

>CP025349.1|AZW90834.1|3622847_3623318_+|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP025349.1|AZW90833.1|3622414_3622759_+|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP025349.1|AZW91467.1|3620914_3622315_+|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP025349.1|AZW90832.1|3618607_3619126_+|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP025349.1|AZW90831.1|3617741_3618497_-|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP025349.1|AZW90830.1|3616313_3617546_-|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP025349.1|AZW90829.1|3615535_3616321_-|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP025349.1|AZW90828.1|3614497_3615469_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP025349.1|AZW90827.1|3613509_3614487_+|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP025349.1|AZW90826.1|3612211_3613384_-|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR
>CP025349.1|AZW90835.1|3623728_3624127_+|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP025349.1|AZW90836.1|3624258_3625209_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP025349.1|AZW90837.1|3625307_3626258_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025349.1|AZW90838.1|3626356_3627304_-|dihydrodipicolinate-synthase-family-protein
MQASHGARIDEQTSGVYVIAATPFADDGELDLASLDSLTDFYLDKDVAGLTILGMMGEASKLTEAETATVMTRILKRVDGRVPVVVGVSHPSNRHLERLARQAMELGAAGVMVAPAAGRHTDDQVYGYYATVAERLGADIPICLQDFPQSAGVHTSVAVIHRLVDDFPQVVMLKHEDFPGMRKLSQVRARSEAEGRRRISILVGNGGLFLPQEMLRGADGAMTGFAYPEMLVQVCRLFAAGKAEAAEDLFNLYLPLLRHEFQYGIGLALRKETLRRRGAIRSAYVRQPGPALDAVDHAELGRLIARLEAQLGRAA
>CP025349.1|AZW90839.1|3627510_3628401_+|LysR-family-transcriptional-regulator
MKLNLRQIEVFRAVMITGSIRGASELLFVSQPAVSRLLSHMEQRIGFALFERIRGRLYATLEARKLFHEVEAVYAGVQRVNDMARDLFEHQEGILNLVASPSLGQMLIPAAIAQYRQAHPQVKLSFHHLTQAPLTERLLKRQADLALTILPAGHPNLEQEEIGAARMVLICPPGHPLAGREPVGAEALAPYPLVAYERGSAFGQKLQAWFDAQSVAARPVIEVGSPQNTCALVQAGAGVALVDEFSARSWPGAGFVMRPVRDLAPLTAYLLRLREEPASHLMQSFIETLRRVMRRA
>CP025349.1|AZW90840.1|3628397_3629546_-|CoA-transferase
MLNHALAGITVLDFSQGIAGPHGACLLGEMGAEVIKIEPPAGDWLRGLGHRQGGTSVLFGYFNRGKAGVALDLKDHAQRRQALALIDKADVLIESNRPGVMARLGLGYEQARQRNPGLVYISVTGFGQDGPHRDLPATDAAMQAYSGFSFGAGDMRDPVRVRVSVVDIVTGVYVSNAALAALMARHGNQGQGQYIDLSLMHGISAVQGAKYAEHAATRGVISRELYAAIGIYPTRDGHIALSAMRDQQVTDFIGLAGRADLLADPRYATQQARYDNQDELRALIAAELAKQPTAHWIEAARRIDLICQPVQTYDQFRQDPQVRTYELFQDMDLGYDMPLPAVRMPGMTATQASLRPPPRLGADTAAVLRRHGASPPSADATP
>CP025349.1|AZW90841.1|3629553_3630525_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHGKNALRALLAGLALGATAAGAAPYPERPVRLIAPIAVGGLTDTLARLVASGLADKLGQPVVVENKPGAGGIIGMEAAAQAAPDGYTLILVYQGVAAVNASLYKNLPYDTRRDFAPVAGLGNFPLVLVASPASGIQSVGALLERAGKQAKAPSYASAGNATTSHLTMELFKNASGLQALHVPYKGEGPANTDVAGGQVDIAFSSLASVAPLVKSGRLVALGISTPERSAVLPDVPTIAQAGVADFEAVGWYGLLAPAGTPAEVVAKLSDAVAAVLDQPAIRAKLEALGVNARATPAADFGRQIDAETEKWRAVIQTAGITLD
>CP025349.1|AZW90842.1|3630562_3631723_-|acyl-CoA-dehydrogenase
MQFTHEHRELARTTRRIIAEHLDPYLDEWEAAQMFPAHQVMKALGSAGLLGIGKPAEYGGMALDFSYEMVFAETLGEVRSSGLSSAIGVQSTMCTPALARHGSDALKRAYLAPTIAGDLVGCIGASEASAGSDVSQIKTWARRDGDDYVINGSKMWITNGVQGDWICLLCNTSQEGGPHKNKSLIIVPLDTPGVSVSRKLDKLVLRASDTAELFFDDVRVPVSNRIGAENMGFIYQMEQFQEERMFVAARGMRSMERVIEETIAYAGQRQVFGGTVLSNQVVYHKLAQMQTEIEALRSLLYRAIGQYLDGQDITQLASMAKYCAGRLSMRIPNECLQFWGGQGVMNENWISRAYRDLRQTAIGGGANEIMLEVIAKTMGIHPGKRA
>CP025349.1|AZW90843.1|3631733_3632126_-|acyl-dehydratase
MRNTMTQRLEEVSMRVTQADIDIYAELTDDFNPLHVDPAFAATTPMGGTIAHGTLSVNLIWQSLARSLGAAALARIDLDIRFLKPLFAGGAITAGGQPDAAEPDRYEVWVKGADGATLIAGHARLAPITD
>CP025349.1|AZW90844.1|3632122_3632518_-|hypothetical-protein
MTQLYTYETFTPGTVLGEWAEPLDARLVATWGRLFGAEARDQPARQVGLTVALMIRAYLNVVTPRPPGNIHAQQILSIDGLPGVGETVRSRIRCLGKEIRRERRYLQLEVSGVGERERNLYTGRMNLIWAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 122073

110

Planktothrix_phage(16.67%)

tRNA,transposase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW87886.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZW87887.1\|1916_2609_+	ribosomal RNA small subunit methyltransferase G	NA	NA	NA	NA
AZW87888.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZW87889.1\|3409_4171_+	N-acetyltransferase	NA	NA	NA	NA
AZW87890.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZW87891.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZW87892.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZW87893.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZW87894.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZW87895.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZW87896.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZW87897.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZW87898.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZW87899.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZW91273.1\|20126_20531_-	lipoprotein	NA	NA	NA	NA
AZW87900.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZW87901.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZW87902.1\|26470_27286_+	DNA-binding response regulator	NA	NA	NA	NA
AZW87903.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87904.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
AZW87905.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AZW87906.1\|29141_30368_-	thiolase family protein	NA	NA	NA	NA
AZW87907.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AZW91274.1\|31069_31978_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW87908.1\|32163_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW87909.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW87910.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87911.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AZW87912.1\|36949_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZW87913.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW87914.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZW87915.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW87916.1\|41318_42212_+	M48 family peptidase	NA	NA	NA	NA
AZW87917.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AZW87918.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZW87919.1\|43346_43646_-	DUF1974 domain-containing protein	NA	NA	NA	NA
AZW87920.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87921.1\|45113_45749_+	hypothetical protein	NA	NA	NA	NA
AZW87922.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW87923.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AZW87924.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZW87925.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZW87926.1\|50141_51092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87927.1\|51134_52391_+	MFS transporter	NA	NA	NA	NA
AZW87928.1\|53622_54357_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
AZW87929.1\|54362_54953_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZW87930.1\|54977_55667_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW87931.1\|55663_56425_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW87932.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87933.1\|57497_58448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87934.1\|59248_60475_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW87935.1\|60474_60894_-	transcriptional regulator	NA	NA	NA	NA
AZW87936.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
AZW87937.1\|62442_63279_-	hypothetical protein	NA	NA	NA	NA
AZW87938.1\|63473_64055_-\|protease	protease	NA	NA	NA	NA
AZW87939.1\|64067_64385_-	ferredoxin	NA	NA	NA	NA
AZW87940.1\|64488_65547_-	oxidoreductase	NA	NA	NA	NA
AZW87941.1\|65581_66853_-	TRAP transporter large permease	NA	NA	NA	NA
AZW87942.1\|67482_68664_-	hypothetical protein	NA	NA	NA	NA
AZW87943.1\|69085_70036_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87944.1\|70129_70444_+\|transposase	transposase	NA	NA	NA	NA
AZW87945.1\|71636_73544_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AZW87946.1\|73705_74326_-	glutathione S-transferase	NA	NA	NA	NA
AZW87947.1\|74357_74939_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AZW87948.1\|75027_75279_-	hypothetical protein	NA	NA	NA	NA
AZW91275.1\|75280_76030_-	hypothetical protein	NA	NA	NA	NA
AZW87949.1\|76228_77638_+	signal recognition particle protein	NA	NA	NA	NA
AZW87950.1\|77634_78585_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91276.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87951.1\|79600_81475_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZW87952.1\|82822_83527_-	DUF2837 domain-containing protein	NA	NA	NA	NA
AZW87953.1\|83523_84630_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZW87954.1\|84891_85485_-	sugar transferase	NA	NA	NA	NA
AZW87955.1\|85481_86714_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZW87956.1\|86731_87991_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZW87957.1\|88014_89103_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZW87958.1\|89110_90211_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZW87959.1\|90214_90790_-	N-acetyltransferase	NA	NA	NA	NA
AZW87960.1\|90793_91846_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZW87961.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZW87962.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZW87963.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
AZW87964.1\|94468_95272_-	type III pantothenate kinase	NA	NA	NA	NA
AZW87965.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZW87966.1\|96203_97340_+	ABC transporter permease	NA	NA	NA	NA
AZW87967.1\|97339_98179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZW87968.1\|99111_99714_+	hypothetical protein	NA	NA	NA	NA
AZW87969.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW87970.1\|100529_101786_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
AZW87971.1\|101788_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZW87972.1\|102808_103084_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZW87973.1\|103091_103754_+	octanoyltransferase	NA	NA	NA	NA
AZW87974.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
AZW87975.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZW87976.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZW87977.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZW87978.1\|107427_108378_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87979.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
AZW87980.1\|110552_111182_-	thiol:disulfide interchange protein DsbA	NA	NA	NA	NA
AZW87981.1\|111243_111927_-	SPOR domain-containing protein	NA	NA	NA	NA
AZW87982.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZW91277.1\|113906_114254_+	DUF1840 domain-containing protein	NA	NA	NA	NA
AZW87983.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
AZW91278.1\|114944_115961_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW87984.1\|116036_116837_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW87985.1\|116833_117709_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW87986.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87987.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZW87988.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
AZW87989.1\|121122_122073_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

164893 : 225403

Diachasmimorpha_longicaudata_entomopoxvirus(11.11%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88021.1\|164893_165844_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88022.1\|167287_168190_-	hypothetical protein	NA	NA	NA	NA
AZW88023.1\|168167_168797_-	LemA family protein	NA	NA	NA	NA
AZW88024.1\|169127_170510_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.3e-42	29.5
AZW88025.1\|170543_171173_+	threonine transporter RhtB	NA	NA	NA	NA
AZW88026.1\|171221_172829_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZW88027.1\|172853_173537_+	hypothetical protein	NA	NA	NA	NA
AZW91283.1\|173618_174095_-	bacterioferritin	NA	NA	NA	NA
AZW88028.1\|174301_175252_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88029.1\|176367_176895_+	lipoprotein	NA	NA	NA	NA
AZW88030.1\|176986_177802_+	lipoprotein	NA	NA	NA	NA
AZW88031.1\|177862_178597_+	sulfurtransferase	NA	NA	NA	NA
AZW88032.1\|178634_180713_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZW88033.1\|180962_181235_-	hypothetical protein	NA	NA	NA	NA
AZW88034.1\|181333_182422_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW88035.1\|182425_184330_+	outer membrane protein assembly factor	NA	NA	NA	NA
AZW88036.1\|184326_188001_+	DUF490 domain-containing protein	NA	NA	NA	NA
AZW88037.1\|188061_188625_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZW88038.1\|188632_189055_-	glyoxalase	NA	NA	NA	NA
AZW88039.1\|189082_189502_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AZW91284.1\|189530_189977_-	N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
AZW88040.1\|190103_190601_+	hypothetical protein	NA	NA	NA	NA
AZW88041.1\|190755_193026_+	lysine decarboxylase	NA	NA	NA	NA
AZW88042.1\|193074_194307_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW88043.1\|194405_195356_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88044.1\|195401_196094_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.4e-83	73.8
AZW88045.1\|196090_196984_+	ZIP family metal transporter	NA	NA	NA	NA
AZW88046.1\|197378_198479_+	aminomethyltransferase	NA	NA	NA	NA
AZW88047.1\|198560_198935_+	glycine cleavage system protein H	NA	NA	NA	NA
AZW88048.1\|198994_201859_+	glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZW88049.1\|202003_202744_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW88050.1\|202813_204025_+	CoA transferase	NA	NA	NA	NA
AZW88051.1\|204053_205022_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88052.1\|205634_206585_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88053.1\|206741_207065_+	PsiF repeat family protein	NA	NA	NA	NA
AZW88054.1\|207169_208219_-	cyclase	NA	NA	NA	NA
AZW88055.1\|208215_209040_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AZW88056.1\|209040_209337_-	YciI family protein	NA	NA	NA	NA
AZW88057.1\|209362_209638_-	muconolactone delta-isomerase	NA	NA	NA	NA
AZW88058.1\|209694_210339_-	CoA transferase subunit B	NA	NA	NA	NA
AZW88059.1\|210338_211025_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW91285.1\|211154_212006_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW88060.1\|212056_212782_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW88061.1\|212813_214163_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZW88062.1\|214274_215207_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZW88063.1\|215664_218460_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
AZW88064.1\|219053_221996_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZW88065.1\|222067_222787_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZW88066.1\|222825_223374_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZW88067.1\|223528_224428_+	virginiamycin B lyase	NA	NA	NA	NA
AZW88068.1\|224452_225403_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

