CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025350	Bordetella pertussis strain I958 chromosome, complete genome	5 crisprs	csa3,cas3,DinG,DEDDh	0	0	28	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025350_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025350_1

250587-250671

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025350_1

>merge|CP025350|1|250587-250671|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP025350|1|1|250587-250671|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP025350.1\|AZW91691.1\|253595_254234_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP025350.1\|AZW91695.1\|258904_259888_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295
CP025350.1\|AZW91687.1\|248572_249274_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347
CP025350.1\|AZW91683.1\|245058_246015_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025350.1\|AZW91684.1\|246033_246525_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP025350.1\|AZW91693.1\|256380_257772_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
CP025350.1\|AZW91682.1\|241545_243648_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP025350.1\|AZW91685.1\|246521_247877_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
CP025350.1\|AZW91696.1\|259952_260852_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025350.1\|AZW91680.1\|239544_240288_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP025350.1\|AZW91689.1\|250681_251623_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP025350.1\|AZW91679.1\|238112_238523_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
CP025350.1\|AZW91681.1\|240331_241375_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP025350.1\|AZW91686.1\|247877_248576_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP025350.1\|AZW91692.1\|255692_256229_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP025350.1\|AZW91690.1\|251619_253509_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP025350.1\|AZW91688.1\|249526_250576_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP025350.1\|AZW91697.1\|260958_262713_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP025350.1\|AZW94880.1\|254376_255621_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP025350.1\|AZW91694.1\|257788_258769_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751

Protein	Function_ID	Function_description	E-value
CP025350.1\|AZW91691.1\|253595_254234_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
CP025350.1\|AZW91695.1\|258904_259888_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP025350.1\|AZW91687.1\|248572_249274_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100
CP025350.1\|AZW91683.1\|245058_246015_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP025350.1\|AZW91684.1\|246033_246525_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP025350.1\|AZW91693.1\|256380_257772_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP025350.1\|AZW91682.1\|241545_243648_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
CP025350.1\|AZW91685.1\|246521_247877_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP025350.1\|AZW91696.1\|259952_260852_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
CP025350.1\|AZW91680.1\|239544_240288_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP025350.1\|AZW91689.1\|250681_251623_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP025350.1\|AZW91679.1\|238112_238523_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
CP025350.1\|AZW91681.1\|240331_241375_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP025350.1\|AZW91686.1\|247877_248576_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP025350.1\|AZW91692.1\|255692_256229_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP025350.1\|AZW91690.1\|251619_253509_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP025350.1\|AZW91688.1\|249526_250576_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP025350.1\|AZW91697.1\|260958_262713_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP025350.1\|AZW94880.1\|254376_255621_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	7.29619e-86
CP025350.1\|AZW91694.1\|257788_258769_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41

>CP025350.1|AZW91688.1|249526_250576_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP025350.1|AZW91687.1|248572_249274_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP025350.1|AZW91686.1|247877_248576_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP025350.1|AZW91685.1|246521_247877_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP025350.1|AZW91684.1|246033_246525_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP025350.1|AZW91683.1|245058_246015_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP025350.1|AZW91682.1|241545_243648_+|hypothetical-protein
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP025350.1|AZW91681.1|240331_241375_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP025350.1|AZW91680.1|239544_240288_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP025350.1|AZW91679.1|238112_238523_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>CP025350.1|AZW91689.1|250681_251623_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP025350.1|AZW91690.1|251619_253509_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP025350.1|AZW91691.1|253595_254234_+|hypothetical-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP025350.1|AZW94880.1|254376_255621_-|N-acetylmuramoyl-L-alanine-amidase
MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP025350.1|AZW91692.1|255692_256229_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP025350.1|AZW91693.1|256380_257772_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP025350.1|AZW91694.1|257788_258769_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP025350.1|AZW91695.1|258904_259888_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP025350.1|AZW91696.1|259952_260852_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP025350.1|AZW91697.1|260958_262713_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025350_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025350_2

432030-432123

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP025350_2

>merge|CP025350|2|432030-432123|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP025350|2|2|432030-432123|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025350.1\|AZW91861.1\|441040_442018_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP025350.1\|AZW91851.1\|430318_431269_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025350.1\|AZW91854.1\|432768_433113_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
CP025350.1\|AZW91860.1\|440058_441030_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP025350.1\|AZW91862.1\|442143_443316_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP025350.1\|AZW91855.1\|433212_434613_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP025350.1\|AZW91850.1\|427139_427874_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP025350.1\|AZW91847.1\|422317_423523_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP025350.1\|AZW91848.1\|423519_425031_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP025350.1\|AZW91858.1\|437981_439214_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
CP025350.1\|AZW91845.1\|420557_421052_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP025350.1\|AZW91857.1\|437030_437786_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
CP025350.1\|AZW91844.1\|419369_420428_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP025350.1\|AZW91849.1\|426550_426730_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP025350.1\|AZW94889.1\|425046_426360_-\|short-chain-fatty-acids-transporter	unknown	unknown	gnl\|CDD\|224942
CP025350.1\|AZW91856.1\|436401_436920_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP025350.1\|AZW91859.1\|439206_439992_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP025350.1\|AZW91852.1\|431400_431799_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP025350.1\|AZW91846.1\|421144_422122_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025350.1\|AZW91853.1\|432209_432680_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180

Protein	Function_ID	Function_description	E-value
CP025350.1\|AZW91861.1\|441040_442018_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP025350.1\|AZW91851.1\|430318_431269_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
CP025350.1\|AZW91854.1\|432768_433113_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP025350.1\|AZW91860.1\|440058_441030_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP025350.1\|AZW91862.1\|442143_443316_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP025350.1\|AZW91855.1\|433212_434613_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP025350.1\|AZW91850.1\|427139_427874_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP025350.1\|AZW91847.1\|422317_423523_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP025350.1\|AZW91848.1\|423519_425031_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP025350.1\|AZW91858.1\|437981_439214_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118
CP025350.1\|AZW91845.1\|420557_421052_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP025350.1\|AZW91857.1\|437030_437786_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP025350.1\|AZW91844.1\|419369_420428_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
CP025350.1\|AZW91849.1\|426550_426730_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
CP025350.1\|AZW94889.1\|425046_426360_-\|short-chain-fatty-acids-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP025350.1\|AZW91856.1\|436401_436920_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP025350.1\|AZW91859.1\|439206_439992_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP025350.1\|AZW91852.1\|431400_431799_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP025350.1\|AZW91846.1\|421144_422122_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
CP025350.1\|AZW91853.1\|432209_432680_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30

>CP025350.1|AZW91852.1|431400_431799_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP025350.1|AZW91851.1|430318_431269_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP025350.1|AZW91850.1|427139_427874_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP025350.1|AZW91849.1|426550_426730_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP025350.1|AZW94889.1|425046_426360_-|short-chain-fatty-acids-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP025350.1|AZW91848.1|423519_425031_+|TRAP-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP025350.1|AZW91847.1|422317_423523_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP025350.1|AZW91846.1|421144_422122_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP025350.1|AZW91845.1|420557_421052_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP025350.1|AZW91844.1|419369_420428_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP025350.1|AZW91853.1|432209_432680_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP025350.1|AZW91854.1|432768_433113_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP025350.1|AZW91855.1|433212_434613_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP025350.1|AZW91856.1|436401_436920_-|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP025350.1|AZW91857.1|437030_437786_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP025350.1|AZW91858.1|437981_439214_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP025350.1|AZW91859.1|439206_439992_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP025350.1|AZW91860.1|440058_441030_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP025350.1|AZW91861.1|441040_442018_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP025350.1|AZW91862.1|442143_443316_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025350_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025350_3

995312-995406

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025350_3

>merge|CP025350|3|995312-995406|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP025350|3|3|995312-995406|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP025350.1\|AZW94915.1\|1002458_1003376_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP025350.1\|AZW92340.1\|997331_998381_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP025350.1\|AZW92333.1\|987612_988677_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	unknown	unknown	gnl\|CDD\|213263
CP025350.1\|AZW92342.1\|1001675_1002407_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
CP025350.1\|AZW94914.1\|998518_999535_-\|IS110-family-transposase-IS1663	unknown	unknown	gnl\|CDD\|376773
CP025350.1\|AZW92339.1\|996276_997227_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025350.1\|AZW92337.1\|994864_995245_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP025350.1\|AZW92330.1\|982001_983828_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
CP025350.1\|AZW92345.1\|1008811_1009063_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
CP025350.1\|AZW92343.1\|1004183_1007363_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
CP025350.1\|AZW92332.1\|984741_985776_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
CP025350.1\|AZW92329.1\|980828_981758_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936
CP025350.1\|AZW94913.1\|989474_990383_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
CP025350.1\|AZW92331.1\|983910_984552_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
CP025350.1\|AZW92334.1\|991870_993145_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP025350.1\|AZW92344.1\|1007359_1008742_+\|multidrug-transporter	unknown	unknown	gnl\|CDD\|273830
CP025350.1\|AZW92336.1\|993686_994559_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP025350.1\|AZW92338.1\|995455_996181_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP025350.1\|AZW92335.1\|993298_993679_+\|hypothetical-protein	unknown	unknown	unknown
CP025350.1\|AZW92341.1\|1001043_1001616_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703