233335 : 286923

Bacillus_phage(25.0%)

tRNA,transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88076.1\|233335_234286_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88077.1\|234372_235323_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88078.1\|235319_236270_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88079.1\|236368_237166_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW88080.1\|238115_238526_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZW88081.1\|239547_240291_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW88082.1\|240334_241378_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88083.1\|241548_243651_+	hypothetical protein	NA	NA	NA	NA
AZW88084.1\|245061_246018_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88085.1\|246036_246528_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZW88086.1\|246524_247880_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZW88087.1\|247880_248579_-	HAD-IB family hydrolase	NA	NA	NA	NA
AZW88088.1\|248575_249277_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZW88089.1\|249529_250579_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZW88090.1\|250684_251626_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZW88091.1\|251622_253512_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZW88092.1\|253598_254237_+	hypothetical protein	NA	NA	NA	NA
AZW91286.1\|254379_255624_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.1e-17	30.3
AZW88093.1\|255695_256232_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZW88094.1\|256383_257775_+	class II fumarate hydratase	NA	NA	NA	NA
AZW88095.1\|257791_258772_-	AEC family transporter	NA	NA	NA	NA
AZW88096.1\|258907_259891_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
AZW88097.1\|259955_260855_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88098.1\|260961_262716_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW88099.1\|262723_263848_-	CoA transferase	NA	NA	NA	NA
AZW88100.1\|263861_264842_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88101.1\|265572_266523_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88102.1\|267082_267628_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
AZW88103.1\|267711_269331_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW88104.1\|269346_270501_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AZW88105.1\|270514_270640_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
AZW88106.1\|270636_272388_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AZW88107.1\|272384_274064_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AZW88108.1\|274099_274675_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.4e-28	43.1
AZW88109.1\|275817_276096_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW88110.1\|277139_278090_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88111.1\|278076_278292_-	hypothetical protein	NA	NA	NA	NA
AZW88112.1\|278367_278529_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZW88113.1\|278536_278677_+	hypothetical protein	NA	NA	NA	NA
AZW88114.1\|279195_279645_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZW88115.1\|279654_280266_-	glutathione S-transferase	NA	NA	NA	NA
AZW88116.1\|280424_281279_-	cytochrome c1	NA	NA	NA	NA
AZW88117.1\|281298_282681_-	cytochrome b	NA	NA	NA	NA
AZW88118.1\|282745_283387_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZW88119.1\|283526_283985_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZW88120.1\|284009_284786_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZW91287.1\|284839_285976_+	PDZ domain-containing protein	W5SAB9	Pithovirus	1.2e-07	31.2
AZW88121.1\|285972_286923_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

555308 : 614608

Acinetobacter_phage(27.27%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88343.1\|555308_556259_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88344.1\|557582_558359_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW88345.1\|558393_560166_+	PDZ domain-containing protein	NA	NA	NA	NA
AZW88346.1\|560167_561070_-	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZW88347.1\|561194_561554_+	dihydroneopterin aldolase	NA	NA	NA	NA
AZW88348.1\|561585_562548_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZW88349.1\|562646_563597_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88350.1\|563609_564545_-	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZW88351.1\|564604_565444_-	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
AZW88352.1\|565440_566610_-	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZW88353.1\|566606_567896_-	hypothetical protein	NA	NA	NA	NA
AZW88354.1\|567938_568313_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZW88355.1\|568418_569156_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZW88356.1\|569163_569868_+	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW88357.1\|570131_571652_+	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZW88358.1\|571707_572271_+	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZW88359.1\|572289_573321_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZW88360.1\|573317_574106_+	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZW88361.1\|574281_575271_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88362.1\|577027_577978_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88363.1\|579200_580103_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88364.1\|580104_580959_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZW88365.1\|581005_582115_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW88366.1\|582125_582644_-	flavin reductase	NA	NA	NA	NA
AZW88367.1\|582673_583306_-	pyridoxine/pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZW88368.1\|583377_584037_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW88369.1\|584033_585254_-	MFS transporter	NA	NA	NA	NA
AZW88370.1\|585522_586395_+\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZW88371.1\|586550_587288_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW88372.1\|587290_588886_-	acyl-CoA synthetase	NA	NA	NA	NA
AZW91308.1\|589017_590007_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88373.1\|590003_590714_+	oxidoreductase	NA	NA	NA	NA
AZW91309.1\|590809_591826_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW88374.1\|592097_592724_-	aminotransferase	NA	NA	NA	NA
AZW88375.1\|592779_593907_-	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZW88376.1\|593912_599630_-	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZW88377.1\|599913_600129_+	hypothetical protein	NA	NA	NA	NA
AZW88378.1\|600197_601142_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZW88379.1\|601330_602266_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZW88380.1\|602383_603955_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88381.1\|604034_605243_+	ABC transporter permease	NA	NA	NA	NA
AZW88382.1\|605740_606658_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW88383.1\|609018_609240_+	hypothetical protein	NA	NA	NA	NA
AZW91310.1\|609570_610587_+\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW88384.1\|610671_610923_-	cell division topological specificity factor	NA	NA	NA	NA
AZW88385.1\|610926_611742_-	septum site-determining protein MinD	NA	NA	NA	NA
AZW88386.1\|611854_612733_-	septum site-determining protein MinC	NA	NA	NA	NA
AZW88387.1\|612844_614608_-\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0

DBSCAN-SWA_5

620763 : 674504

Salmonella_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88391.1\|620763_621714_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88392.1\|621782_622781_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88393.1\|622785_623466_-	DUF533 domain-containing protein	NA	NA	NA	NA
AZW88394.1\|623603_623996_+	OsmC family peroxiredoxin	NA	NA	NA	NA
AZW91311.1\|624103_625120_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW88395.1\|625359_626145_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW88396.1\|626239_627649_-	lytic transglycosylase	NA	NA	NA	NA
AZW88397.1\|627659_628460_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZW88398.1\|628480_629251_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW88399.1\|629293_629761_+	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZW88400.1\|629757_630708_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88401.1\|632656_633535_-	fatty acid desaturase	NA	NA	NA	NA
AZW88402.1\|634461_637440_-	hypothetical protein	NA	NA	NA	NA
AZW88403.1\|637438_637807_+	hypothetical protein	NA	NA	NA	NA
AZW88404.1\|637793_638744_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88405.1\|638740_639829_-	hypothetical protein	NA	NA	NA	NA
AZW88406.1\|639864_640728_-	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZW88407.1\|641867_642257_-	DNA-binding protein	NA	NA	NA	NA
AZW88408.1\|642260_643043_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW88409.1\|643076_643829_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW88410.1\|644137_645277_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88411.1\|645273_646065_+	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZW88412.1\|646061_646811_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZW88413.1\|646807_647680_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW88414.1\|647679_648681_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW88415.1\|648677_649841_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW88416.1\|649866_650550_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW88417.1\|650503_651838_+	CoA ligase	NA	NA	NA	NA
AZW88418.1\|651830_652925_+	CoA transferase	NA	NA	NA	NA
AZW91312.1\|653691_654642_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88419.1\|656582_657842_+	hypothetical protein	NA	NA	NA	NA
AZW88420.1\|657838_659377_+	SpoVR family protein	NA	NA	NA	NA
AZW88421.1\|659373_660570_-	MFS transporter	NA	NA	NA	NA
AZW88422.1\|660566_661958_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW88423.1\|661954_662971_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88424.1\|663039_664275_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW88425.1\|664375_665170_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW88426.1\|665539_665947_+	GFA family protein	NA	NA	NA	NA
AZW88427.1\|666364_666637_-	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW88428.1\|667218_668073_+	urease accessory protein UreD	NA	NA	NA	NA
AZW88429.1\|668173_668476_+	urease subunit gamma	NA	NA	NA	NA
AZW88430.1\|668502_669138_+	urease accessory protein UreJ	NA	NA	NA	NA
AZW88431.1\|669154_669463_+	urease subunit beta	NA	NA	NA	NA
AZW88432.1\|669459_671175_+	urease subunit alpha	NA	NA	NA	NA
AZW88433.1\|671177_671795_+	urease accessory protein UreE	NA	NA	NA	NA
AZW88434.1\|671895_672480_+	urease accessory protein UreF	NA	NA	NA	NA
AZW88435.1\|672504_673149_+	urease accessory protein UreG	NA	NA	NA	NA
AZW88436.1\|673553_674504_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

723391 : 763392

Pseudomonas_phage(33.33%)

tRNA,transposase,integrase,protease

attL 720690:720708|attR 740578:740596

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
720690:720708	attL	NA	NA	NA	NA
AZW88473.1\|723391_724039_+\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
AZW88474.1\|724035_724818_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZW88475.1\|724890_725982_+	redox-regulated ATPase YchF	NA	NA	NA	NA
AZW88476.1\|726261_727389_+\|integrase	site-specific integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
AZW88477.1\|727730_728777_+	Fic family protein	NA	NA	NA	NA
AZW91315.1\|728787_728928_+	DEAD/DEAH box helicase	NA	NA	NA	NA
AZW88478.1\|728924_732044_+	restriction endonuclease	NA	NA	NA	NA
AZW88479.1\|732045_734997_+	restriction endonuclease subunit M	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
AZW88480.1\|735012_736224_+	chromosome segregation protein SMC	NA	NA	NA	NA
AZW88481.1\|736220_736421_+	hypothetical protein	NA	NA	NA	NA
AZW88482.1\|736407_737358_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88483.1\|737374_737869_+	DUF4276 domain-containing protein	NA	NA	NA	NA
AZW88484.1\|737872_738130_+	hypothetical protein	NA	NA	NA	NA
AZW88485.1\|738154_739585_+	ATP-dependent helicase	NA	NA	NA	NA
AZW88486.1\|739654_739951_+	ATP-dependent helicase	A0A1V0SIN4	Klosneuvirus	5.5e-05	34.1
AZW88487.1\|740734_741685_-\|transposase	IS481 family transposase	NA	NA	NA	NA
740578:740596	attR	NA	NA	NA	NA
AZW88488.1\|742103_744668_-	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZW88489.1\|744712_746566_-	hypothetical protein	NA	NA	NA	NA
AZW88490.1\|746898_748470_+	winged helix family transcriptional regulator	NA	NA	NA	NA
AZW88491.1\|749911_750862_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88492.1\|750947_751688_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW88493.1\|751914_752862_-	hypothetical protein	NA	NA	NA	NA
AZW88494.1\|754249_755200_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88495.1\|755186_755375_-	hypothetical protein	NA	NA	NA	NA
AZW88496.1\|755393_756209_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZW88497.1\|756341_757781_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW88498.1\|757794_758136_+	cupin domain-containing protein	NA	NA	NA	NA
AZW88499.1\|758190_759846_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW88500.1\|759997_761008_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88501.1\|761140_761914_+	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88502.1\|762257_762455_+	hypothetical protein	NA	NA	NA	NA
AZW88503.1\|762441_763392_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

773319 : 820937

Bovine_alphaherpesvirus(10.0%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88511.1\|773319_774270_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88512.1\|774408_775161_+	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
AZW88513.1\|775399_777124_+	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.5e-49	32.9
AZW88514.1\|777143_778403_+	SAM-dependent methyltransferase	NA	NA	NA	NA
AZW88515.1\|778417_779512_-	CCA-adding enzyme	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
AZW88516.1\|779508_781635_-	lytic transglycosylase	A0A0S2SXL7	Bacillus_phage	5.5e-14	36.6
AZW88517.1\|781647_782328_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AZW91319.1\|782605_783979_+	MFS transporter	NA	NA	NA	NA
AZW88518.1\|783980_785000_+	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
AZW88519.1\|785063_786035_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88520.1\|786099_787050_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88521.1\|787148_787991_-	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZW88522.1\|787990_788326_-\|holin	phage holin family protein	NA	NA	NA	NA
AZW88523.1\|788396_789815_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	8.7e-40	29.4
AZW88524.1\|790094_791135_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
AZW88525.1\|791214_791466_-	DUF1289 domain-containing protein	NA	NA	NA	NA
AZW88526.1\|791576_792875_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.6e-125	60.9
AZW88527.1\|793023_793878_+	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
AZW88528.1\|793874_794765_+	acyltransferase	NA	NA	NA	NA
AZW88529.1\|794807_795719_+	diaminopimelate epimerase	NA	NA	NA	NA
AZW88530.1\|795745_796438_+	DUF484 domain-containing protein	NA	NA	NA	NA
AZW88531.1\|796452_797433_+	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	3.3e-14	30.5
AZW88532.1\|797445_799587_-	TonB-dependent receptor	NA	NA	NA	NA
AZW88533.1\|799635_800604_-	nickel transporter	NA	NA	NA	NA
AZW91320.1\|800594_801218_-	DUF1007 domain-containing protein	NA	NA	NA	NA
AZW88534.1\|801223_802159_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88535.1\|802155_803052_-	metal ABC transporter permease	NA	NA	NA	NA
AZW88536.1\|803048_803771_-	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.1e-11	30.0
AZW88537.1\|803761_803962_-	hypothetical protein	NA	NA	NA	NA
AZW88538.1\|804099_804603_+	transcriptional repressor	NA	NA	NA	NA
AZW88539.1\|804879_805995_+	GTP-binding protein	NA	NA	NA	NA
AZW88540.1\|806137_806602_+	RNA polymerase-binding protein DksA	NA	NA	NA	NA
AZW88541.1\|806749_807289_+	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AZW88542.1\|807310_808645_+	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
AZW91321.1\|808658_808964_-	RND transporter	NA	NA	NA	NA
AZW88543.1\|809388_809970_+	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AZW88544.1\|810051_811002_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88545.1\|811100_812051_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88546.1\|812491_813397_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW88547.1\|813452_815060_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW88548.1\|815313_816819_-	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
AZW88549.1\|816833_817298_-	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AZW88550.1\|817587_818538_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88551.1\|818700_819231_+	hypothetical protein	NA	NA	NA	NA
AZW88552.1\|819230_819542_+	cell division protein ZapA	NA	NA	NA	NA
AZW88553.1\|819986_820937_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