Protein	Function_ID	Function_description	E-value
CP025350.1\|AZW94915.1\|1002458_1003376_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
CP025350.1\|AZW92340.1\|997331_998381_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP025350.1\|AZW92333.1\|987612_988677_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP025350.1\|AZW92342.1\|1001675_1002407_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP025350.1\|AZW94914.1\|998518_999535_-\|IS110-family-transposase-IS1663	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23
CP025350.1\|AZW92339.1\|996276_997227_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025350.1\|AZW92337.1\|994864_995245_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP025350.1\|AZW92330.1\|982001_983828_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
CP025350.1\|AZW92345.1\|1008811_1009063_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP025350.1\|AZW92343.1\|1004183_1007363_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP025350.1\|AZW92332.1\|984741_985776_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP025350.1\|AZW92329.1\|980828_981758_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120
CP025350.1\|AZW94913.1\|989474_990383_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP025350.1\|AZW92331.1\|983910_984552_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132
CP025350.1\|AZW92334.1\|991870_993145_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP025350.1\|AZW92344.1\|1007359_1008742_+\|multidrug-transporter	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
CP025350.1\|AZW92336.1\|993686_994559_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP025350.1\|AZW92338.1\|995455_996181_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
CP025350.1\|AZW92341.1\|1001043_1001616_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17

>CP025350.1|AZW92337.1|994864_995245_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP025350.1|AZW92336.1|993686_994559_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP025350.1|AZW92335.1|993298_993679_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP025350.1|AZW92334.1|991870_993145_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP025350.1|AZW94913.1|989474_990383_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP025350.1|AZW92333.1|987612_988677_+|sulfate/thiosulfate-import-ATP-binding-protein-CysA
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP025350.1|AZW92332.1|984741_985776_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP025350.1|AZW92331.1|983910_984552_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>CP025350.1|AZW92330.1|982001_983828_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>CP025350.1|AZW92329.1|980828_981758_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>CP025350.1|AZW92338.1|995455_996181_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP025350.1|AZW92339.1|996276_997227_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025350.1|AZW92340.1|997331_998381_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP025350.1|AZW94914.1|998518_999535_-|IS110-family-transposase-IS1663
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>CP025350.1|AZW92341.1|1001043_1001616_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP025350.1|AZW92342.1|1001675_1002407_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP025350.1|AZW94915.1|1002458_1003376_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP025350.1|AZW92343.1|1004183_1007363_+|multidrug-efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP025350.1|AZW92344.1|1007359_1008742_+|multidrug-transporter
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>CP025350.1|AZW92345.1|1008811_1009063_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025350_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025350_4

1819815-1819942

Orphan

Consensus_repeat	Method
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of CP025350_4

>merge|CP025350|4|1819815-1819942|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCGTGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGCAAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

>CP025350|4|4|1819815-1819942|CRISPRCasFinder
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCATAGCGGGCGCAGCG	TGGGGGCACTACTTTGCCGCTGGGCCGCCCCAAGGC
AAAAAGCCCCCTCGGGGGGCAGCAAGCCCGCGTAGCGGGCGCAGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP025350.1\|AZW92975.1\|1807710_1808160_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239527
CP025350.1\|AZW92987.1\|1822024_1824061_+\|UvrABC-system-protein-B	unknown	unknown	gnl\|CDD\|235395
CP025350.1\|AZW92985.1\|1819965_1820694_-\|transcriptional-repressor-LexA	unknown	unknown	gnl\|CDD\|234688
CP025350.1\|AZW92991.1\|1826799_1827210_+\|Fe-S-cluster-assembly-scaffold-IscU	unknown	unknown	gnl\|CDD\|183087
CP025350.1\|AZW92979.1\|1810455_1811715_-\|poly-beta-1,6-N-acetyl-D-glucosamine-synthase	unknown	unknown	gnl\|CDD\|236882
CP025350.1\|AZW92982.1\|1816023_1816260_+\|hypothetical-protein	unknown	unknown	unknown
CP025350.1\|AZW92986.1\|1820744_1821947_-\|aspartate/tyrosine/aromatic-aminotransferase	unknown	unknown	gnl\|CDD\|181731
CP025350.1\|AZW92989.1\|1825020_1825533_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	unknown	unknown	gnl\|CDD\|273927
CP025350.1\|AZW92983.1\|1816604_1817090_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
CP025350.1\|AZW92977.1\|1808719_1809832_+\|alkene-reductase	unknown	unknown	gnl\|CDD\|239243
CP025350.1\|AZW92992.1\|1827211_1827535_+\|iron-sulfur-cluster-assembly-protein-IscA	unknown	unknown	gnl\|CDD\|213674
CP025350.1\|AZW92994.1\|1828179_1830042_+\|chaperone-protein-HscA	unknown	unknown	gnl\|CDD\|235360
CP025350.1\|AZW92980.1\|1811718_1813824_-\|poly-beta-1,6-N-acetyl-D-glucosamine-N-deacetylase-PgaB	unknown	unknown	gnl\|CDD\|274867
CP025350.1\|AZW92993.1\|1827537_1828050_+\|co-chaperone-protein-HscB	unknown	unknown	gnl\|CDD\|235133
CP025350.1\|AZW92984.1\|1817457_1818408_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025350.1\|AZW92978.1\|1809836_1810475_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372868
CP025350.1\|AZW92981.1\|1813829_1815815_-\|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA	unknown	unknown	gnl\|CDD\|274868
CP025350.1\|AZW92990.1\|1825550_1826762_+\|IscS-subfamily-cysteine-desulfurase	unknown	unknown	gnl\|CDD\|184450
CP025350.1\|AZW92988.1\|1824313_1824805_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	unknown	unknown	gnl\|CDD\|319971
CP025350.1\|AZW92976.1\|1808367_1808667_+\|transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|223713

Protein	Function_ID	Function_description	E-value
CP025350.1\|AZW92975.1\|1807710_1808160_-\|hypothetical-protein	gnl\|CDD\|239527	cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).	0.000948481
CP025350.1\|AZW92987.1\|1822024_1824061_+\|UvrABC-system-protein-B	gnl\|CDD\|235395	PRK05298, PRK05298, excinuclease ABC subunit UvrB.	0
CP025350.1\|AZW92985.1\|1819965_1820694_-\|transcriptional-repressor-LexA	gnl\|CDD\|234688	PRK00215, PRK00215, transcriptional repressor LexA.	1.30999e-106
CP025350.1\|AZW92991.1\|1826799_1827210_+\|Fe-S-cluster-assembly-scaffold-IscU	gnl\|CDD\|183087	PRK11325, PRK11325, scaffold protein; Provisional.	5.84746e-99
CP025350.1\|AZW92986.1\|1820744_1821947_-\|aspartate/tyrosine/aromatic-aminotransferase	gnl\|CDD\|181731	PRK09257, PRK09257, aromatic amino acid transaminase.	0
CP025350.1\|AZW92979.1\|1810455_1811715_-\|poly-beta-1,6-N-acetyl-D-glucosamine-synthase	gnl\|CDD\|236882	PRK11204, PRK11204, N-glycosyltransferase; Provisional.	0
CP025350.1\|AZW92989.1\|1825020_1825533_+\|Fe-S-cluster-assembly-transcriptional-regulator-IscR	gnl\|CDD\|273927	TIGR02010, Putative_HTH-type_transcriptional_regulator, iron-sulfur cluster assembly transcription factor IscR. This model describes IscR, an iron-sulfur binding transcription factor of the ISC iron-sulfur cluster assembly system. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Regulatory functions, DNA interactions].	1.00126e-77
CP025350.1\|AZW92983.1\|1816604_1817090_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	7.77331e-19
CP025350.1\|AZW92977.1\|1808719_1809832_+\|alkene-reductase	gnl\|CDD\|239243	cd02933, OYE_like_FMN, Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction. Members of OYE family include 12-oxophytodienoate reductase, pentaerythritol tetranitrate reductase, morphinone reductase, and related enzymes.	0
CP025350.1\|AZW92992.1\|1827211_1827535_+\|iron-sulfur-cluster-assembly-protein-IscA	gnl\|CDD\|213674	TIGR02011, Protein_yfhF., iron-sulfur cluster assembly protein IscA. This model represents the IscA component of the ISC system for iron-sulfur cluster assembly. The ISC system consists of IscRASU, HscAB and an Isc-specific ferredoxin. IscA previously was believed to act as a scaffold and now is seen as an iron donor protein. This clade is limited to the proteobacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	4.04388e-54
CP025350.1\|AZW92994.1\|1828179_1830042_+\|chaperone-protein-HscA	gnl\|CDD\|235360	PRK05183, hscA, chaperone protein HscA; Provisional.	0
CP025350.1\|AZW92980.1\|1811718_1813824_-\|poly-beta-1,6-N-acetyl-D-glucosamine-N-deacetylase-PgaB	gnl\|CDD\|274867	TIGR03938, hypothetical_protein_Pcar_2791, poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	0
CP025350.1\|AZW92993.1\|1827537_1828050_+\|co-chaperone-protein-HscB	gnl\|CDD\|235133	PRK03578, hscB, Fe-S protein assembly co-chaperone HscB.	2.55481e-79
CP025350.1\|AZW92984.1\|1817457_1818408_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025350.1\|AZW92978.1\|1809836_1810475_-\|hypothetical-protein	gnl\|CDD\|372868	pfam13994, PgaD, PgaD-like protein. This family includes the PgaD protein from E. coli. The homopolymer poly-beta-1,6-N-acetyl-D-glucosamine (beta-1,6-GlcNAc; PGA) serves as an adhesin for the maintenance of biofilm structural stability in eubacteria. The pgaABCD operon is required for its synthesis and export. It has been shown that PgaD is essential for this process.	0.00341018
CP025350.1\|AZW92981.1\|1813829_1815815_-\|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA	gnl\|CDD\|274868	TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA. Members of this protein family are the poly-beta-1,6 N-acetyl-D-glucosamine (PGA) export porin PgaA of Gram-negative bacteria. There is no counterpart in the poly-beta-1,6 N-acetyl-D-glucosamine biosynthesis systems of Gram-positive bacteria such as Staphylococcus epidermidis. The PGA polysaccharide adhesin is a critical determinant of biofilm formation. The conserved C-terminal domain of this outer membrane protein is preceded by a variable number of TPR repeats.	1.10027e-119
CP025350.1\|AZW92990.1\|1825550_1826762_+\|IscS-subfamily-cysteine-desulfurase	gnl\|CDD\|184450	PRK14012, PRK14012, IscS subfamily cysteine desulfurase.	0
CP025350.1\|AZW92988.1\|1824313_1824805_+\|low-molecular-weight-phosphotyrosine-protein-phosphatase	gnl\|CDD\|319971	cd16343, LMWPTP, Low molecular weight protein tyrosine phosphatase. Low molecular weight protein tyrosine phosphatases (LMW-PTP) are a family of small soluble single-domain enzymes that are characterized by a highly conserved active site motif (V/I)CXGNXCRS and share no sequence similarity with other types of protein tyrosine phosphatases (PTPs). LMW-PTPs play important roles in many biological processes and are widely distributed in prokaryotes and eukaryotes.	1.04407e-74
CP025350.1\|AZW92976.1\|1808367_1808667_+\|transcriptional-regulator	gnl\|CDD\|223713	COG0640, ArsR, Predicted transcriptional regulators [Transcription].	1.67046e-14

>CP025350.1|AZW92984.1|1817457_1818408_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025350.1|AZW92983.1|1816604_1817090_+|MarR-family-transcriptional-regulator
MPASQDKPDVPPGPYHFSEQVGHLLRRAYQRHVAIFQQTIPDSKLTAAQFVVLCALRDQGACSLVDVVKATAIDQATVRGVIERLKARKLLAVSHDPADRRKVLVTLTPDGRALVEEMVPFAEQITQSTFGGLNPAERVAIVYLLRKMSDADDLVGRQSES
>CP025350.1|AZW92982.1|1816023_1816260_+|hypothetical-protein
MRRAAKWWGPAATWTLAALLVLLVGHGVVPEAARVSDAPLLHAMAGHAYLLNWAAGLMALIGWGDSLVLYRRTRRRAV
>CP025350.1|AZW92981.1|1813829_1815815_-|poly-beta-1,6-N-acetyl-D-glucosamine-export-porin-PgaA
MNNDQTRRTRPASVRGLRRTRLLVAGLAFVGAAAAAAPSVRDQVQEASRSGAANLALDLATEHRALFTPLEYAQLQHAAIAQRLRWSRAETWNLTGPERFATLDAALADGWQLLDSLPLAPEYASLRTAVISDMIYGLGLRGRYADAIKLYEGLRATNTPVHPYVLVSAGNAYAYEERYDEAIVCYEEALAKAGPGDIDRVPTQESLFFAYMDRGRYEDAEQLLQRIEKTSPQYVENAPVAERPNEDYATAQRLRAQYLMYSGETEAGTLAIDALQHDAPFSSGLRNAAASARLGDARPREAKAAFTTALAERPDDIQAMTGLARASMALREYPEAEAIVTTLSERFPESSSVRNLQRDYEVYQSPLLTMDFGGDIGHGGDNSNNDNSTIANREWSLNTMLYTSPISHNYRLFFHQFTGYADLGDGHKSRVRNGAGLEYRRGSIEASTELHQSTGPSGRFGASANVAWLPSDGWRLAANFDSDSNDLPWKAYRAGIHGWSSGVSARYQPTERTYYDVAYQLQHYSDSNTRQTIGATWFQNLWTVPRHSVSTWTSVAYSNNSKTDTECFSPDHDLTAQVTAMYEWRPWRDGQYAFRQRVYATGGVYNQAEHGNSALWQLRLEQVWDLPRQTSITYGVGYGRHSYDGDPENRTLFYLTLNIPF
>CP025350.1|AZW92980.1|1811718_1813824_-|poly-beta-1,6-N-acetyl-D-glucosamine-N-deacetylase-PgaB
MTAMHRTLLKWFACCALGLLMLPARAYKVDMLPPPDPDDGLTFRVLCMHDVRDNLRASFADMPDQFAIETRTLTDLFEWIRVKGFNLISMQQIIDSRAGVRPLPPRPILLTFDDGYASTYTKVFPLLKKFNYPAVVAVVTSWTDAPAGTKIRLSPKIEVPHDFFMTWAQLREMAQSGLVELASHSHNLHRGVLANPQGNEQPAASSRQYLPASGRYENDAEYRARVRQDLKTSADLIREHTGVTIRSIVWPYGAHNRDTDQVAAEVGLNIGLTLQPGPNTPDVSLTQIRRSLVDYEVNVATVARAMREPVSYHGQVRPIERIVQVDLDYIYDPDPEQQNRNLGQLIDRMKDLAPSAVYLQAFAYPKGDGDITEVYFPNRHLPMRADLFNRVAWQLKTRAGVMVYAWLPVLTFSVPPGNPAYGKVVQSTTRKPGERGLGSPTRLSPFHPDAHRVISEIYEDLAKAAHFDGLLFHDDAVLDDTEDSSPEALATYQGWGLPPDIAAIRADPKLAQQWSKGKIRYLIDFTMHLRHIVSGYQNDRDMVVARNLYAQPVLDPVSEAWYGQSLPEFLKSYDFVALMAMPNMEGAARPEQWMRQLVAAVARQKGLDRTIFELQARDWRVGKPIDTEILRKQMVQLRSLGAINYGYYPDDFIANHPDAEVLRDVMSLKSTLEKRRLTKAQELSRQTTLYGSASQAEPTQR
>CP025350.1|AZW92979.1|1810455_1811715_-|poly-beta-1,6-N-acetyl-D-glucosamine-synthase
MNDSVKSVLSSFVFYYPFFMSYFWIVGGLLHFFLFEQGRKHRATLLPRVPRVAIVVPCYNEGENVAEVIAHLDRMHYPNYRIIAVNDGSRDNTGALLNELAEQYPRLLVVHQSRNEGKAIGLNTAAQLSDAEFLLCIDGDSLPHPDSITYMLTHFLHAGHVGAVTGNPRIRNRSTVLGRMQVGEFSSIVGLIKRTQQLYGKLMTVSGVMTMFRKQALHQVGYWSPDMQTEDIDISWKLQLAGWTLRYEPRALTWILMPETFRGLFKQRYRWARGGIETALKYAPRMLNPRQILMWPIFLEFSLSVLWAYAMLFLICMAVLGQFVALPPAWQFEIFPRWHGTLLFLTCLAQLFAGCIVDRAYDYRIFRYFADAVWYPIAFWIIGMITTVFALPRVLFRRAQSRARWVSPDRGIKHESVDH
>CP025350.1|AZW92978.1|1809836_1810475_-|hypothetical-protein
MKALIIDISASPLREYVHQHGVADGLLYGCWYRIVRPLLVILTWVAFSLYIHHSLVTVGGTAAQIAELLVYITVVATMAAALTAWMIVCRFHGWIRARDNEEVGVGLDPEYALPPRWPLPEGANRLLVDHDEAGAIVQVSAWYVPAAIEPVVAAAMASAVMPEAAPLSEPAPVAAALPDEADELAAWSGPPMQRQPDGRIEPTLHDGRALTL
>CP025350.1|AZW92977.1|1808719_1809832_+|alkene-reductase
MSTLFQPLNAGKLRLANRIVMAPLTRNRSPNAVPPPLTATYYAQRASAGLIITEATAISHQGQGYADVPGLYAPEQLAGWRRVTDAVHAAGGTIVVQLWHVGRISHTTLQPGQGAPVAPSAIRAQARTYLVDAQGKGQFADTSEPRALALDELPGIVEDYRRAARAAIDHGFDGVELHAANGYLLDQFLRSGSNHRDDAYGGSIENRARLLLRALDAVCAEVGADRVGIRLSPVTPANDAHDDQPQPLFEYVLRELARRGLAYVHVIEGATGGDRAYQQGPAPFDYAALKAAYRAAGGAGAWMVNNGYDISLAEQKLSSGQADLVAFGKPFIANPDLVARLRQGAALNEGDRDTFYGGGERGYTDYPALA
>CP025350.1|AZW92976.1|1808367_1808667_+|transcriptional-regulator
MAINTEDILKALAHPARRNILAWLKEPQRHFPQQEHPLELGVCAGQFERCGLSQSTVSTHLAILQRAGLIHSRRVGQWVFYQRNEACIAEFLQTMQAEL
>CP025350.1|AZW92975.1|1807710_1808160_-|hypothetical-protein
MTRPSDIKPREGDTPGTPYAAFVEGAALGPVSFDITPAIVQEYFEASQADPALYRVDVRQAAAPNVILPYMTVPVYQTYPPIQGIVMAELEMSWHRPIWADETTRVTATGTILRKFEKRGRRYVQWEGRFRGADGQPIATLLNTFHVPE
>CP025350.1|AZW92985.1|1819965_1820694_-|transcriptional-repressor-LexA
MRLAFFPWVLQNGAVYPYSPQKRVIAMATKLTERQQEILDLIRQTVARTGFPPTRAEIAQALGFRSPNAAEDHLKALARKGAIELTAGASRGIRLKVPDSATPSAQLTHPLLAQLVLPLVGRVAAGSPILASEHVEREVGVDPGLFAQTPDYLLKVRGMSMRDAGILEGDLLAVKRAAEARNGQIVVARLGDEVTVKRLQRQNGRIELLPENPDFAPIVVANTDEFALEGIAVGLIRTQPLH