1005151 : 1099176

Bacillus_virus(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88693.1\|1005151_1006102_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88694.1\|1006204_1006867_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW88695.1\|1006969_1007380_-	hypothetical protein	NA	NA	NA	NA
AZW88696.1\|1007484_1008486_+	amidase	NA	NA	NA	NA
AZW88697.1\|1008488_1009685_+	CoA transferase	NA	NA	NA	NA
AZW88698.1\|1009705_1010509_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW88699.1\|1010589_1010886_+	histidine kinase	NA	NA	NA	NA
AZW88700.1\|1010916_1011480_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW91335.1\|1011520_1012378_+	ABC transporter permease	NA	NA	NA	NA
AZW88701.1\|1012385_1013135_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.2e-29	33.5
AZW88702.1\|1013156_1014029_+	hypothetical protein	NA	NA	NA	NA
AZW88703.1\|1014057_1014837_+	KR domain-containing protein	NA	NA	NA	NA
AZW88704.1\|1014870_1015668_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW88705.1\|1017119_1018292_+	hypothetical protein	A0A2H4PQU7	Staphylococcus_phage	1.1e-59	39.6
AZW88706.1\|1018322_1018715_+	RidA family protein	NA	NA	NA	NA
AZW88707.1\|1018708_1019569_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW88708.1\|1019572_1020535_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW91336.1\|1021311_1022001_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.8e-12	28.8
AZW88709.1\|1022861_1023812_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88710.1\|1024161_1025031_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88711.1\|1025101_1025797_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
AZW88712.1\|1025786_1026296_+	nucleoside deaminase	NA	NA	NA	NA
AZW88713.1\|1026292_1027513_+	MFS transporter	NA	NA	NA	NA
AZW88714.1\|1027460_1028363_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88715.1\|1029249_1030536_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88716.1\|1030574_1031948_+	amidase	NA	NA	NA	NA
AZW88717.1\|1031986_1032688_-	riboflavin synthase	NA	NA	NA	NA
AZW88718.1\|1032986_1033976_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88719.1\|1034076_1034538_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW88720.1\|1034553_1035102_-	cysteine dioxygenase	NA	NA	NA	NA
AZW88721.1\|1035243_1036719_-	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	3.0e-35	25.6
AZW88722.1\|1036824_1037916_+	DUF2817 domain-containing protein	NA	NA	NA	NA
AZW88723.1\|1037919_1038702_-	ABC transporter permease	NA	NA	NA	NA
AZW88724.1\|1038711_1039500_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-33	40.0
AZW88725.1\|1040625_1041060_-	PaaI family thioesterase	NA	NA	NA	NA
AZW88726.1\|1041056_1042067_-	alcohol dehydrogenase	NA	NA	NA	NA
AZW88727.1\|1042110_1043037_-	VOC family protein	NA	NA	NA	NA
AZW88728.1\|1043323_1043692_+	DUF861 domain-containing protein	NA	NA	NA	NA
AZW91337.1\|1043908_1044859_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91338.1\|1044840_1047330_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-86	33.8
AZW88729.1\|1047378_1048071_+	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	4.7e-07	29.9
AZW88730.1\|1048143_1049343_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW88731.1\|1049360_1050266_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88732.1\|1050381_1051311_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW91339.1\|1051336_1052683_+	MFS transporter	NA	NA	NA	NA
AZW91340.1\|1052710_1053460_+	NAD(P)-dependent oxidoreductase	A0A0M4JSW6	Mollivirus	1.2e-11	26.4
AZW88733.1\|1053473_1054256_+	short-chain dehydrogenase	NA	NA	NA	NA
AZW88734.1\|1054448_1055399_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88735.1\|1055460_1056606_-	porin	NA	NA	NA	NA
AZW88736.1\|1057082_1057919_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.6e-33	33.3
AZW88737.1\|1057988_1058954_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88738.1\|1058950_1059901_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88739.1\|1059887_1060082_-	hypothetical protein	NA	NA	NA	NA
AZW88740.1\|1060286_1060829_+	hypothetical protein	NA	NA	NA	NA
AZW88741.1\|1061864_1062815_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88742.1\|1063056_1063425_+	hypothetical protein	NA	NA	NA	NA
AZW88743.1\|1063470_1064595_+	hypothetical protein	NA	NA	NA	NA
AZW91341.1\|1065729_1066470_-	oxidoreductase	NA	NA	NA	NA
AZW88744.1\|1066573_1067194_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW88745.1\|1067297_1068248_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88746.1\|1068244_1070353_-	AsmA family protein	NA	NA	NA	NA
AZW88747.1\|1070497_1071157_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AZW91342.1\|1071188_1071653_-	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AZW88748.1\|1071928_1072114_+	hypothetical protein	NA	NA	NA	NA
AZW88749.1\|1072165_1072918_-	DNA-binding protein	NA	NA	NA	NA
AZW88750.1\|1072924_1074187_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88751.1\|1074228_1075467_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88752.1\|1076544_1077672_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
AZW88753.1\|1077682_1078510_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW88754.1\|1078496_1079363_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW88755.1\|1080729_1081134_-	hypothetical protein	NA	NA	NA	NA
AZW88756.1\|1081225_1082176_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91343.1\|1082545_1083457_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW88757.1\|1083471_1084182_+	FadR family transcriptional regulator	NA	NA	NA	NA
AZW88758.1\|1084178_1085423_+	DUF521 domain-containing protein	NA	NA	NA	NA
AZW88759.1\|1085424_1085859_+	DUF126 domain-containing protein	NA	NA	NA	NA
AZW88760.1\|1085887_1086193_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW88761.1\|1086086_1086305_+	hypothetical protein	NA	NA	NA	NA
AZW88762.1\|1086291_1087242_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88763.1\|1087298_1088447_-	alcohol dehydrogenase	NA	NA	NA	NA
AZW88764.1\|1088527_1089478_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88765.1\|1089997_1090795_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88766.1\|1090842_1091496_-	ABC transporter permease	NA	NA	NA	NA
AZW88767.1\|1091452_1092541_-	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZW88768.1\|1092705_1094931_-	glycosyl hydrolase	NA	NA	NA	NA
AZW88769.1\|1097208_1098105_+	inositol monophosphatase	NA	NA	NA	NA
AZW88770.1\|1097993_1098239_+	hypothetical protein	NA	NA	NA	NA
AZW88771.1\|1098225_1099176_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1129562 : 1200532

uncultured_Mediterranean_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88800.1\|1129562_1130513_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88801.1\|1130569_1131682_+	malate dehydrogenase	NA	NA	NA	NA
AZW88802.1\|1134065_1135016_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88803.1\|1135606_1136383_+	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZW88804.1\|1136500_1136764_-	30S ribosomal protein S20	NA	NA	NA	NA
AZW88805.1\|1136864_1137869_-	DUF4880 domain-containing protein	NA	NA	NA	NA
AZW88806.1\|1138069_1139671_-	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZW88807.1\|1139696_1140455_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW88808.1\|1140546_1141203_-	adenylate kinase	NA	NA	NA	NA
AZW88809.1\|1141293_1142058_-	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZW88810.1\|1142067_1142256_-	hypothetical protein	NA	NA	NA	NA
AZW88811.1\|1142311_1143355_-	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZW88812.1\|1143351_1143765_-	biopolymer transporter ExbD	NA	NA	NA	NA
AZW88813.1\|1143761_1144382_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AZW88814.1\|1144662_1145613_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88815.1\|1145780_1147172_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AZW88816.1\|1147244_1147823_+	superoxide dismutase [Fe]	NA	NA	NA	NA
AZW88817.1\|1147939_1149337_+	chloride channel protein EriC	NA	NA	NA	NA
AZW88818.1\|1149452_1150658_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AZW88819.1\|1150757_1151276_-	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
AZW88820.1\|1151370_1151616_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AZW88821.1\|1151843_1152158_+\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AZW88822.1\|1152247_1157437_+	alpha-2-macroglobulin family protein	NA	NA	NA	NA
AZW91345.1\|1157433_1159602_+	penicillin-binding protein 1C	NA	NA	NA	NA
AZW88823.1\|1159621_1161973_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.2e-164	41.9
AZW88824.1\|1161977_1163297_+	paraquat-inducible membrane protein A	NA	NA	NA	NA
AZW88825.1\|1163315_1164989_+	MCE family protein	NA	NA	NA	NA
AZW88826.1\|1164993_1165662_+	lipoprotein	NA	NA	NA	NA
AZW88827.1\|1165818_1169640_+	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW88828.1\|1169970_1170921_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88829.1\|1170942_1172088_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88830.1\|1172236_1173166_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW88831.1\|1173162_1174251_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW88832.1\|1174247_1175051_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
AZW88833.1\|1175047_1175779_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
AZW88834.1\|1175836_1177126_-	MFS transporter	NA	NA	NA	NA
AZW88835.1\|1177222_1177825_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW88836.1\|1182377_1182716_-	transcriptional regulator	NA	NA	NA	NA
AZW88837.1\|1183384_1183690_+	hypothetical protein	NA	NA	NA	NA
AZW88838.1\|1185396_1186347_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88839.1\|1186343_1187675_-	MFS transporter	NA	NA	NA	NA
AZW88840.1\|1188914_1190936_+	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW88841.1\|1190928_1191570_+	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AZW88842.1\|1191566_1191974_+	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AZW88843.1\|1191970_1192771_+	SURF1 family protein	NA	NA	NA	NA
AZW88844.1\|1192845_1193550_+	oxidoreductase	NA	NA	NA	NA
AZW88845.1\|1193581_1194376_+	N-formylglutamate deformylase	NA	NA	NA	NA
AZW88846.1\|1194372_1195323_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88847.1\|1195421_1196372_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88848.1\|1196470_1196905_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AZW88849.1\|1196987_1199324_+	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-124	42.8
AZW91346.1\|1199515_1200532_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1216727 : 1273434

Agrobacterium_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88864.1\|1216727_1217678_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88865.1\|1217780_1218365_+	nitroreductase	NA	NA	NA	NA
AZW91349.1\|1218434_1219856_-	argininosuccinate lyase	NA	NA	NA	NA
AZW88866.1\|1219963_1221310_+	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AZW88867.1\|1221348_1222983_+	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AZW88868.1\|1223026_1223365_+	P-II family nitrogen regulator	NA	NA	NA	NA
AZW88869.1\|1223389_1223764_-	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AZW88870.1\|1226876_1227758_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88871.1\|1227865_1229494_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW88872.1\|1229535_1231053_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88873.1\|1231147_1232092_+	ABC transporter permease	NA	NA	NA	NA
AZW88874.1\|1233273_1234176_-	ribosome biogenesis GTPase	NA	NA	NA	NA
AZW88875.1\|1234172_1235438_-	peptidase M48	NA	NA	NA	NA
AZW88876.1\|1235482_1236028_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AZW88877.1\|1236061_1236748_+	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AZW88878.1\|1236719_1237649_-	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AZW88879.1\|1237820_1238810_+	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AZW88880.1\|1238874_1239159_+	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AZW88881.1\|1239174_1239939_+	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AZW91350.1\|1239935_1240442_+	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AZW88882.1\|1241603_1242554_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88883.1\|1242641_1244294_+	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AZW88884.1\|1244304_1245093_+	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AZW88885.1\|1245092_1245563_+	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AZW88886.1\|1245637_1246951_+	phenylacetate--CoA ligase	NA	NA	NA	NA
AZW88887.1\|1247004_1247610_-	fimbrial protein FimX	NA	NA	NA	NA
AZW88888.1\|1247836_1248787_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88889.1\|1248975_1249926_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88890.1\|1249922_1250873_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88891.1\|1250859_1251210_-	hypothetical protein	NA	NA	NA	NA
AZW88892.1\|1251133_1252162_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW88893.1\|1252241_1253540_-	TRAP transporter large permease	NA	NA	NA	NA
AZW88894.1\|1253536_1254118_-	TRAP transporter small permease	NA	NA	NA	NA
AZW88895.1\|1254430_1258477_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
AZW88896.1\|1258717_1266379_+	adhesin	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
AZW88897.1\|1266375_1267326_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88898.1\|1268465_1268939_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW88899.1\|1269078_1269699_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZW88900.1\|1269834_1270635_+	aldolase	NA	NA	NA	NA
AZW88901.1\|1270689_1271781_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88902.1\|1271802_1272246_-	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AZW88903.1\|1272274_1272907_-	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
AZW88904.1\|1273017_1273434_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA

DBSCAN-SWA_11

1301801 : 1359012

Klosneuvirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW88928.1\|1301801_1302752_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88929.1\|1306498_1307110_-	DUF2239 domain-containing protein	NA	NA	NA	NA
AZW88930.1\|1307332_1308793_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.6e-97	41.3
AZW88931.1\|1308889_1310482_+	GMP synthase (glutamine-hydrolyzing)	A0A1V0SH76	Hokovirus	1.0e-17	33.3
AZW88932.1\|1310468_1310747_+	hypothetical protein	NA	NA	NA	NA
AZW88933.1\|1310805_1311093_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZW88934.1\|1311094_1312435_+	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW88935.1\|1312530_1313220_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW88936.1\|1313232_1314663_+	MFS transporter	NA	NA	NA	NA
AZW88937.1\|1316387_1317209_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW88938.1\|1317219_1318791_+	amidohydrolase	NA	NA	NA	NA
AZW88939.1\|1318819_1319797_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88940.1\|1319823_1320627_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.7e-30	38.2
AZW88941.1\|1320623_1321418_+	ABC transporter permease	NA	NA	NA	NA
AZW88942.1\|1321425_1322661_+	DUF521 domain-containing protein	NA	NA	NA	NA
AZW88943.1\|1322653_1323088_+	DUF126 domain-containing protein	NA	NA	NA	NA
AZW88944.1\|1323837_1324788_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88945.1\|1325409_1327137_-	sodium-independent anion transporter	NA	NA	NA	NA
AZW88946.1\|1327248_1328607_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW88947.1\|1328727_1328913_+	hypothetical protein	NA	NA	NA	NA
AZW88948.1\|1328899_1329850_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88949.1\|1329890_1330961_+	FUSC family protein	NA	NA	NA	NA
AZW91352.1\|1330983_1331862_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW88950.1\|1332033_1333005_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW88951.1\|1333167_1334010_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW88952.1\|1334171_1334852_+	anti-sigma factor	NA	NA	NA	NA
AZW88953.1\|1334845_1336015_+	amine oxidase	NA	NA	NA	NA
AZW88954.1\|1336011_1337043_+	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZW88955.1\|1337086_1338328_+	MFS transporter	NA	NA	NA	NA
AZW88956.1\|1338362_1339895_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW88957.1\|1339975_1340599_+	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW88958.1\|1340629_1341241_+	LysE family translocator	NA	NA	NA	NA
AZW88959.1\|1341276_1341747_+	DUF1801 domain-containing protein	NA	NA	NA	NA
AZW88960.1\|1342178_1343183_+	peptidase M20	NA	NA	NA	NA
AZW88961.1\|1343219_1344734_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW88962.1\|1344737_1345697_+	ABC transporter permease	NA	NA	NA	NA
AZW88963.1\|1345725_1346529_+	ABC transporter permease	NA	NA	NA	NA
AZW88964.1\|1346530_1348165_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZW88965.1\|1348248_1349310_+	LacI family transcriptional regulator	NA	NA	NA	NA
AZW88966.1\|1349508_1349778_+	hypothetical protein	NA	NA	NA	NA
AZW88967.1\|1349781_1350306_+	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZW88968.1\|1350721_1351672_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88969.1\|1351668_1352739_-	metal-dependent hydrolase	NA	NA	NA	NA
AZW88970.1\|1352811_1353450_+	DedA family protein	NA	NA	NA	NA
AZW88971.1\|1353744_1353972_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW88972.1\|1354094_1354808_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW88973.1\|1355052_1356003_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW88974.1\|1356106_1356388_+	hypothetical protein	NA	NA	NA	NA
AZW88975.1\|1356502_1357951_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW88976.1\|1358061_1359012_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1449245 : 1501398

Salmonella_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW89058.1\|1449245_1450196_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89059.1\|1450362_1450716_+	cytochrome C	NA	NA	NA	NA
AZW89060.1\|1450728_1451091_+	cytochrome	NA	NA	NA	NA
AZW89061.1\|1451132_1451558_-	DUF1841 domain-containing protein	NA	NA	NA	NA
AZW89062.1\|1451760_1453017_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.2e-11	64.8
AZW89063.1\|1453215_1454196_+	hypothetical protein	NA	NA	NA	NA
AZW89064.1\|1454345_1455587_+	hypothetical protein	NA	NA	NA	NA
AZW89065.1\|1455685_1456636_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89066.1\|1456644_1457340_-	two-component system response regulator KdpE	NA	NA	NA	NA
AZW89067.1\|1460161_1460761_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
AZW89068.1\|1460771_1462937_-	K(+)-transporting ATPase subunit B	M1HBF8	Paramecium_bursaria_Chlorella_virus	1.2e-24	27.1
AZW89069.1\|1462960_1464745_-	potassium-transporting ATPase A chain	NA	NA	NA	NA
AZW89070.1\|1464744_1464834_-	K(+)-transporting ATPase subunit F	NA	NA	NA	NA
AZW89071.1\|1465528_1465801_+	DUF4212 domain-containing protein	NA	NA	NA	NA
AZW89072.1\|1465800_1467867_+	cation acetate symporter	NA	NA	NA	NA
AZW89073.1\|1467863_1468814_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89074.1\|1468912_1469863_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89075.1\|1469978_1470311_-	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
AZW89076.1\|1470307_1470994_-	DNA mismatch repair protein MutS	NA	NA	NA	NA
AZW89077.1\|1470980_1471940_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.1e-57	40.2
AZW91360.1\|1471981_1474342_+	DNA translocase FtsK	S5VNE3	Mycobacterium_phage	7.6e-81	48.0
AZW89078.1\|1474341_1474974_+	outer-membrane lipoprotein carrier protein LolA	NA	NA	NA	NA
AZW89079.1\|1475036_1476416_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.6e-75	38.9
AZW89080.1\|1476462_1477818_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.6e-83	47.5
AZW89081.1\|1478096_1478345_+	hypothetical protein	NA	NA	NA	NA
AZW89082.1\|1478532_1478850_-	virulence factor	NA	NA	NA	NA
AZW89083.1\|1479122_1479638_-	hypothetical protein	T1SAR8	Salmonella_phage	5.1e-06	44.6
AZW89084.1\|1479731_1479893_+	hypothetical protein	NA	NA	NA	NA
AZW89085.1\|1479908_1480664_-	GGDEF domain-containing protein	NA	NA	NA	NA
AZW89086.1\|1481002_1481209_+	hypothetical protein	NA	NA	NA	NA
AZW89087.1\|1481216_1481876_-	antibiotic resistance protein	NA	NA	NA	NA
AZW89088.1\|1482170_1484375_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW89089.1\|1484485_1485709_-	MFS transporter	S4TR35	Salmonella_phage	9.8e-24	29.4
AZW89090.1\|1485831_1486806_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW89091.1\|1486873_1488067_-	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
AZW89092.1\|1488081_1488882_-	siderophore ferric iron reductase	NA	NA	NA	NA
AZW89093.1\|1488878_1490735_-	IucA/IucC family siderophore biosynthesis protein	NA	NA	NA	NA
AZW89094.1\|1490731_1491337_-	N-acetyltransferase	NA	NA	NA	NA
AZW89095.1\|1491355_1492741_-	alcaligin biosynthesis enzyme	NA	NA	NA	NA
AZW89096.1\|1493466_1494693_+	transporter	NA	NA	NA	NA
AZW89097.1\|1494781_1495564_+	3-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW89098.1\|1495662_1496613_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89099.1\|1496639_1497413_+	peroxide stress protein YaaA	NA	NA	NA	NA
AZW89100.1\|1497424_1498666_+	MFS transporter	NA	NA	NA	NA
AZW89101.1\|1500447_1501398_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1604283 : 1675437

Ectocarpus_siliculosus_virus(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW89198.1\|1604283_1605234_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89199.1\|1605255_1606476_+	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
AZW89200.1\|1606661_1608074_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZW89201.1\|1608137_1609205_+	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZW89202.1\|1609201_1610692_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZW91365.1\|1610701_1611646_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89203.1\|1611805_1612504_+	pirin family protein	NA	NA	NA	NA
AZW89204.1\|1612581_1613487_+	pirin family protein	NA	NA	NA	NA
AZW89205.1\|1613506_1614457_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89206.1\|1614555_1615350_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AZW89207.1\|1615354_1617025_-	iron ABC transporter permease	NA	NA	NA	NA
AZW89208.1\|1617148_1618198_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89209.1\|1618519_1619296_+	ferredoxin--NADP reductase	NA	NA	NA	NA
AZW89210.1\|1619360_1620263_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89211.1\|1621556_1622360_+	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AZW89212.1\|1625053_1625440_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
AZW89213.1\|1625455_1627546_+	DNA helicase RecG	NA	NA	NA	NA
AZW89214.1\|1627597_1628551_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AZW91366.1\|1628565_1629453_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89215.1\|1629590_1631117_+	methylmalonate-semialdehyde dehydrogenase (CoA acylating)	NA	NA	NA	NA
AZW91367.1\|1631215_1631716_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AZW89216.1\|1632039_1633995_-	capsular biosynthesis protein	NA	NA	NA	NA
AZW89217.1\|1634162_1636247_-	hypothetical protein	NA	NA	NA	NA
AZW89218.1\|1636273_1637059_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-12	32.0
AZW89219.1\|1637914_1638685_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AZW89220.1\|1638684_1639425_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW89221.1\|1639466_1640636_+	capsule biosynthesis protein	NA	NA	NA	NA
AZW89222.1\|1640667_1642752_+	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AZW89223.1\|1642748_1643639_+	capsular biosynthesis protein	NA	NA	NA	NA
AZW89224.1\|1643635_1644733_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW89225.1\|1644755_1646045_+	nucleotide sugar dehydrogenase	NA	NA	NA	NA
AZW89226.1\|1646056_1647082_+	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AZW89227.1\|1647078_1649136_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW89228.1\|1649149_1650325_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZW89229.1\|1650406_1651357_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89230.1\|1651415_1652189_+	oxidoreductase	NA	NA	NA	NA
AZW89231.1\|1652181_1653738_+	LTA synthase family protein	NA	NA	NA	NA
AZW89232.1\|1653734_1654685_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89233.1\|1656011_1656614_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW89234.1\|1656853_1657555_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW89235.1\|1657548_1658331_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZW89236.1\|1658515_1659466_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89237.1\|1659564_1660302_-	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZW89238.1\|1660491_1661250_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW89239.1\|1661296_1662286_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW89240.1\|1662463_1663432_-	transporter	NA	NA	NA	NA
AZW89241.1\|1664971_1665940_+	AAA family ATPase	NA	NA	NA	NA
AZW89242.1\|1665948_1666890_+	DUF58 domain-containing protein	NA	NA	NA	NA
AZW89243.1\|1667363_1668374_+	hypothetical protein	NA	NA	NA	NA
AZW91368.1\|1668364_1669879_+	VWA domain-containing protein	NA	NA	NA	NA
AZW89244.1\|1669875_1671222_+	hypothetical protein	NA	NA	NA	NA
AZW91369.1\|1671224_1672259_+	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
AZW89245.1\|1672308_1673934_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZW89246.1\|1674486_1675437_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1696228 : 1757576

uncultured_Caudovirales_phage(12.5%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW89260.1\|1696228_1697179_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91375.1\|1697472_1698195_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AZW89261.1\|1698633_1699821_-	MFS transporter	NA	NA	NA	NA
AZW89262.1\|1699824_1700205_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AZW89263.1\|1701924_1702896_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW89264.1\|1702909_1703623_+	NAD-dependent oxidoreductase	NA	NA	NA	NA
AZW89265.1\|1703627_1704545_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89266.1\|1704651_1704948_+	hypothetical protein	NA	NA	NA	NA
AZW89267.1\|1705046_1705997_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89268.1\|1707155_1710089_+	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AZW89269.1\|1710088_1710433_+	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AZW89270.1\|1710429_1712058_+	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AZW89271.1\|1712054_1712534_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AZW89272.1\|1712530_1712815_+	K+/H+ antiporter subunit F	NA	NA	NA	NA
AZW89273.1\|1712811_1713138_+	cation:proton antiporter	NA	NA	NA	NA
AZW89274.1\|1713293_1714244_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89275.1\|1714287_1714830_+	hypothetical protein	NA	NA	NA	NA
AZW89276.1\|1714927_1715776_+	hydrolase	NA	NA	NA	NA
AZW89277.1\|1715768_1716275_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.4e-07	38.4
AZW89278.1\|1716271_1717273_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
AZW89279.1\|1717285_1718080_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW89280.1\|1718128_1720030_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW89281.1\|1720026_1720650_-	hypothetical protein	NA	NA	NA	NA
AZW89282.1\|1720776_1721901_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89283.1\|1722218_1723886_+	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.6e-53	28.9
AZW89284.1\|1724041_1724818_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
AZW89285.1\|1724902_1725901_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89286.1\|1725897_1726671_+	ABC transporter permease	NA	NA	NA	NA
AZW89287.1\|1727655_1728606_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89288.1\|1728629_1729094_-	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
AZW89289.1\|1729240_1730449_+	flavohemoprotein	NA	NA	NA	NA
AZW89290.1\|1730459_1730930_+	DNA-binding protein	NA	NA	NA	NA
AZW89291.1\|1731048_1732338_+	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW89292.1\|1735078_1736029_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89293.1\|1736127_1737144_-	folate-binding protein	NA	NA	NA	NA
AZW89294.1\|1737310_1738357_+	endolytic transglycosylase MltG	NA	NA	NA	NA
AZW89295.1\|1738353_1738980_+	thymidylate kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
AZW89296.1\|1738976_1740029_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
AZW89297.1\|1740078_1740849_+	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW89298.1\|1740899_1741736_+	hypothetical protein	NA	NA	NA	NA
AZW89299.1\|1741931_1742672_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW89300.1\|1742746_1743490_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89301.1\|1744151_1744925_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	37.7
AZW89302.1\|1746062_1747352_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AZW89303.1\|1748962_1750210_-	Zn-dependent hydrolase	NA	NA	NA	NA
AZW89304.1\|1750219_1751929_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
AZW89305.1\|1751925_1752864_-	CoA ester lyase	NA	NA	NA	NA
AZW89306.1\|1752860_1754144_-	TRAP transporter large permease	NA	NA	NA	NA
AZW89307.1\|1754147_1754630_-	TRAP transporter small permease	NA	NA	NA	NA
AZW89308.1\|1754630_1755617_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89309.1\|1755789_1756509_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW89310.1\|1756625_1757576_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1909381 : 1953767