>CP025350.1|AZW92986.1|1820744_1821947_-|aspartate/tyrosine/aromatic-aminotransferase
MSTLFASVELAPRDPILGLNEQYNADTRPGKVNLGVGVYYDDEGRIPLLQAVRKAEVARIEAAAARGYLPIEGIAGYNKGAQALLLGADSPLAAEGRVLTAQALGGTGALKIGADFLRQLLPQSKVLISDPSWENHRALFERAGFPVETYAYYDAATHGLNFEAMLAALQAAPEQTIVVLHACCHNPTGVDPTPQQWEQIAAVVKARNLVPFLDIAYQGFGEGLEQDAAVVRMFAELDLTMFISSSFSKSFSLYGERVGALTVVAGSKDEAARVLSQLKRVIRTNYSNPPTHGGTVVSTVLNTPELFALWENELAGMRDRIRLMRKELVEKIKTQGVAQDFSFVLAQRGMFSYSGLTAAQVDRLREEHGIYAVSSGRICVAALNSRNIDAVAAGIAAVLK
>CP025350.1|AZW92987.1|1822024_1824061_+|UvrABC-system-protein-B
MTAPGFVEFPDSPFHLYQPYPPAGDQPGAIDALTEGVSDGLMFQTLLGVTGSGKTYTMANMIARLGRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYYDYYQPEAYVPTRDLFIEKDSSINEHIEQMRLSATKSLLERRDTVIVGTVSCIYGIGNPGDYHAMVLILRTGDRISRREVLARLVAMQYTRNDADFTRGVFRVRCETIDIFPAESPELALRLTLFDDEIESLELFDPLTGRVRQKLPRFTVYPGSHYVTPRETVLRAIETIKEELRERLAQLIADGKLVEAQRLEQRTRFDLEMLQELGFCKGIENYSRHLSGAAPGEPPPTLIDYLPADALMFIDESHVTIGQLGGMYRGDRSRKETLVQYGFRLPSALDNRPLRLEEFEARMRQCVFVSATPAAYEQEHADNVVEQVVRPTGLVDPIVEVRPAHTQVDDLLGEIHKRAALQERVLVTTLTKRMAEDLTDFLSEHGVRVRYLHSDIDTVERVEIIRDLRLGVFDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGRAILYADRITDSMRRAIDETERRRAKQIQHNTDHGITARGVSKAVRELIDGVVAPAGHDALESAVPAEVLTDEKAMAREIRRLEKLMMDHARNLEFEQAAAARDALNALKSRLLLDGVGWSG
>CP025350.1|AZW92988.1|1824313_1824805_+|low-molecular-weight-phosphotyrosine-protein-phosphatase
MMTKVLFVCMGNICRSPSAEGVFRYLVNDAGMGDVVRVDSAGTHAFHIGEAPDARAQAAARKRGYDLTHCAARQVTADDFREFDLILAMDWDNLAALQQQCPKAYQHKLMLLMRFANEFEEATVPDPYYGGPEGFGKVLDYLEDACQGVLELVRKRATQYQAA
>CP025350.1|AZW92989.1|1825020_1825533_+|Fe-S-cluster-assembly-transcriptional-regulator-IscR
MRLTTKGRFAVTAMIDLAMRQHSGPVTLAAISQRQNISLSYLEQLFGKLRRHELVDSVRGPGGGYSLARLARNVTVADIIFAVDEPLDATSCGGKRDCTSGNDGKPGKCMTHELWTTLNRKMVDYLDSVSLQDLVDQQRVRQLQEAANQAQGCSAVRVNRSTPVAANATA
>CP025350.1|AZW92990.1|1825550_1826762_+|IscS-subfamily-cysteine-desulfurase
MSNRPIYLDYSATTPVDPSVVEKMIPWLYESFGNPASRSHAFGWEAEDAVEKAREEVAKLVNADPREIVWTSGATESDNLAIKGAANFYAERGKHIITVKTEHKAVLDTCRELERQGFEVTYLDVQDDGLLSLDAFKAALRPDTILVSVMMVNNEIGVIQDIAALGEICREKGIIFHVDAAQATGKVEIDLQKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEAQMHGGGHERGFRSGTLATHQIVGMGEAFRLAREEMGTENERVRMLRDRLLAGLTQIEEVYVNGSMEHRVPHNLNISFNYVEGESLIMAIKELAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTLGRFTTEQEIDFTIELIKSRVGKLRDMSPLWEMAQEGIDLNSVQWAAH
>CP025350.1|AZW92991.1|1826799_1827210_+|Fe-S-cluster-assembly-scaffold-IscU
MAYSSKVLDHYENPRNVGSFDKGDDSVGTGMVGAPACGDVMKLQIKVNEAGVIEDARFKTYGCGSAIASSSLVTEWVKGKTLDEAMNIRNTQIAEELALPPVKIHCSILAEDAIKAAVQDYKTKHGAETPEAVAAN
>CP025350.1|AZW92992.1|1827211_1827535_+|iron-sulfur-cluster-assembly-protein-IscA
MAVTLTQSAANHVGRYLQKRGKGIGLRLGVRTTGCSGMAYKLEYVDEQAADDVVFDSFGVKVFIDPKSLAYLDGTELDYAREGLNEGFRFSNPNEKATCGCGESFTV
>CP025350.1|AZW92993.1|1827537_1828050_+|co-chaperone-protein-HscB
MAADDHFSLFGLPTRFALDPVQLEQAWRAVAARVHPDRYATASAAERRVAMQWAARANEAYRQLRDPMLRARYLCEQAGVDLQTESNTAMDPAFLMQQMEWREMLDDARRDPAAFAALRAELEQARLRMQQTLSELIDERGDYQQAGTKVREWMFVEKLAQELSAAQPMQ
>CP025350.1|AZW92994.1|1828179_1830042_+|chaperone-protein-HscA
MALLQISEPGDSPAPHQRKLAVGIDLGTTNSLVAAVRSSVPEVLADAQGQVLLPSAVRYLDGGAVRIGREALLEQARDPLNTIVSVKRFMGRSAADAAASGAPYEFVDAPGMVRLRTVQGDLSPVEVSAQILAVLRQRAEDVLGDDLVGAVITVPAYFDDAQRQATRDAARLAGLNVLRLLNEPTAAAIAYGLDQAAEGIYAVYDLGGGTFDISILRLTQGVFEVIATGGDTALGGDDFDSAIVAHACAGEDVAALPVADRRALLVAARAAREALTDQAQAPFEVTLRDGRAIQATLTRAQFEQLAEPLVGRTLDSARRALRDAGLAVGDVRGVVMVGGATRMPVVRQQVGALFGTEPLTNLDPDQVVALGAALQANLLAGNRALGEDWLLLDVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDCRSLARFELRGIPPMVAGAARIRVTFQVDADGLLSVTAREQSTGVEAAVAVKPSYGLSDDEIARMLADSVTQADSDARARMLREQQVEARQLVESVGAALAADGDLLDPAERATVDQRLQAAAQAQSLDDVEAVRAAVQALSDATEEFAARRMDRSIRSALAGRKLDELA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025350_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025350_5

3433531-3433640

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025350_5

>merge|CP025350|5|3433531-3433640|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP025350|5|5|3433531-3433640|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP025350.1\|AZW94281.1\|3419830_3420199_-\|hypothetical-protein	unknown	unknown	unknown
CP025350.1\|AZW94286.1\|3428386_3429157_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025350.1\|AZW94296.1\|3441573_3442914_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP025350.1\|AZW94297.1\|3443029_3444793_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP025350.1\|AZW94290.1\|3433641_3434034_-\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|224679
CP025350.1\|AZW94288.1\|3429988_3431398_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727
CP025350.1\|AZW94299.1\|3445895_3446711_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP025350.1\|AZW94280.1\|3418893_3419844_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025350.1\|AZW94285.1\|3427876_3428344_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP025350.1\|AZW94291.1\|3434171_3434852_+\|DUF533-domain-containing-protein	unknown	unknown	gnl\|CDD\|377342
CP025350.1\|AZW94283.1\|3424102_3424981_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP025350.1\|AZW94287.1\|3429177_3429978_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP025350.1\|AZW94289.1\|3431492_3432278_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
CP025350.1\|AZW94294.1\|3438378_3439080_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|181883
CP025350.1\|AZW94282.1\|3420197_3423176_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP025350.1\|AZW94295.1\|3439079_3440504_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236531
CP025350.1\|AZW94298.1\|3444904_3445783_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP025350.1\|AZW94284.1\|3426929_3427880_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025350.1\|AZW94292.1\|3434856_3435855_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025350.1\|AZW94293.1\|3435923_3436874_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
CP025350.1\|AZW94286.1\|3428386_3429157_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP025350.1\|AZW94296.1\|3441573_3442914_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP025350.1\|AZW94297.1\|3443029_3444793_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP025350.1\|AZW94290.1\|3433641_3434034_-\|OsmC-family-peroxiredoxin	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP025350.1\|AZW94288.1\|3429988_3431398_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP025350.1\|AZW94299.1\|3445895_3446711_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP025350.1\|AZW94280.1\|3418893_3419844_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.27808e-22
CP025350.1\|AZW94285.1\|3427876_3428344_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP025350.1\|AZW94291.1\|3434171_3434852_+\|DUF533-domain-containing-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62
CP025350.1\|AZW94283.1\|3424102_3424981_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP025350.1\|AZW94287.1\|3429177_3429978_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP025350.1\|AZW94289.1\|3431492_3432278_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP025350.1\|AZW94294.1\|3438378_3439080_+\|DNA-binding-response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP025350.1\|AZW94282.1\|3420197_3423176_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP025350.1\|AZW94295.1\|3439079_3440504_+\|ATP-binding-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP025350.1\|AZW94298.1\|3444904_3445783_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP025350.1\|AZW94284.1\|3426929_3427880_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025350.1\|AZW94292.1\|3434856_3435855_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76869e-129
CP025350.1\|AZW94293.1\|3435923_3436874_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23

>CP025350.1|AZW94289.1|3431492_3432278_+|enoyl-[acyl-carrier-protein]-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP025350.1|AZW94288.1|3429988_3431398_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP025350.1|AZW94287.1|3429177_3429978_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP025350.1|AZW94286.1|3428386_3429157_-|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP025350.1|AZW94285.1|3427876_3428344_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP025350.1|AZW94284.1|3426929_3427880_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025350.1|AZW94283.1|3424102_3424981_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP025350.1|AZW94282.1|3420197_3423176_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP025350.1|AZW94281.1|3419830_3420199_-|hypothetical-protein
MHVGQGLGDAVHGNAPGGRVGANLGNAQRQDDFLAPRIEHDAVLAPDEILQACAPVEWRGRVLRAAAQLPRQGLAQIQPHAQLDASCEDSIGCMHGSSEPDLRNWKSPPPQFTQGARPDEHP
>CP025350.1|AZW94280.1|3418893_3419844_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIPPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025350.1|AZW94290.1|3433641_3434034_-|OsmC-family-peroxiredoxin
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP025350.1|AZW94291.1|3434171_3434852_+|DUF533-domain-containing-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP025350.1|AZW94292.1|3434856_3435855_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRPVAPMTTMKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP025350.1|AZW94293.1|3435923_3436874_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025350.1|AZW94294.1|3438378_3439080_+|DNA-binding-response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP025350.1|AZW94295.1|3439079_3440504_+|ATP-binding-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP025350.1|AZW94296.1|3441573_3442914_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP025350.1|AZW94297.1|3443029_3444793_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP025350.1|AZW94298.1|3444904_3445783_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP025350.1|AZW94299.1|3445895_3446711_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 122073

110

Planktothrix_phage(16.67%)

protease,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW91487.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZW91488.1\|1916_2609_+	ribosomal RNA small subunit methyltransferase G	NA	NA	NA	NA
AZW91489.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZW91490.1\|3409_4171_+	N-acetyltransferase	NA	NA	NA	NA
AZW91491.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZW91492.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZW91493.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZW91494.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZW91495.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZW91496.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZW91497.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZW91498.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZW91499.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZW91500.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZW94867.1\|20126_20531_-	lipoprotein	NA	NA	NA	NA
AZW91501.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZW91502.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZW91503.1\|26470_27286_+	DNA-binding response regulator	NA	NA	NA	NA
AZW91504.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91505.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
AZW91506.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AZW91507.1\|29141_30368_-	thiolase family protein	NA	NA	NA	NA
AZW91508.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AZW94868.1\|31069_31978_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW91509.1\|32163_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW91510.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW91511.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91512.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AZW91513.1\|36949_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZW91514.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW91515.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZW91516.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW91517.1\|41318_42212_+	M48 family peptidase	NA	NA	NA	NA
AZW91518.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AZW91519.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZW91520.1\|43346_43646_-	DUF1974 domain-containing protein	NA	NA	NA	NA
AZW91521.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91522.1\|45113_45749_+	hypothetical protein	NA	NA	NA	NA
AZW91523.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW91524.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AZW91525.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZW91526.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZW91527.1\|50141_51092_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91528.1\|51134_52391_+	MFS transporter	NA	NA	NA	NA
AZW91529.1\|53622_54357_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
AZW91530.1\|54362_54953_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZW91531.1\|54977_55667_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW91532.1\|55663_56425_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW91533.1\|56504_57404_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW91534.1\|57497_58448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91535.1\|59248_60475_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW91536.1\|60474_60894_-	transcriptional regulator	NA	NA	NA	NA
AZW91537.1\|61077_62019_-	hypothetical protein	NA	NA	NA	NA
AZW91538.1\|62442_63279_-	hypothetical protein	NA	NA	NA	NA
AZW91539.1\|63473_64055_-\|protease	protease	NA	NA	NA	NA
AZW91540.1\|64067_64385_-	ferredoxin	NA	NA	NA	NA
AZW91541.1\|64488_65547_-	oxidoreductase	NA	NA	NA	NA
AZW91542.1\|65581_66853_-	TRAP transporter large permease	NA	NA	NA	NA
AZW91543.1\|67482_68664_-	hypothetical protein	NA	NA	NA	NA
AZW91544.1\|69085_70036_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91545.1\|70129_70444_+\|transposase	transposase	NA	NA	NA	NA
AZW91546.1\|71636_73544_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	1.1e-117	37.2
AZW91547.1\|73705_74326_-	glutathione S-transferase	NA	NA	NA	NA
AZW91548.1\|74357_74939_-	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	A0A1W6DX33	Sphingobium_phage	1.7e-05	54.3
AZW91549.1\|75027_75279_-	hypothetical protein	NA	NA	NA	NA
AZW94869.1\|75280_76030_-	hypothetical protein	NA	NA	NA	NA
AZW91550.1\|76228_77638_+	signal recognition particle protein	NA	NA	NA	NA
AZW91551.1\|77634_78585_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94870.1\|78659_79604_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91552.1\|79600_81475_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZW91553.1\|82822_83527_-	DUF2837 domain-containing protein	NA	NA	NA	NA
AZW91554.1\|83523_84630_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZW91555.1\|84891_85485_-	sugar transferase	NA	NA	NA	NA
AZW91556.1\|85481_86714_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZW91557.1\|86731_87991_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZW91558.1\|88014_89103_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZW91559.1\|89110_90211_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZW91560.1\|90214_90790_-	N-acetyltransferase	NA	NA	NA	NA
AZW91561.1\|90793_91846_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZW91562.1\|91976_92984_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZW91563.1\|92985_94272_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZW91564.1\|94288_94444_-	hypothetical protein	NA	NA	NA	NA
AZW91565.1\|94468_95272_-	type III pantothenate kinase	NA	NA	NA	NA
AZW91566.1\|95268_96135_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZW91567.1\|96203_97340_+	ABC transporter permease	NA	NA	NA	NA
AZW91568.1\|97339_98179_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZW91569.1\|99111_99714_+	hypothetical protein	NA	NA	NA	NA
AZW91570.1\|99743_100397_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW91571.1\|100529_101786_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
AZW91572.1\|101788_102733_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZW91573.1\|102808_103084_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZW91574.1\|103091_103754_+	octanoyltransferase	NA	NA	NA	NA
AZW91575.1\|103815_104817_+	lipoyl synthase	NA	NA	NA	NA
AZW91576.1\|104831_105380_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZW91577.1\|105437_106334_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZW91578.1\|106330_107392_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZW91579.1\|107427_108378_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91580.1\|109277_110471_+	cystathionine beta-lyase	NA	NA	NA	NA
AZW91581.1\|110552_111182_-	thiol:disulfide interchange protein DsbA	NA	NA	NA	NA
AZW91582.1\|111243_111927_-	SPOR domain-containing protein	NA	NA	NA	NA
AZW91583.1\|111936_113619_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZW94871.1\|113906_114254_+	DUF1840 domain-containing protein	NA	NA	NA	NA
AZW91584.1\|114344_114662_+	hypothetical protein	NA	NA	NA	NA
AZW94872.1\|114944_115961_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW91585.1\|116036_116837_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW91586.1\|116833_117709_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW91587.1\|117719_119012_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW91588.1\|119054_120095_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZW91589.1\|120200_121022_-	phosphodiesterase	NA	NA	NA	NA
AZW91590.1\|121122_122073_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