Faecalibacterium_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW89416.1\|1909381_1910332_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89417.1\|1910413_1910962_-	OmpA family protein	NA	NA	NA	NA
AZW89418.1\|1910964_1911303_-	hypothetical protein	NA	NA	NA	NA
AZW89419.1\|1911697_1914289_-	bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase	NA	NA	NA	NA
AZW89420.1\|1914355_1915099_+	3'-5' exonuclease	A0A2K9V2V7	Faecalibacterium_phage	4.3e-06	31.8
AZW89421.1\|1915111_1915498_+	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
AZW89422.1\|1915504_1915795_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW89423.1\|1915930_1916230_+	hypothetical protein	NA	NA	NA	NA
AZW89424.1\|1916298_1917201_+	EamA family transporter	NA	NA	NA	NA
AZW89425.1\|1917204_1917975_+	anion permease	NA	NA	NA	NA
AZW89426.1\|1918360_1918810_+	hypothetical protein	NA	NA	NA	NA
AZW89427.1\|1918877_1919828_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89428.1\|1919814_1920045_-	hypothetical protein	NA	NA	NA	NA
AZW89429.1\|1920189_1921101_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89430.1\|1921326_1922844_+	propionyl-CoA--succinate CoA transferase	NA	NA	NA	NA
AZW89431.1\|1924075_1925038_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89432.1\|1925126_1925375_+	hypothetical protein	NA	NA	NA	NA
AZW89433.1\|1931932_1932376_-	hypothetical protein	NA	NA	NA	NA
AZW89434.1\|1932440_1932713_-	N-acetyltransferase	NA	NA	NA	NA
AZW89435.1\|1932709_1933657_-	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW89436.1\|1933838_1935233_+	amidase	NA	NA	NA	NA
AZW89437.1\|1935255_1935651_-	hypothetical protein	NA	NA	NA	NA
AZW89438.1\|1935647_1936907_-	gamma-glutamyl-phosphate reductase	A0A1X9I5D4	Streptococcus_phage	1.1e-91	45.7
AZW89439.1\|1937028_1938084_-	DNA polymerase III subunit delta	NA	NA	NA	NA
AZW89440.1\|1938086_1938746_-	lipoprotein	NA	NA	NA	NA
AZW89441.1\|1938761_1941419_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	3.3e-173	39.0
AZW89442.1\|1941496_1942699_-	MFS transporter	NA	NA	NA	NA
AZW89443.1\|1942695_1943208_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW91385.1\|1943330_1943669_-	DNA-binding protein	NA	NA	NA	NA
AZW89444.1\|1944044_1944995_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89445.1\|1945093_1946044_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89446.1\|1946207_1948103_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	2.3e-19	27.5
AZW89447.1\|1948216_1948384_-	50S ribosomal protein L33	NA	NA	NA	NA
AZW89448.1\|1948447_1948684_-	50S ribosomal protein L28	NA	NA	NA	NA
AZW89449.1\|1949052_1950252_-	Bcr/CflA family drug resistance efflux transporter	NA	NA	NA	NA
AZW89450.1\|1951767_1952718_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89451.1\|1952816_1953767_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

2148983 : 2204219

Lake_Baikal_phage(25.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW89614.1\|2148983_2149934_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89615.1\|2150134_2150944_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW89616.1\|2151068_2152019_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89617.1\|2152015_2152909_-	methylglyoxal synthase	NA	NA	NA	NA
AZW89618.1\|2153033_2153228_-	Fe-S assembly protein IscX	NA	NA	NA	NA
AZW89619.1\|2153227_2153569_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AZW89620.1\|2153578_2155441_-	chaperone protein HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
AZW89621.1\|2155570_2156083_-	co-chaperone protein HscB	NA	NA	NA	NA
AZW89622.1\|2156085_2156409_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
AZW89623.1\|2156410_2156821_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
AZW89624.1\|2156858_2158070_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
AZW89625.1\|2158087_2158600_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
AZW89626.1\|2158815_2159307_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
AZW89627.1\|2159559_2161596_-	UvrABC system protein B	NA	NA	NA	NA
AZW89628.1\|2161673_2162876_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW89629.1\|2162926_2163655_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	2.8e-10	50.7
AZW89630.1\|2165212_2166163_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89631.1\|2166733_2166946_-	hypothetical protein	NA	NA	NA	NA
AZW89632.1\|2166963_2167695_-	hypothetical protein	NA	NA	NA	NA
AZW89633.1\|2167729_2168371_-	CoA transferase subunit B	NA	NA	NA	NA
AZW89634.1\|2168363_2169080_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW89635.1\|2171244_2172021_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW89636.1\|2172042_2173200_-	thiolase	NA	NA	NA	NA
AZW89637.1\|2173196_2173628_-	hypothetical protein	NA	NA	NA	NA
AZW89638.1\|2173624_2174428_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW89639.1\|2174441_2174897_-	MaoC family dehydratase	NA	NA	NA	NA
AZW89640.1\|2174909_2175881_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW89641.1\|2175946_2177170_-	CoA transferase	NA	NA	NA	NA
AZW89642.1\|2177397_2178348_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89643.1\|2178471_2180925_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZW89644.1\|2181113_2182418_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZW89645.1\|2182522_2183176_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZW89646.1\|2183178_2184489_-	trigger factor	NA	NA	NA	NA
AZW89647.1\|2184667_2185246_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZW89648.1\|2185357_2185558_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZW89649.1\|2185903_2186470_-	DUF924 domain-containing protein	NA	NA	NA	NA
AZW89650.1\|2186553_2186757_-	cold-shock protein CspA	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZW89651.1\|2187063_2187384_-	hypothetical protein	NA	NA	NA	NA
AZW89652.1\|2187425_2187707_-	hypothetical protein	NA	NA	NA	NA
AZW89653.1\|2187781_2189038_-	autotransporter Phg	NA	NA	NA	NA
AZW89654.1\|2189420_2189750_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW89655.1\|2191320_2192142_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZW89656.1\|2192141_2193281_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZW89657.1\|2193287_2194184_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZW89658.1\|2194180_2196106_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZW89659.1\|2196465_2199078_+	TonB-dependent receptor	NA	NA	NA	NA
AZW89660.1\|2199130_2201431_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZW89661.1\|2201427_2202636_-	acyl-CoA desaturase	NA	NA	NA	NA
AZW89662.1\|2202897_2203272_+	hypothetical protein	NA	NA	NA	NA
AZW89663.1\|2203268_2204219_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2507129 : 2565373

Planktothrix_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW89915.1\|2507129_2508080_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89916.1\|2508559_2509216_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
AZW89917.1\|2509230_2510898_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW89918.1\|2510900_2511530_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89919.1\|2511741_2512836_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89920.1\|2512980_2513793_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AZW89921.1\|2513796_2515500_-	peptidoglycan-binding protein LysM	NA	NA	NA	NA
AZW89922.1\|2515550_2516681_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW89923.1\|2516867_2517944_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
AZW91410.1\|2518025_2518676_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZW89924.1\|2518690_2520124_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
AZW89925.1\|2520377_2521196_-	tungsten ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW89926.1\|2521192_2521897_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-13	30.0
AZW89927.1\|2522796_2523912_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89928.1\|2523945_2524320_-	hypothetical protein	NA	NA	NA	NA
AZW89929.1\|2524342_2525500_-	formate dehydrogenase subunit gamma	NA	NA	NA	NA
AZW89930.1\|2525512_2525746_-	lipoprotein	NA	NA	NA	NA
AZW89931.1\|2526380_2529350_-	formate dehydrogenase	NA	NA	NA	NA
AZW89932.1\|2529364_2529574_-	formate dehydrogenase	NA	NA	NA	NA
AZW89933.1\|2529725_2530355_-	hypothetical protein	NA	NA	NA	NA
AZW89934.1\|2530351_2532469_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
AZW89935.1\|2532465_2533146_-	DUF3306 domain-containing protein	NA	NA	NA	NA
AZW89936.1\|2533142_2533703_-	DUF3305 domain-containing protein	NA	NA	NA	NA
AZW89937.1\|2533709_2534807_-	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW89938.1\|2534944_2535553_+	molybdenum cofactor guanylyltransferase MobA	NA	NA	NA	NA
AZW89939.1\|2535549_2536842_+	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZW89940.1\|2536855_2537398_+	molybdopterin-guanine dinucleotide biosynthesis protein B	NA	NA	NA	NA
AZW89941.1\|2537407_2538244_-	M48 family peptidase	NA	NA	NA	NA
AZW89942.1\|2538277_2539339_-	chorismate synthase	A0A291AU41	Pandoravirus	2.9e-80	42.8
AZW89943.1\|2539380_2540433_-	GGDEF domain-containing protein	NA	NA	NA	NA
AZW89944.1\|2540448_2540751_-	hypothetical protein	NA	NA	NA	NA
AZW89945.1\|2540892_2541843_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89946.1\|2542021_2543716_+	iron ABC transporter permease	NA	NA	NA	NA
AZW89947.1\|2543712_2544798_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.4e-27	37.7
AZW89948.1\|2544845_2545745_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW89949.1\|2545755_2546400_+	histidine phosphatase family protein	NA	NA	NA	NA
AZW89950.1\|2547421_2550664_-	carbamoyl-phosphate synthase large subunit	NA	NA	NA	NA
AZW89951.1\|2550674_2551772_-	carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	5.3e-53	35.2
AZW89952.1\|2552034_2553018_+	transaldolase	H6WFR1	Cyanophage	5.9e-11	29.2
AZW89953.1\|2553116_2554067_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89954.1\|2554165_2555116_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89955.1\|2555125_2555815_-	VIT family protein	NA	NA	NA	NA
AZW89956.1\|2555874_2556312_-	PaaI family thioesterase	NA	NA	NA	NA
AZW89957.1\|2556357_2557251_-	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AZW89958.1\|2557298_2558471_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW89959.1\|2558467_2559622_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW89960.1\|2559818_2560169_-	RnfH family protein	NA	NA	NA	NA
AZW89961.1\|2560158_2560593_-	ubiquinone-binding protein	NA	NA	NA	NA
AZW89962.1\|2560609_2561560_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW89963.1\|2561707_2562175_+	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AZW89964.1\|2562155_2563313_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AZW89965.1\|2563378_2564305_-	paraslipin	NA	NA	NA	NA
AZW89966.1\|2564422_2565373_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2607653 : 2674153

uncultured_Caudovirales_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90005.1\|2607653_2608604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90006.1\|2608973_2609546_+	flagellar basal body-associated protein FliL	NA	NA	NA	NA
AZW90007.1\|2609548_2610559_+	flagellar motor switch protein FliM	NA	NA	NA	NA
AZW90008.1\|2610551_2611052_+	flagellar motor switch protein FliN	NA	NA	NA	NA
AZW90009.1\|2611062_2611404_+	flagellar biosynthetic protein FliO	NA	NA	NA	NA
AZW90010.1\|2611415_2612207_+	flagellar biosynthetic protein FliP	NA	NA	NA	NA
AZW90011.1\|2612223_2612493_+	flagellar biosynthetic protein FliQ	NA	NA	NA	NA
AZW90012.1\|2612515_2613304_+	flagellar biosynthetic protein FliR	NA	NA	NA	NA
AZW91414.1\|2613350_2614367_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW90013.1\|2614583_2616026_-	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	1.0e-35	41.8
AZW90014.1\|2616204_2617824_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	45.3
AZW90015.1\|2617944_2619765_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-11	52.6
AZW90016.1\|2619843_2621376_-	flagellar hook-associated protein 3	NA	NA	NA	NA
AZW90017.1\|2621409_2623056_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
AZW90018.1\|2623125_2624148_-	flagellar assembly peptidoglycan hydrolase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.9e-12	31.4
AZW90019.1\|2624165_2625299_-	flagellar biosynthesis protein FlgI	NA	NA	NA	NA
AZW90020.1\|2625301_2625991_-	flagellar L-ring protein	NA	NA	NA	NA
AZW90021.1\|2625990_2626776_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
AZW90022.1\|2626819_2627584_-	flagellar basal body rod protein FlgF	NA	NA	NA	NA
AZW90023.1\|2627622_2629044_-	flagellar hook protein FlgE	NA	NA	NA	NA
AZW90024.1\|2629109_2629814_-	flagellar basal body rod modification protein	NA	NA	NA	NA
AZW90025.1\|2629861_2630281_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
AZW90026.1\|2630293_2630701_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
AZW91415.1\|2630884_2631595_+	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
AZW90027.1\|2631721_2632012_+	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
AZW90028.1\|2632029_2632512_+	flagellar protein FlgN	NA	NA	NA	NA
AZW90029.1\|2637017_2638172_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
AZW91416.1\|2638477_2639494_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW90030.1\|2639740_2640529_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW90031.1\|2640595_2641276_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW90032.1\|2641272_2642043_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-30	39.1
AZW90033.1\|2642141_2643092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90034.1\|2643147_2644065_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AZW90035.1\|2644075_2645254_-	mandelate racemase	NA	NA	NA	NA
AZW90036.1\|2645273_2646269_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90037.1\|2647857_2648466_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZW90038.1\|2648453_2649494_+	LacI family transcriptional regulator	NA	NA	NA	NA
AZW90039.1\|2649511_2650474_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90040.1\|2650470_2651664_-	CoA transferase	NA	NA	NA	NA
AZW90041.1\|2651660_2652458_-	citryl-CoA lyase	NA	NA	NA	NA
AZW90042.1\|2652483_2653470_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90043.1\|2653488_2655528_-	acetyl-CoA synthetase	NA	NA	NA	NA
AZW91417.1\|2655729_2656410_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW90044.1\|2656423_2657335_-	CoA ester lyase	NA	NA	NA	NA
AZW90045.1\|2657331_2657910_-	NADPH-dependent oxidoreductase	NA	NA	NA	NA
AZW90046.1\|2658048_2658954_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90047.1\|2658961_2662381_+	nuclease	NA	NA	NA	NA
AZW90048.1\|2662368_2664969_-	BP1344/BB2830 family autotransporter	NA	NA	NA	NA
AZW90049.1\|2665924_2666557_-	PadR family transcriptional regulator	NA	NA	NA	NA
AZW90050.1\|2666950_2667709_+	hypothetical protein	NA	NA	NA	NA
AZW90051.1\|2667705_2668908_+	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW90052.1\|2669095_2670046_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90053.1\|2670953_2672099_+	DUF3182 domain-containing protein	NA	NA	NA	NA
AZW91418.1\|2672118_2672841_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW90054.1\|2672957_2673137_+	hypothetical protein	NA	NA	NA	NA
AZW90055.1\|2673202_2674153_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2857605 : 3009253

118

uncultured_Mediterranean_phage(15.79%)

tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90202.1\|2857605_2858556_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90203.1\|2858654_2859536_-	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
AZW90204.1\|2859613_2860993_-	4Fe-4S binding domain-containing protein	NA	NA	NA	NA
AZW90205.1\|2861031_2861877_-	FTR1 family iron permease	NA	NA	NA	NA
AZW90206.1\|2861892_2862237_-	cupredoxin domain-containing protein	NA	NA	NA	NA
AZW90207.1\|2862239_2862776_-	hypothetical protein	NA	NA	NA	NA
AZW90208.1\|2862948_2863524_-	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
AZW90209.1\|2863626_2864364_-	beta-ketoacyl-ACP reductase	NA	NA	NA	NA
AZW90210.1\|2864431_2866069_-	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
AZW90211.1\|2866176_2866932_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
AZW90212.1\|2866919_2867882_-	RluA family pseudouridine synthase	NA	NA	NA	NA
AZW90213.1\|2867983_2868784_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
AZW90214.1\|2868845_2870921_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	2.4e-75	30.0
AZW90215.1\|2871085_2873461_+	protein tex	NA	NA	NA	NA
AZW90216.1\|2873541_2874897_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AZW90217.1\|2876375_2877098_+	short-chain dehydrogenase	NA	NA	NA	NA
AZW90218.1\|2877152_2878136_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90219.1\|2878265_2879216_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90220.1\|2879212_2880115_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90221.1\|2880202_2880961_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW90222.1\|2880973_2882122_-	cell division protein ZapE	NA	NA	NA	NA
AZW90223.1\|2882162_2883590_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-41	28.1
AZW90224.1\|2883819_2885034_-	dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
AZW90225.1\|2885079_2887950_-	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
AZW90226.1\|2890360_2890849_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW90227.1\|2890974_2893671_+	alpha-ketoglutarate dehydrogenase	NA	NA	NA	NA
AZW90228.1\|2893825_2896108_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW90229.1\|2896272_2896905_+	fimbrial protein	NA	NA	NA	NA
AZW90230.1\|2897003_2897954_+\|transposase	IS481-like element IS481 family transposase	NA	NA	NA	NA
AZW90231.1\|2898000_2898555_-	transcription elongation factor GreB	NA	NA	NA	NA
AZW90232.1\|2898622_2899468_-	PHP domain-containing protein	NA	NA	NA	NA
AZW90233.1\|2899537_2900506_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW90234.1\|2900505_2902302_-	hypothetical protein	NA	NA	NA	NA
AZW90235.1\|2904201_2908128_-	inverse autotransporter beta-barrel domain-containing protein	NA	NA	NA	NA
AZW90236.1\|2908418_2908595_-	hypothetical protein	NA	NA	NA	NA
AZW90237.1\|2908863_2912094_-	autotransporter SphB3	NA	NA	NA	NA
AZW90238.1\|2912375_2913203_-	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW90239.1\|2913236_2913932_-	lipoprotein-releasing system ATP-binding protein LolD	G9BWD6	Planktothrix_phage	7.0e-35	38.6
AZW90240.1\|2913924_2915205_-	lipoprotein-releasing system transmembrane subunit LolC	NA	NA	NA	NA
AZW90241.1\|2915214_2916192_+	hypothetical protein	NA	NA	NA	NA
AZW91434.1\|2916173_2917874_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.3e-50	28.3
AZW90242.1\|2917976_2919080_+	peptide chain release factor 2	NA	NA	NA	NA
AZW90243.1\|2919110_2919866_+	short-chain dehydrogenase	NA	NA	NA	NA
AZW90244.1\|2919872_2921393_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0
AZW90245.1\|2921435_2921738_+	hypothetical protein	NA	NA	NA	NA
AZW90246.1\|2921734_2922367_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW90247.1\|2922445_2924311_-	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
AZW90248.1\|2924307_2925123_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.5e-12	23.7
AZW90249.1\|2925130_2926246_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW90250.1\|2927150_2928029_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW90251.1\|2928028_2928853_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
AZW90252.1\|2929020_2929971_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90253.1\|2930069_2931020_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90254.1\|2931202_2934082_+	diguanylate phosphodiesterase	NA	NA	NA	NA
AZW90255.1\|2934063_2934840_-	DNA-binding response regulator	NA	NA	NA	NA
AZW90256.1\|2934932_2936396_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
AZW90257.1\|2936392_2936764_-	DUF2069 domain-containing protein	NA	NA	NA	NA
AZW90258.1\|2936781_2938095_+	hypothetical protein	NA	NA	NA	NA
AZW90259.1\|2938131_2938590_+	CBS domain-containing protein	NA	NA	NA	NA
AZW90260.1\|2938702_2939653_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90261.1\|2939649_2940663_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AZW90262.1\|2940802_2941789_+	homoserine kinase	NA	NA	NA	NA
AZW90263.1\|2941832_2942633_+	hypothetical protein	NA	NA	NA	NA
AZW90264.1\|2943435_2944386_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90265.1\|2944537_2945140_-	hypothetical protein	NA	NA	NA	NA
AZW90266.1\|2945158_2945791_+	ribosomal RNA large subunit methyltransferase E	NA	NA	NA	NA
AZW90267.1\|2946028_2947915_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
AZW90268.1\|2947933_2948776_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
AZW90269.1\|2948772_2950131_+	phosphoglucosamine mutase	NA	NA	NA	NA
AZW90270.1\|2950351_2951146_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW90271.1\|2951376_2952870_-	exopolyphosphatase	NA	NA	NA	NA
AZW90272.1\|2953105_2955187_+	polyphosphate kinase 1	NA	NA	NA	NA
AZW90273.1\|2955381_2956422_+	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
AZW90274.1\|2956556_2957573_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZW90275.1\|2957594_2958452_+	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AZW91435.1\|2958496_2959273_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-17	28.7
AZW90276.1\|2959640_2960591_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90277.1\|2960617_2961082_-	barstar family protein 2	NA	NA	NA	NA
AZW90278.1\|2962288_2964577_-	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW90279.1\|2964693_2965566_-	hypothetical protein	NA	NA	NA	NA
AZW90280.1\|2965608_2966763_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZW90281.1\|2966797_2967628_-	transglycosylase	NA	NA	NA	NA
AZW90282.1\|2967711_2969256_+	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
AZW90283.1\|2969298_2969658_-	hypothetical protein	NA	NA	NA	NA
AZW90284.1\|2969659_2970073_-\|holin	phage holin family protein	NA	NA	NA	NA
AZW90285.1\|2970113_2970431_-	DUF883 domain-containing protein	NA	NA	NA	NA
AZW90286.1\|2970515_2971232_-	hypothetical protein	NA	NA	NA	NA
AZW91436.1\|2971495_2972917_+	siroheme synthase	NA	NA	NA	NA
AZW90287.1\|2972983_2975731_-	pertactin autotransporter	NA	NA	NA	NA
AZW91437.1\|2976063_2977080_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW91438.1\|2977415_2978057_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZW90288.1\|2978147_2979584_-	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZW90289.1\|2979741_2980815_+\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AZW90290.1\|2980811_2981948_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZW90291.1\|2982092_2982437_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AZW90292.1\|2982503_2984384_+	protein translocase subunit SecD	NA	NA	NA	NA
AZW90293.1\|2984433_2985369_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AZW91439.1\|2985701_2986718_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW90294.1\|2987655_2989083_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZW90295.1\|2989079_2990102_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
AZW90296.1\|2990091_2990565_+	endoribonuclease YbeY	NA	NA	NA	NA
AZW90297.1\|2990690_2991593_+	transporter associated domain protein	NA	NA	NA	NA
AZW90298.1\|2991589_2993233_+	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AZW91440.1\|2993229_2994237_-	aldo/keto reductase	NA	NA	NA	NA
AZW91441.1\|2995067_2996084_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW90299.1\|2996183_2996816_-	protein phosphatase CheZ	NA	NA	NA	NA
AZW90300.1\|2996824_2997214_-	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AZW90301.1\|2997266_2998319_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AZW90302.1\|2999182_3000889_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AZW90303.1\|3000962_3001463_-	chemotaxis protein CheW	NA	NA	NA	NA
AZW90304.1\|3001477_3003535_-	chemotaxis protein CheA	NA	NA	NA	NA
AZW90305.1\|3003561_3003855_-	response regulator	NA	NA	NA	NA
AZW90306.1\|3003956_3004904_-	motility protein MotB	NA	NA	NA	NA
AZW90307.1\|3004916_3005792_-	flagellar motor stator protein MotA	NA	NA	NA	NA
AZW90308.1\|3005912_3006473_-	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
AZW90309.1\|3006507_3006831_-	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AZW90310.1\|3007266_3008004_+	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AZW90311.1\|3008302_3009253_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