164891 : 303017

118

Klosneuvirus(10.53%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW91622.1\|164891_165842_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91623.1\|167285_168188_-	hypothetical protein	NA	NA	NA	NA
AZW91624.1\|168165_168795_-	LemA family protein	NA	NA	NA	NA
AZW91625.1\|169125_170508_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.3e-42	29.5
AZW91626.1\|170541_171171_+	threonine transporter RhtB	NA	NA	NA	NA
AZW91627.1\|171219_172827_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZW91628.1\|172851_173535_+	hypothetical protein	NA	NA	NA	NA
AZW94877.1\|173616_174093_-	bacterioferritin	NA	NA	NA	NA
AZW91629.1\|176364_176892_+	lipoprotein	NA	NA	NA	NA
AZW91630.1\|176983_177799_+	lipoprotein	NA	NA	NA	NA
AZW91631.1\|177859_178594_+	sulfurtransferase	NA	NA	NA	NA
AZW91632.1\|178631_180710_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZW91633.1\|180959_181232_-	hypothetical protein	NA	NA	NA	NA
AZW91634.1\|181330_182419_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW91635.1\|182422_184327_+	outer membrane protein assembly factor	NA	NA	NA	NA
AZW91636.1\|184323_187998_+	DUF490 domain-containing protein	NA	NA	NA	NA
AZW91637.1\|188058_188622_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZW91638.1\|188629_189052_-	glyoxalase	NA	NA	NA	NA
AZW91639.1\|189079_189499_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AZW94878.1\|189527_189974_-	N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
AZW91640.1\|190100_190598_+	hypothetical protein	NA	NA	NA	NA
AZW91641.1\|190752_193023_+	lysine decarboxylase	NA	NA	NA	NA
AZW91642.1\|193071_194304_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW91643.1\|195397_196090_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.4e-83	73.8
AZW91644.1\|196086_196980_+	ZIP family metal transporter	NA	NA	NA	NA
AZW91645.1\|197374_198475_+	aminomethyltransferase	NA	NA	NA	NA
AZW91646.1\|198556_198931_+	glycine cleavage system protein H	NA	NA	NA	NA
AZW91647.1\|198990_201855_+	glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZW91648.1\|201999_202740_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW91649.1\|202809_204021_+	CoA transferase	NA	NA	NA	NA
AZW91650.1\|204049_205018_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91651.1\|205631_206582_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91652.1\|206738_207062_+	PsiF repeat family protein	NA	NA	NA	NA
AZW91653.1\|207166_208216_-	cyclase	NA	NA	NA	NA
AZW91654.1\|208212_209037_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AZW91655.1\|209037_209334_-	YciI family protein	NA	NA	NA	NA
AZW91656.1\|209359_209635_-	muconolactone delta-isomerase	NA	NA	NA	NA
AZW91657.1\|209691_210336_-	CoA transferase subunit B	NA	NA	NA	NA
AZW91658.1\|210335_211022_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW94879.1\|211151_212003_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW91659.1\|212053_212779_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW91660.1\|212810_214160_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZW91661.1\|214271_215204_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZW91662.1\|215661_218457_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
AZW91663.1\|219050_221993_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZW91664.1\|222064_222784_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZW91665.1\|222822_223371_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZW91666.1\|223525_224425_+	virginiamycin B lyase	NA	NA	NA	NA
AZW91667.1\|224449_225400_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91668.1\|225386_225566_-	hypothetical protein	NA	NA	NA	NA
AZW91669.1\|225618_226314_+	FadR family transcriptional regulator	NA	NA	NA	NA
AZW91670.1\|226330_227743_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW91671.1\|227855_229286_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
AZW91672.1\|229327_231241_-	phosphomethylpyrimidine synthase	NA	NA	NA	NA
AZW91673.1\|231559_232126_+	preprotein translocase subunit SecD	NA	NA	NA	NA
AZW91674.1\|232216_233218_+	HindIII family type II restriction endonuclease	NA	NA	NA	NA
AZW91675.1\|233332_234283_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91676.1\|234369_235320_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91677.1\|235316_236267_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91678.1\|236365_237163_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW91679.1\|238112_238523_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZW91680.1\|239544_240288_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW91681.1\|240331_241375_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW91682.1\|241545_243648_+	hypothetical protein	NA	NA	NA	NA
AZW91683.1\|245058_246015_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91684.1\|246033_246525_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZW91685.1\|246521_247877_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZW91686.1\|247877_248576_-	HAD-IB family hydrolase	NA	NA	NA	NA
AZW91687.1\|248572_249274_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZW91688.1\|249526_250576_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZW91689.1\|250681_251623_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZW91690.1\|251619_253509_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZW91691.1\|253595_254234_+	hypothetical protein	NA	NA	NA	NA
AZW94880.1\|254376_255621_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.1e-17	30.3
AZW91692.1\|255692_256229_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZW91693.1\|256380_257772_+	class II fumarate hydratase	NA	NA	NA	NA
AZW91694.1\|257788_258769_-	AEC family transporter	NA	NA	NA	NA
AZW91695.1\|258904_259888_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
AZW91696.1\|259952_260852_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW91697.1\|260958_262713_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW91698.1\|262720_263845_-	CoA transferase	NA	NA	NA	NA
AZW91699.1\|263858_264839_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91700.1\|265569_266520_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91701.1\|267079_267625_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
AZW91702.1\|267708_269328_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW91703.1\|269343_270498_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AZW91704.1\|270511_270637_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
AZW91705.1\|270633_272385_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AZW91706.1\|272381_274061_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AZW91707.1\|274096_274672_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.4e-28	43.1
AZW91708.1\|275814_276093_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW91709.1\|277136_278087_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91710.1\|278073_278289_-	hypothetical protein	NA	NA	NA	NA
AZW91711.1\|278364_278526_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZW91712.1\|278533_278674_+	hypothetical protein	NA	NA	NA	NA
AZW91713.1\|279192_279642_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZW91714.1\|279651_280263_-	glutathione S-transferase	NA	NA	NA	NA
AZW91715.1\|280421_281276_-	cytochrome c1	NA	NA	NA	NA
AZW91716.1\|281295_282678_-	cytochrome b	NA	NA	NA	NA
AZW91717.1\|282742_283384_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZW91718.1\|283523_283982_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZW91719.1\|284006_284783_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZW94881.1\|284836_285973_+	PDZ domain-containing protein	W5SAB9	Pithovirus	1.2e-07	31.2
AZW91720.1\|285969_286920_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91721.1\|287018_287645_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW91722.1\|287667_288594_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AZW91723.1\|288602_290189_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW91724.1\|290185_291190_-	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	7.5e-30	31.5
AZW91725.1\|291389_292250_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW91726.1\|292281_293283_-	2-isopropylmalate synthase	NA	NA	NA	NA
AZW91727.1\|293353_294163_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW91728.1\|294240_296100_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZW91729.1\|296228_297431_-	MFS transporter	NA	NA	NA	NA
AZW91730.1\|297544_298426_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW91731.1\|299928_300489_-	5'-3'-deoxyribonucleotidase	A0A1E1EUN3	Acanthamoeba_castellanii_mimivirus	3.2e-14	30.8
AZW91732.1\|300548_301499_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91733.1\|301690_301951_-	hypothetical protein	NA	NA	NA	NA
AZW91734.1\|302066_303017_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