3030204 : 3102698

Bacillus_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90331.1\|3030204_3031155_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90332.1\|3031197_3032373_+	flagellin FliC	NA	NA	NA	NA
AZW90333.1\|3032594_3034385_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
AZW90334.1\|3034397_3036059_-	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
AZW90335.1\|3036071_3038777_-	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AZW90336.1\|3039069_3040824_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
AZW90337.1\|3040820_3041447_+	DNA-binding response regulator	NA	NA	NA	NA
AZW90338.1\|3041443_3042295_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
AZW90339.1\|3042370_3044485_+	M3 family peptidase	NA	NA	NA	NA
AZW90340.1\|3044635_3045286_+	SCO family protein	NA	NA	NA	NA
AZW90341.1\|3045431_3045683_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AZW90342.1\|3045752_3047135_-	multidrug transporter	NA	NA	NA	NA
AZW90343.1\|3047131_3050311_-	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AZW91443.1\|3051118_3052036_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90344.1\|3052087_3052819_-	rRNA pseudouridine synthase	NA	NA	NA	NA
AZW90345.1\|3052878_3053451_+	chorismate--pyruvate lyase	NA	NA	NA	NA
AZW91444.1\|3054959_3055976_+\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW90346.1\|3056113_3057163_-	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
AZW90347.1\|3057267_3058218_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90348.1\|3058313_3059039_-	CoA pyrophosphatase	NA	NA	NA	NA
AZW90349.1\|3059249_3059630_-	50S ribosomal protein L19	NA	NA	NA	NA
AZW90350.1\|3059935_3060808_+	multidrug DMT transporter permease	NA	NA	NA	NA
AZW90351.1\|3060815_3061196_-	hypothetical protein	NA	NA	NA	NA
AZW90352.1\|3061349_3062624_-	radical SAM protein	NA	NA	NA	NA
AZW91445.1\|3064111_3065020_-	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
AZW90353.1\|3065817_3066882_-	sulfate/thiosulfate import ATP-binding protein CysA	G3M9Y6	Bacillus_virus	3.8e-24	30.3
AZW90354.1\|3068718_3069753_-	sulfate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW90355.1\|3069942_3070584_-	peroxiredoxin	NA	NA	NA	NA
AZW90356.1\|3070666_3072493_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW90357.1\|3072736_3073666_-	electron transfer flavoprotein subunit alpha	NA	NA	NA	NA
AZW90358.1\|3073665_3074415_-	electron transfer flavoprotein subunit beta/FixA family protein	NA	NA	NA	NA
AZW90359.1\|3074486_3075401_-	deacetylase	A0A2K9KZC4	Tupanvirus	9.8e-45	34.7
AZW90360.1\|3075420_3076566_+	lytic murein transglycosylase B	NA	NA	NA	NA
AZW90361.1\|3076626_3077538_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	8.0e-47	38.8
AZW90362.1\|3077618_3078569_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90363.1\|3078667_3079252_-	DUF655 domain-containing protein	NA	NA	NA	NA
AZW90364.1\|3079286_3080276_-	ADP-L-glycero-D-mannoheptose-6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZW90365.1\|3080272_3081214_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZW90366.1\|3081210_3082431_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZW90367.1\|3082473_3082788_-	DUF1049 domain-containing protein	NA	NA	NA	NA
AZW90368.1\|3082979_3083339_-	integration host factor subunit beta	NA	NA	NA	NA
AZW90369.1\|3083340_3085071_-	30S ribosomal protein S1	NA	NA	NA	NA
AZW90370.1\|3085243_3085915_-	cytidylate kinase	NA	NA	NA	NA
AZW90371.1\|3085929_3087258_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZW90372.1\|3087254_3088154_-	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AZW90373.1\|3088240_3089326_-	prephenate dehydratase	NA	NA	NA	NA
AZW90374.1\|3089318_3090452_-	phosphoserine aminotransferase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
AZW90375.1\|3090451_3093133_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZW90376.1\|3093503_3094085_+	OmpA family protein	NA	NA	NA	NA
AZW90377.1\|3094162_3094936_+	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AZW90378.1\|3094932_3095610_+	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW90379.1\|3095825_3097007_+	MFS transporter	NA	NA	NA	NA
AZW90380.1\|3097483_3097741_+	hypothetical protein	NA	NA	NA	NA
AZW90381.1\|3097779_3097962_+	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZW90382.1\|3097991_3098942_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91446.1\|3099071_3099464_+	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZW90383.1\|3099740_3100652_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
AZW90384.1\|3100776_3101751_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90385.1\|3101747_3102698_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

3116205 : 3169723

Bacillus_phage(33.33%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90396.1\|3116205_3117156_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90397.1\|3117268_3117520_-	hypothetical protein	NA	NA	NA	NA
AZW90398.1\|3117713_3117929_-	hypothetical protein	NA	NA	NA	NA
AZW90399.1\|3118025_3119144_-	mannose-6-phosphate isomerase	NA	NA	NA	NA
AZW90400.1\|3119263_3119476_-	hypothetical protein	NA	NA	NA	NA
AZW90401.1\|3119635_3119857_-	hypothetical protein	NA	NA	NA	NA
AZW90402.1\|3119909_3120860_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90403.1\|3122036_3123407_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AZW90404.1\|3123439_3124231_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW90405.1\|3124243_3125299_-	hypothetical protein	NA	NA	NA	NA
AZW90406.1\|3125324_3126200_-	hypothetical protein	NA	NA	NA	NA
AZW90407.1\|3126305_3126554_-	hypothetical protein	NA	NA	NA	NA
AZW90408.1\|3126588_3128043_-	carboxylase	NA	NA	NA	NA
AZW90409.1\|3128039_3128561_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AZW90410.1\|3128589_3129942_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW90411.1\|3130165_3133054_-	metal-dependent phosphohydrolase	NA	NA	NA	NA
AZW90412.1\|3135198_3136500_+	phospholipase	NA	NA	NA	NA
AZW90413.1\|3136514_3137231_-	flagellar brake protein	NA	NA	NA	NA
AZW90414.1\|3137512_3138193_+	DUF3313 domain-containing protein	NA	NA	NA	NA
AZW90415.1\|3138204_3138372_-	hypothetical protein	NA	NA	NA	NA
AZW90416.1\|3138480_3138633_-	hypothetical protein	NA	NA	NA	NA
AZW90417.1\|3138720_3139380_-	thiopurine S-methyltransferase	NA	NA	NA	NA
AZW90418.1\|3139760_3141611_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.4
AZW90419.1\|3141607_3142558_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90420.1\|3143721_3145437_+	acetolactate synthase, large subunit, biosynthetic type	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	3.1e-60	30.3
AZW90421.1\|3145447_3145939_+	acetolactate synthase small subunit	NA	NA	NA	NA
AZW90422.1\|3146011_3147028_+	ketol-acid reductoisomerase	NA	NA	NA	NA
AZW90423.1\|3147195_3147975_+	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
AZW90424.1\|3147993_3148521_-	lipoprotein	NA	NA	NA	NA
AZW90425.1\|3148519_3148726_+	hypothetical protein	NA	NA	NA	NA
AZW90426.1\|3148814_3149084_+	30S ribosomal protein S15	NA	NA	NA	NA
AZW90427.1\|3149174_3151334_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
AZW90428.1\|3151454_3152174_+	lipoprotein	NA	NA	NA	NA
AZW90429.1\|3152170_3153121_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90430.1\|3153261_3154479_+	threonine ammonia-lyase	NA	NA	NA	NA
AZW90431.1\|3154472_3155084_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZW90432.1\|3155717_3156695_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZW90433.1\|3156838_3157585_+	triose-phosphate isomerase	NA	NA	NA	NA
AZW90434.1\|3157606_3158053_+	preprotein translocase subunit SecG	NA	NA	NA	NA
AZW90435.1\|3158840_3161072_+\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZW90436.1\|3161094_3161895_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW90437.1\|3162176_3163409_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW90438.1\|3163519_3164509_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90439.1\|3164539_3165928_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW90440.1\|3167526_3168510_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91448.1\|3168706_3169723_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

3234180 : 3307342

Klosneuvirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90492.1\|3234180_3235131_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90493.1\|3235127_3236147_-	fructose 1,6-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.5e-49	35.7
AZW90494.1\|3236156_3238865_-	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.8e-15	24.0
AZW90495.1\|3239012_3239669_+	DUF4136 domain-containing protein	NA	NA	NA	NA
AZW90496.1\|3239767_3240718_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90497.1\|3240823_3241759_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
AZW90498.1\|3241958_3243653_+	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW90499.1\|3243687_3244614_+	VOC family protein	NA	NA	NA	NA
AZW91452.1\|3244682_3245780_+	hypothetical protein	NA	NA	NA	NA
AZW90500.1\|3245798_3246662_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-34	38.9
AZW90501.1\|3246673_3247456_+	ABC transporter permease	NA	NA	NA	NA
AZW90502.1\|3247452_3248571_+	DUF2817 domain-containing protein	NA	NA	NA	NA
AZW90503.1\|3248567_3250100_+	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
AZW90504.1\|3250140_3251148_+	zinc-binding dehydrogenase	NA	NA	NA	NA
AZW90505.1\|3251292_3252015_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW90506.1\|3252030_3253053_-	autotransporter domain-containing protein	NA	NA	NA	NA
AZW90507.1\|3253369_3254104_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW90508.1\|3254188_3255934_+	acetolactate synthase catalytic subunit	NA	NA	NA	NA
AZW90509.1\|3255930_3256683_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW90510.1\|3256727_3257684_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90511.1\|3257772_3258339_+	hypothetical protein	NA	NA	NA	NA
AZW90512.1\|3258346_3259207_-	aminotransferase	NA	NA	NA	NA
AZW90513.1\|3259236_3259980_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-32	42.4
AZW90514.1\|3259996_3260680_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW90515.1\|3261517_3262432_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW90516.1\|3262496_3263405_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90517.1\|3263495_3264920_-	protein CyaE	NA	NA	NA	NA
AZW90518.1\|3264921_3266244_-	protein CyaD	NA	NA	NA	NA
AZW90519.1\|3266240_3268379_-	cyclolysin secretion/processing ATP-binding protein CyaB	W8CYL7	Bacillus_phage	2.7e-45	29.2
AZW90520.1\|3268456_3273577_-	bifunctional adenylate cyclase toxin/hemolysin CyaA	NA	NA	NA	NA
AZW91453.1\|3273763_3273943_-	hypothetical protein	NA	NA	NA	NA
AZW90521.1\|3274025_3274613_+	cyclolysin-activating lysine-acyltransferase CyaC	NA	NA	NA	NA
AZW90522.1\|3274628_3276110_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW90523.1\|3276164_3278018_-	hypothetical protein	NA	NA	NA	NA
AZW90524.1\|3278280_3279618_-	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW90525.1\|3279652_3281650_-	hydantoin utilization protein B	NA	NA	NA	NA
AZW90526.1\|3281667_3283716_-	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW90527.1\|3283846_3284713_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90528.1\|3284981_3285947_-	octaprenyl diphosphate synthase	NA	NA	NA	NA
AZW90529.1\|3286061_3287210_-	fumarylacetoacetate hydrolase	NA	NA	NA	NA
AZW90530.1\|3287634_3287946_+	50S ribosomal protein L21	NA	NA	NA	NA
AZW90531.1\|3287979_3288240_+	50S ribosomal protein L27	NA	NA	NA	NA
AZW90532.1\|3288389_3289523_+	GTPase ObgE	NA	NA	NA	NA
AZW90533.1\|3289593_3290730_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.8e-63	44.8
AZW90534.1\|3290895_3291690_-	DNA-binding response regulator	NA	NA	NA	NA
AZW90535.1\|3291752_3292196_+	transcriptional regulator	NA	NA	NA	NA
AZW90536.1\|3292311_3293262_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90537.1\|3293248_3293437_-	hypothetical protein	NA	NA	NA	NA
AZW90538.1\|3293384_3293792_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZW90539.1\|3293864_3296060_+	DNA methylase	NA	NA	NA	NA
AZW90540.1\|3296281_3297232_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90541.1\|3297191_3297716_-	RNA polymerase subunit sigma	NA	NA	NA	NA
AZW90542.1\|3297847_3298819_+	hypothetical protein	NA	NA	NA	NA
AZW91454.1\|3298938_3301383_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW90543.1\|3301398_3301989_-	polyisoprenoid-binding protein	NA	NA	NA	NA
AZW90544.1\|3302232_3303183_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90545.1\|3303340_3304606_-	saccharopine dehydrogenase	NA	NA	NA	NA
AZW90546.1\|3304639_3305737_-	carboxynorspermidine decarboxylase	NA	NA	NA	NA
AZW90547.1\|3306391_3307342_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

3318629 : 3418742

109

uncultured_Caudovirales_phage(13.79%)