390853 : 448362

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW91819.1\|390853_391804_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91820.1\|391940_392858_+	reductase	NA	NA	NA	NA
AZW91821.1\|392854_393103_+	glutaredoxin family protein	NA	NA	NA	NA
AZW91822.1\|393099_394305_+	CoA transferase	NA	NA	NA	NA
AZW91823.1\|394377_395373_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91824.1\|395395_396616_-	CoA transferase	NA	NA	NA	NA
AZW91825.1\|396612_397257_-	hypothetical protein	NA	NA	NA	NA
AZW91826.1\|398987_399797_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW91827.1\|400014_401055_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-59	42.5
AZW91828.1\|401153_402137_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91829.1\|402063_402765_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91830.1\|402813_403584_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW91831.1\|403580_404822_-	CoA transferase	NA	NA	NA	NA
AZW91832.1\|404926_406633_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW91833.1\|406629_407526_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW91834.1\|407566_409156_-	sulfurtransferase	NA	NA	NA	NA
AZW91835.1\|409205_410198_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91836.1\|410266_410866_-	hypothetical protein	NA	NA	NA	NA
AZW94887.1\|411326_412304_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91837.1\|412382_413333_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91838.1\|413421_414336_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW91839.1\|414332_414992_+	LysE family translocator	NA	NA	NA	NA
AZW91840.1\|415081_416005_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AZW91841.1\|416010_416466_-	hypothetical protein	NA	NA	NA	NA
AZW91842.1\|416462_417566_-	ChbG/HpnK family deacetylase	NA	NA	NA	NA
AZW94888.1\|417485_417794_+	GtrA family protein	NA	NA	NA	NA
AZW91843.1\|417753_419373_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
AZW91844.1\|419369_420428_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AZW91845.1\|420557_421052_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW91846.1\|421144_422122_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91847.1\|422317_423523_+	sodium/glutamate symporter	NA	NA	NA	NA
AZW91848.1\|423519_425031_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
AZW94889.1\|425046_426360_-	short-chain fatty acids transporter	NA	NA	NA	NA
AZW91849.1\|426550_426730_-	hypothetical protein	NA	NA	NA	NA
AZW91850.1\|427139_427874_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AZW91851.1\|430318_431269_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW91852.1\|431400_431799_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZW91853.1\|432209_432680_-	universal stress protein	NA	NA	NA	NA
AZW91854.1\|432768_433113_-	TIGR01244 family phosphatase	NA	NA	NA	NA
AZW91855.1\|433212_434613_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW91856.1\|436401_436920_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.1e-12	38.9
AZW91857.1\|437030_437786_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZW91858.1\|437981_439214_+	CoA transferase	NA	NA	NA	NA
AZW91859.1\|439206_439992_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW91860.1\|440058_441030_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW91861.1\|441040_442018_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW91862.1\|442143_443316_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW91863.1\|443342_444371_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW91864.1\|444436_445630_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW91865.1\|447411_448362_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

619762 : 720226

111

uncultured_Caudovirales_phage(13.79%)

terminase,transposase,tRNA,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92015.1\|619762_620713_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92016.1\|621411_621795_+	hypothetical protein	NA	NA	NA	NA
AZW92017.1\|621852_622455_+	DUF2946 domain-containing protein	NA	NA	NA	NA
AZW94896.1\|622472_622874_-	DoxX family protein	NA	NA	NA	NA
AZW92018.1\|623007_623901_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92019.1\|623897_624479_+	NUDIX hydrolase	NA	NA	NA	NA
AZW92020.1\|625273_626008_+	arginyltransferase	NA	NA	NA	NA
AZW92021.1\|626048_627098_+	dihydroorotate dehydrogenase (quinone)	NA	NA	NA	NA
AZW92022.1\|627245_627824_-	Phasin (PHA-granule associated protein)	NA	NA	NA	NA
AZW92023.1\|628210_629188_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
AZW92024.1\|629281_633676_-	dermonecrotic toxin	NA	NA	NA	NA
AZW92025.1\|633876_634725_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW92026.1\|634883_635696_-	competence/damage-inducible protein A	NA	NA	NA	NA
AZW92027.1\|635751_636702_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92028.1\|636800_637601_-	hypothetical protein	NA	NA	NA	NA
AZW92029.1\|637662_638046_+	thioredoxin	NA	NA	NA	NA
AZW92030.1\|638057_639491_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZW92031.1\|639697_640027_-	AzlD domain-containing protein	NA	NA	NA	NA
AZW94897.1\|640029_640698_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW92032.1\|640961_641882_+	branched-chain amino acid transaminase	NA	NA	NA	NA
AZW92033.1\|641928_642141_+	zinc-finger domain-containing protein	NA	NA	NA	NA
AZW92034.1\|642163_642586_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AZW92035.1\|642602_643703_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW92036.1\|643799_645317_-	peptidase	NA	NA	NA	NA
AZW92037.1\|645392_646232_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZW92038.1\|646253_647135_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
AZW92039.1\|647216_648311_-	porin	NA	NA	NA	NA
AZW92040.1\|648604_649555_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94898.1\|649629_650571_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92041.1\|650654_651014_-	hypothetical protein	NA	NA	NA	NA
AZW92042.1\|651395_652433_-	hypothetical protein	NA	NA	NA	NA
AZW92043.1\|652749_654090_+	peptidase M24 family protein	NA	NA	NA	NA
AZW92044.1\|654099_654552_-	hypothetical protein	NA	NA	NA	NA
AZW92045.1\|654648_655830_+	monooxygenase	NA	NA	NA	NA
AZW92046.1\|655889_656921_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZW92047.1\|656961_657201_+	Fis family transcriptional regulator	NA	NA	NA	NA
AZW92048.1\|657270_658860_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZW92049.1\|658859_659408_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZW92050.1\|659488_660061_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AZW92051.1\|660079_660991_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZW92052.1\|661064_662033_-	threonine/serine dehydratase	NA	NA	NA	NA
AZW92053.1\|662155_663229_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZW92054.1\|663233_665054_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZW92055.1\|665130_666081_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92056.1\|666169_666505_+	ASCH domain-containing protein	NA	NA	NA	NA
AZW92057.1\|666638_667289_+	carbonic anhydrase	NA	NA	NA	NA
AZW92058.1\|667310_668729_-	amidase	NA	NA	NA	NA
AZW92059.1\|668798_669554_-	hypothetical protein	NA	NA	NA	NA
AZW94899.1\|669522_670281_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW92060.1\|670291_671173_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW92061.1\|671189_671897_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AZW92062.1\|671899_672658_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AZW92063.1\|672867_674610_+	sulfite reductase	NA	NA	NA	NA
AZW92064.1\|674602_675127_+	DUF934 domain-containing protein	NA	NA	NA	NA
AZW92065.1\|675166_675961_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92066.1\|676128_677202_+	hypothetical protein	NA	NA	NA	NA
AZW92067.1\|677300_678251_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92068.1\|678502_678715_-	hypothetical protein	NA	NA	NA	NA
AZW94900.1\|678780_679392_-	LexA family transcriptional repressor	NA	NA	NA	NA
AZW92069.1\|679871_680192_-	hypothetical protein	NA	NA	NA	NA
AZW92070.1\|680184_680883_-	hypothetical protein	NA	NA	NA	NA
AZW92071.1\|680897_681119_-	hypothetical protein	NA	NA	NA	NA
AZW92072.1\|681136_682087_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94901.1\|682762_683212_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	5.2e-39	61.5
AZW92073.1\|683198_684476_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZW92074.1\|684478_685897_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZW94902.1\|685925_686981_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
AZW92075.1\|686986_687229_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZW92076.1\|687351_687954_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZW92077.1\|688382_689333_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92078.1\|689350_689998_+	hypothetical protein	R9TJ64	Synechococcus_phage	2.7e-65	71.1
AZW92079.1\|690007_690259_+	hypothetical protein	NA	NA	NA	NA
AZW92080.1\|690321_690804_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZW92081.1\|690805_691006_+	hypothetical protein	NA	NA	NA	NA
AZW92082.1\|691005_691401_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZW92083.1\|691397_691796_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZW92084.1\|691792_692215_+	hypothetical protein	NA	NA	NA	NA
AZW92085.1\|692222_692723_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZW92086.1\|692977_693496_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZW92087.1\|693505_693835_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZW92088.1\|693852_694143_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZW92089.1\|694168_696781_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	4.9e-105	38.6
AZW92090.1\|696790_697150_+	hypothetical protein	NA	NA	NA	NA
AZW92091.1\|697217_697751_+	DUF1833 domain-containing protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZW92092.1\|697747_698137_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZW92093.1\|698129_702086_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZW92094.1\|702090_702507_+	hypothetical protein	NA	NA	NA	NA
AZW92095.1\|702725_702989_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AZW92096.1\|702988_703801_+	hypothetical protein	NA	NA	NA	NA
AZW92097.1\|703805_704048_+	hypothetical protein	NA	NA	NA	NA
AZW92098.1\|704026_704578_+	lysozyme	NA	NA	NA	NA
AZW92099.1\|704559_705093_+	DUF2514 domain-containing protein	NA	NA	NA	NA
AZW92100.1\|705089_705371_-	hypothetical protein	NA	NA	NA	NA
AZW92101.1\|705713_705914_+	hypothetical protein	NA	NA	NA	NA
AZW92102.1\|705920_706592_-	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZW92103.1\|706947_707634_-	DNA-binding response regulator	NA	NA	NA	NA
AZW92104.1\|707614_708187_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZW92105.1\|708252_709983_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AZW92106.1\|710035_710464_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AZW92107.1\|710466_711147_+	protein TolQ	NA	NA	NA	NA
AZW92108.1\|711146_711605_+	protein TolR	NA	NA	NA	NA
AZW92109.1\|711641_712616_+	cell envelope integrity protein TolA	NA	NA	NA	NA
AZW92110.1\|712632_713949_+	protein TolB	NA	NA	NA	NA
AZW92111.1\|713980_714478_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
AZW92112.1\|714564_715254_+	tol-pal system protein YbgF	NA	NA	NA	NA
AZW92113.1\|715253_716303_+	iron ABC transporter permease	NA	NA	NA	NA
AZW92114.1\|716299_717094_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AZW92115.1\|717262_717613_+	hypothetical protein	NA	NA	NA	NA
AZW92116.1\|717588_718146_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92117.1\|719070_719289_+	hypothetical protein	NA	NA	NA	NA
AZW92118.1\|719275_720226_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

747151 : 820313

Streptococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92139.1\|747151_748102_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92140.1\|748756_749854_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
AZW92141.1\|749887_751153_+	saccharopine dehydrogenase	NA	NA	NA	NA
AZW92142.1\|751310_752261_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92143.1\|752504_753095_+	polyisoprenoid-binding protein	NA	NA	NA	NA
AZW94904.1\|753110_755555_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW92144.1\|755674_756646_-	hypothetical protein	NA	NA	NA	NA
AZW92145.1\|756777_757302_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AZW92146.1\|757261_758212_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92147.1\|758433_760629_-	DNA methylase	NA	NA	NA	NA
AZW92148.1\|760701_761109_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZW92149.1\|761231_762182_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92150.1\|762297_762741_-	transcriptional regulator	NA	NA	NA	NA
AZW92151.1\|762803_763598_+	DNA-binding response regulator	NA	NA	NA	NA
AZW92152.1\|763763_764900_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	5.8e-63	44.8
AZW92153.1\|764970_766104_-	GTPase ObgE	NA	NA	NA	NA
AZW92154.1\|766253_766514_-	50S ribosomal protein L27	NA	NA	NA	NA
AZW92155.1\|766547_766859_-	50S ribosomal protein L21	NA	NA	NA	NA
AZW92156.1\|767283_768432_+	fumarylacetoacetate hydrolase	NA	NA	NA	NA
AZW92157.1\|768546_769512_+	octaprenyl diphosphate synthase	NA	NA	NA	NA
AZW92158.1\|769780_770647_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92159.1\|770777_772826_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW92160.1\|772843_774841_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW92161.1\|774875_776213_+	FAD-binding oxidoreductase	NA	NA	NA	NA
AZW92162.1\|776475_778329_+	hypothetical protein	NA	NA	NA	NA
AZW92163.1\|778383_779865_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW92164.1\|779880_780468_-	cyclolysin-activating lysine-acyltransferase CyaC	NA	NA	NA	NA
AZW94905.1\|780550_780730_+	hypothetical protein	NA	NA	NA	NA
AZW92165.1\|780916_786037_+	bifunctional adenylate cyclase toxin/hemolysin CyaA	NA	NA	NA	NA
AZW92166.1\|786114_788253_+	cyclolysin secretion/processing ATP-binding protein CyaB	W8CYL7	Bacillus_phage	2.7e-45	29.2
AZW92167.1\|788249_789572_+	protein CyaD	NA	NA	NA	NA
AZW92168.1\|789573_790998_+	protein CyaE	NA	NA	NA	NA
AZW92169.1\|791088_791997_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92170.1\|792061_792976_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92171.1\|793813_794497_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW92172.1\|794513_795257_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.5e-32	42.4
AZW92173.1\|795286_796147_+	aminotransferase	NA	NA	NA	NA
AZW92174.1\|796154_796721_-	hypothetical protein	NA	NA	NA	NA
AZW92175.1\|796809_797766_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92176.1\|797810_798563_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW92177.1\|798559_800305_-	acetolactate synthase catalytic subunit	NA	NA	NA	NA
AZW92178.1\|800389_801124_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW92179.1\|801440_802463_+	autotransporter domain-containing protein	NA	NA	NA	NA
AZW92180.1\|802478_803201_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW92181.1\|803345_804353_-	zinc-binding dehydrogenase	NA	NA	NA	NA
AZW92182.1\|804393_805926_-	long-chain fatty acid--CoA ligase	NA	NA	NA	NA
AZW92183.1\|805922_807041_-	DUF2817 domain-containing protein	NA	NA	NA	NA
AZW92184.1\|807037_807820_-	ABC transporter permease	NA	NA	NA	NA
AZW92185.1\|807831_808695_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.6e-34	38.9
AZW94906.1\|808713_809811_-	hypothetical protein	NA	NA	NA	NA
AZW92186.1\|809879_810806_-	VOC family protein	NA	NA	NA	NA
AZW92187.1\|810840_812535_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW92188.1\|812734_813670_-	mechanosensitive ion channel family protein	NA	NA	NA	NA
AZW92189.1\|813775_814726_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92190.1\|814824_815481_-	DUF4136 domain-containing protein	NA	NA	NA	NA
AZW92191.1\|815628_818337_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	2.8e-15	24.0
AZW92192.1\|818346_819366_+	fructose 1,6-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.5e-49	35.7
AZW92193.1\|819362_820313_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

853060 : 902324

Vibrio_phage(33.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92222.1\|853060_854011_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94907.1\|853983_854583_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW92223.1\|854584_855019_+	PaaI family thioesterase	NA	NA	NA	NA
AZW92224.1\|855015_855450_+	hypothetical protein	NA	NA	NA	NA
AZW92225.1\|855433_856237_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AZW92226.1\|856253_857069_-	DNA repair exonuclease	NA	NA	NA	NA
AZW92227.1\|857065_857881_-	diacylglycerol kinase	NA	NA	NA	NA
AZW92228.1\|858027_858729_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92229.1\|858756_860715_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AZW92230.1\|860797_861748_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92231.1\|861968_862637_+	transcriptional regulator	NA	NA	NA	NA
AZW92232.1\|862760_863867_+	MexH family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW92233.1\|863879_866993_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.5e-57	21.5
AZW92234.1\|866989_868483_+	RND transporter	NA	NA	NA	NA
AZW92235.1\|868497_869169_+	transcriptional regulator	NA	NA	NA	NA
AZW92236.1\|869212_869707_-	azurin	NA	NA	NA	NA
AZW92237.1\|869847_870495_-	transcriptional regulator	NA	NA	NA	NA
AZW94908.1\|870598_872647_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW92238.1\|872643_874656_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW92239.1\|874681_876016_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW92240.1\|876124_877117_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92241.1\|877183_879268_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZW92242.1\|879292_880264_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92243.1\|880392_881394_-	peptidase M14	NA	NA	NA	NA
AZW92244.1\|881427_882669_-	cystathionine beta-lyase	NA	NA	NA	NA
AZW92245.1\|882749_883673_+	transcriptional regulator LrhA	NA	NA	NA	NA
AZW92246.1\|883750_884575_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW94909.1\|884771_885788_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW92247.1\|885984_886968_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92248.1\|888566_889955_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW92249.1\|889985_890975_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92250.1\|891085_892318_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW92251.1\|892599_893400_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW92252.1\|893422_895654_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZW92253.1\|896441_896888_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZW92254.1\|896909_897656_-	triose-phosphate isomerase	NA	NA	NA	NA
AZW92255.1\|897799_898777_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZW92256.1\|899410_900022_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZW92257.1\|900015_901233_-	threonine ammonia-lyase	NA	NA	NA	NA
AZW92258.1\|901373_902324_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

911936 : 976876

Bacillus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92267.1\|911936_912887_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92268.1\|912883_914734_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.4
AZW92269.1\|915114_915774_+	thiopurine S-methyltransferase	NA	NA	NA	NA
AZW92270.1\|915861_916014_+	hypothetical protein	NA	NA	NA	NA
AZW92271.1\|916122_916290_+	hypothetical protein	NA	NA	NA	NA
AZW92272.1\|916301_916982_-	DUF3313 domain-containing protein	NA	NA	NA	NA
AZW92273.1\|917263_917980_+	flagellar brake protein	NA	NA	NA	NA
AZW92274.1\|917994_919296_-	phospholipase	NA	NA	NA	NA
AZW92275.1\|921440_924329_+	metal-dependent phosphohydrolase	NA	NA	NA	NA
AZW92276.1\|924552_925905_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW92277.1\|925933_926455_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AZW92278.1\|926451_927906_+	carboxylase	NA	NA	NA	NA
AZW92279.1\|927940_928189_+	hypothetical protein	NA	NA	NA	NA
AZW92280.1\|928294_929170_+	hypothetical protein	NA	NA	NA	NA
AZW92281.1\|929195_930251_+	hypothetical protein	NA	NA	NA	NA
AZW92282.1\|930263_931055_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW92283.1\|931087_932458_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AZW92284.1\|933634_934585_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92285.1\|934637_934859_+	hypothetical protein	NA	NA	NA	NA
AZW92286.1\|935018_935231_+	hypothetical protein	NA	NA	NA	NA
AZW92287.1\|935350_936469_+	mannose-6-phosphate isomerase	NA	NA	NA	NA
AZW92288.1\|936565_936781_+	hypothetical protein	NA	NA	NA	NA
AZW92289.1\|936974_937226_+	hypothetical protein	NA	NA	NA	NA
AZW92290.1\|937338_938289_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92291.1\|938285_938669_-	ferredoxin	NA	NA	NA	NA
AZW92292.1\|938723_940541_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
AZW94911.1\|940687_941515_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
AZW92293.1\|941560_942541_+	aldo/keto reductase	NA	NA	NA	NA
AZW92294.1\|942537_942750_-	hypothetical