terminase,tRNA,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90558.1\|3318629_3319580_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90559.1\|3320311_3320689_+	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
AZW90560.1\|3320673_3321375_-	hypothetical protein	NA	NA	NA	NA
AZW90561.1\|3321518_3322211_-	nucleotidyltransferase family protein	NA	NA	NA	NA
AZW90562.1\|3322210_3323314_-	aminoglycoside phosphotransferase	NA	NA	NA	NA
AZW90563.1\|3323423_3325796_+	LPS-assembly protein LptD	NA	NA	NA	NA
AZW90564.1\|3325792_3327352_+	chaperone SurA	NA	NA	NA	NA
AZW90565.1\|3327376_3328174_+	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AZW90566.1\|3328205_3329351_-	glycerate kinase	W6LM47	Streptococcus_phage	1.7e-41	42.2
AZW90567.1\|3329455_3330898_+	pyruvate kinase	NA	NA	NA	NA
AZW91455.1\|3330900_3331989_-	hypothetical protein	NA	NA	NA	NA
AZW90568.1\|3334267_3335218_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90569.1\|3335204_3335423_-	hypothetical protein	NA	NA	NA	NA
AZW90570.1\|3336347_3336905_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90571.1\|3336880_3337231_-	hypothetical protein	NA	NA	NA	NA
AZW90572.1\|3337399_3338194_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AZW90573.1\|3338190_3339240_-	iron ABC transporter permease	NA	NA	NA	NA
AZW90574.1\|3339239_3339929_-	tol-pal system protein YbgF	NA	NA	NA	NA
AZW90575.1\|3340015_3340513_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
AZW90576.1\|3340544_3341861_-	protein TolB	NA	NA	NA	NA
AZW90577.1\|3341877_3342852_-	cell envelope integrity protein TolA	NA	NA	NA	NA
AZW90578.1\|3342888_3343347_-	protein TolR	NA	NA	NA	NA
AZW90579.1\|3343346_3344027_-	protein TolQ	NA	NA	NA	NA
AZW90580.1\|3344029_3344458_-	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AZW90581.1\|3344510_3346241_-\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AZW90582.1\|3346306_3346879_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZW90583.1\|3346859_3347546_+	DNA-binding response regulator	NA	NA	NA	NA
AZW90584.1\|3347901_3348573_+	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZW90585.1\|3348579_3348780_-	hypothetical protein	NA	NA	NA	NA
AZW90586.1\|3349122_3349404_+	hypothetical protein	NA	NA	NA	NA
AZW90587.1\|3349400_3349934_-	DUF2514 domain-containing protein	NA	NA	NA	NA
AZW90588.1\|3349915_3350467_-	lysozyme	NA	NA	NA	NA
AZW90589.1\|3350445_3350688_-	hypothetical protein	NA	NA	NA	NA
AZW90590.1\|3350692_3351505_-	hypothetical protein	NA	NA	NA	NA
AZW90591.1\|3351504_3351768_-	hypothetical protein	NA	NA	NA	NA
AZW90592.1\|3351986_3352403_-	hypothetical protein	NA	NA	NA	NA
AZW90593.1\|3352407_3356364_-	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZW90594.1\|3356356_3356746_-	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZW90595.1\|3356742_3357276_-	DUF1833 domain-containing protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZW90596.1\|3357343_3357703_-	hypothetical protein	NA	NA	NA	NA
AZW90597.1\|3357712_3360325_-\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AZW90598.1\|3360350_3360641_-	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZW90599.1\|3360658_3360988_-	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZW90600.1\|3360997_3361516_-\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZW90601.1\|3361770_3362271_-	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZW90602.1\|3362278_3362701_-	hypothetical protein	NA	NA	NA	NA
AZW90603.1\|3362697_3363096_-	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZW90604.1\|3363092_3363488_-	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZW90605.1\|3363487_3363688_-	hypothetical protein	NA	NA	NA	NA
AZW90606.1\|3363689_3364172_-	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZW90607.1\|3364234_3364486_-	hypothetical protein	NA	NA	NA	NA
AZW90608.1\|3364495_3365143_-	hypothetical protein	R9TJ64	Synechococcus_phage	2.7e-65	71.1
AZW90609.1\|3365160_3366111_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90610.1\|3366539_3367142_-	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZW90611.1\|3367264_3367507_-	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZW91456.1\|3367512_3368568_-	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
AZW90612.1\|3368596_3370015_-	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZW90613.1\|3370017_3371295_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZW90614.1\|3371281_3371731_-\|terminase	terminase	C7U0W1	Enterobacteria_phage	5.2e-39	61.5
AZW90615.1\|3372406_3373357_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90616.1\|3373374_3373596_+	hypothetical protein	NA	NA	NA	NA
AZW90617.1\|3373610_3374309_+	hypothetical protein	NA	NA	NA	NA
AZW90618.1\|3374301_3374622_+	hypothetical protein	NA	NA	NA	NA
AZW91457.1\|3375101_3375713_+	LexA family transcriptional repressor	NA	NA	NA	NA
AZW90619.1\|3375778_3375991_+	hypothetical protein	NA	NA	NA	NA
AZW90620.1\|3376242_3377193_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90621.1\|3377291_3378365_-	hypothetical protein	NA	NA	NA	NA
AZW90622.1\|3378532_3379327_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW90623.1\|3379366_3379891_-	DUF934 domain-containing protein	NA	NA	NA	NA
AZW90624.1\|3379883_3381626_-	sulfite reductase	NA	NA	NA	NA
AZW90625.1\|3381835_3382594_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AZW90626.1\|3382596_3383304_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AZW90627.1\|3383320_3384202_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW90628.1\|3384212_3384971_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW91458.1\|3384939_3385695_+	hypothetical protein	NA	NA	NA	NA
AZW90629.1\|3385764_3387183_+	amidase	NA	NA	NA	NA
AZW90630.1\|3387204_3387855_-	carbonic anhydrase	NA	NA	NA	NA
AZW90631.1\|3387988_3388324_-	ASCH domain-containing protein	NA	NA	NA	NA
AZW90632.1\|3388412_3389363_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90633.1\|3389439_3391260_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZW90634.1\|3391264_3392338_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZW90635.1\|3392460_3393429_+	threonine/serine dehydratase	NA	NA	NA	NA
AZW90636.1\|3393502_3394414_+	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZW90637.1\|3394432_3395005_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AZW90638.1\|3395085_3395634_-	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZW90639.1\|3395633_3397223_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZW90640.1\|3397292_3397532_-	Fis family transcriptional regulator	NA	NA	NA	NA
AZW90641.1\|3397572_3398604_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZW90642.1\|3398663_3399845_-	monooxygenase	NA	NA	NA	NA
AZW90643.1\|3399941_3400394_+	hypothetical protein	NA	NA	NA	NA
AZW90644.1\|3400403_3401744_-	peptidase M24 family protein	NA	NA	NA	NA
AZW90645.1\|3402060_3403098_+	hypothetical protein	NA	NA	NA	NA
AZW90646.1\|3403479_3403839_+	hypothetical protein	NA	NA	NA	NA
AZW91459.1\|3403922_3404864_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90647.1\|3404938_3405889_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90648.1\|3406182_3407277_+	porin	NA	NA	NA	NA
AZW90649.1\|3407358_3408240_+	cytochrome c oxidase assembly protein	NA	NA	NA	NA
AZW90650.1\|3408261_3409101_-	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZW90651.1\|3409176_3410694_+	peptidase	NA	NA	NA	NA
AZW90652.1\|3410790_3411891_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW90653.1\|3411907_3412330_-	DUF4440 domain-containing protein	NA	NA	NA	NA
AZW90654.1\|3412352_3412565_-	zinc-finger domain-containing protein	NA	NA	NA	NA
AZW90655.1\|3412611_3413532_-	branched-chain amino acid transaminase	NA	NA	NA	NA
AZW91460.1\|3413795_3414464_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW90656.1\|3414466_3414796_+	AzlD domain-containing protein	NA	NA	NA	NA
AZW90657.1\|3415002_3416436_+	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZW90658.1\|3416447_3416831_-	thioredoxin	NA	NA	NA	NA
AZW90659.1\|3416892_3417693_+	hypothetical protein	NA	NA	NA	NA
AZW90660.1\|3417791_3418742_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3579409 : 3626258

Lake_Baikal_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW90801.1\|3579409_3580360_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90802.1\|3580476_3581544_+	choloylglycine hydrolase	NA	NA	NA	NA
AZW90803.1\|3581619_3584748_-	ribonuclease E/G	NA	NA	NA	NA
AZW90804.1\|3585255_3586221_+	23S rRNA pseudouridine(955/2504/2580) synthase	NA	NA	NA	NA
AZW90805.1\|3586223_3586895_+	hydrolase	NA	NA	NA	NA
AZW90806.1\|3587051_3588011_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
AZW90807.1\|3588018_3588681_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
AZW90808.1\|3588677_3589628_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90809.1\|3589749_3591003_+	CoA transferase	NA	NA	NA	NA
AZW90810.1\|3590980_3591943_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW91466.1\|3592095_3592569_+	MaoC family dehydratase	NA	NA	NA	NA
AZW90811.1\|3592568_3593801_+	2-methylfumaryl-CoA isomerase	NA	NA	NA	NA
AZW90812.1\|3594546_3594828_+	hypothetical protein	NA	NA	NA	NA
AZW90813.1\|3594814_3595801_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90814.1\|3595944_3596349_+	RidA family protein	NA	NA	NA	NA
AZW90815.1\|3596490_3599877_+	molybdopterin oxidoreductase	NA	NA	NA	NA
AZW90816.1\|3599907_3601371_+	Short chain fatty acid transporter	NA	NA	NA	NA
AZW90817.1\|3601367_3603008_+	1-pyrroline-5-carboxylate dehydrogenase	NA	NA	NA	NA
AZW90818.1\|3603117_3603753_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW90819.1\|3603782_3604223_-	hypothetical protein	NA	NA	NA	NA
AZW90820.1\|3604733_3604937_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.8e-14	58.2
AZW90821.1\|3605112_3606018_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90822.1\|3606116_3607067_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90823.1\|3607165_3608116_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90824.1\|3609897_3611091_-	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW90825.1\|3611156_3612185_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW90826.1\|3612211_3613384_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW90827.1\|3613509_3614487_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW90828.1\|3614497_3615469_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW90829.1\|3615535_3616321_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW90830.1\|3616313_3617546_-	CoA transferase	NA	NA	NA	NA
AZW90831.1\|3617741_3618497_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZW90832.1\|3618607_3619126_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.1e-12	38.9
AZW91467.1\|3620914_3622315_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW90833.1\|3622414_3622759_+	TIGR01244 family phosphatase	NA	NA	NA	NA
AZW90834.1\|3622847_3623318_+	universal stress protein	NA	NA	NA	NA
AZW90835.1\|3623728_3624127_+	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZW90836.1\|3624258_3625209_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW90837.1\|3625307_3626258_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

4006494 : 4071406

Planktothrix_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW91188.1\|4006494_4006980_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91189.1\|4007198_4008179_+	protein BugT	NA	NA	NA	NA
AZW91190.1\|4008445_4009255_+	Pertussis toxin subunit 1	NA	NA	NA	NA
AZW91191.1\|4009294_4009975_+	Pertussis toxin subunit 2	NA	NA	NA	NA
AZW91192.1\|4009968_4010427_+	pertussis toxin subunit 4	NA	NA	NA	NA
AZW91193.1\|4010438_4010801_+	Pertussis toxin subunit 5	NA	NA	NA	NA
AZW91194.1\|4010883_4011567_+	Pertussis toxin subunit 3	NA	NA	NA	NA
AZW91195.1\|4011622_4011931_+	type IV secretion protein A	NA	NA	NA	NA
AZW91196.1\|4011949_4012264_+	type IV secretion protein B	NA	NA	NA	NA
AZW91197.1\|4012260_4014735_+	type IV secretion system protein PtlC	NA	NA	NA	NA
AZW91198.1\|4014742_4016134_+	type IV secretion system protein PtlD	NA	NA	NA	NA
AZW91199.1\|4016130_4016316_+	type IV secretion protein I	NA	NA	NA	NA
AZW91200.1\|4016294_4016996_+	type IV secretion protein E	NA	NA	NA	NA
AZW91201.1\|4016992_4017814_+	type IV secretion system protein PtlF	NA	NA	NA	NA
AZW91483.1\|4017794_4018919_+	type IV secretion system protein PtlG	NA	NA	NA	NA
AZW91202.1\|4018911_4019931_+	type IV secretion protein H	NA	NA	NA	NA
AZW91203.1\|4020136_4021171_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW91484.1\|4021271_4022063_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW91204.1\|4022145_4022520_+	DUF1232 domain-containing protein	NA	NA	NA	NA
AZW91205.1\|4022497_4023907_+	DUF2868 domain-containing protein	NA	NA	NA	NA
AZW91206.1\|4023899_4025282_+	DUF3482 domain-containing protein	A0A0R6PHS5	Moraxella_phage	9.9e-57	38.9
AZW91207.1\|4025616_4027221_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW91208.1\|4027256_4028270_+	ABC transporter permease	NA	NA	NA	NA
AZW91209.1\|4028280_4029207_+	ABC transporter permease	NA	NA	NA	NA
AZW91210.1\|4029597_4030548_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91211.1\|4030717_4031944_+	bifunctional glutamate N-acetyltransferase/amino-acid N-acetyltransferase	NA	NA	NA	NA
AZW91212.1\|4032143_4033010_+	DUF815 domain-containing protein	NA	NA	NA	NA
AZW91213.1\|4033002_4033965_+	NUDIX domain-containing protein	A0A221LFJ1	Barns_Ness_breadcrumb_sponge_sobemo-like_virus	1.9e-06	53.4
AZW91214.1\|4034065_4035016_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91215.1\|4035114_4036065_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91216.1\|4036163_4037114_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91217.1\|4037110_4038604_-	RND transporter	NA	NA	NA	NA
AZW91218.1\|4038600_4041708_-	multidrug transporter subunit MdtC	NA	NA	NA	NA
AZW91219.1\|4041704_4044773_-	multidrug transporter subunit MdtB	NA	NA	NA	NA
AZW91220.1\|4044769_4046020_-	multidrug transporter subunit MdtA	NA	NA	NA	NA
AZW91221.1\|4046200_4046962_-	cell division protein ZapD	NA	NA	NA	NA
AZW91222.1\|4046994_4047645_-	dephospho-CoA kinase	NA	NA	NA	NA
AZW91223.1\|4047647_4048487_-	prepilin peptidase	NA	NA	NA	NA
AZW91224.1\|4048727_4049471_+	hypothetical protein	NA	NA	NA	NA
AZW91225.1\|4049553_4049901_-	LuxR family transcriptional regulator	NA	NA	NA	NA
AZW91226.1\|4049998_4050841_-	pantoate--beta-alanine ligase	NA	NA	NA	NA
AZW91227.1\|4050885_4051773_-	segregation/condensation protein A	NA	NA	NA	NA
AZW91228.1\|4051799_4051988_-	DUF3460 domain-containing protein	NA	NA	NA	NA
AZW91229.1\|4052085_4053543_+	MFS transporter	NA	NA	NA	NA
AZW91230.1\|4053529_4055056_+	glycerol kinase	NA	NA	NA	NA
AZW91231.1\|4055074_4055542_-	hypothetical protein	NA	NA	NA	NA
AZW91232.1\|4055541_4056564_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91233.1\|4056684_4057425_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-35	39.7
AZW91234.1\|4057479_4058580_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW91235.1\|4058581_4059772_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW91236.1\|4059891_4060908_-	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.0e-71	42.1
AZW91237.1\|4061226_4061898_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	9.5e-29	38.2
AZW91238.1\|4061894_4062803_+	ABC transporter permease	NA	NA	NA	NA
AZW91239.1\|4063014_4063662_+	chemoreceptor glutamine deamidase CheD	NA	NA	NA	NA
AZW91240.1\|4067513_4068590_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
AZW91241.1\|4068600_4069410_-	transcriptional regulator	NA	NA	NA	NA
AZW91242.1\|4069499_4070273_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW91243.1\|4070455_4071406_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025349

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection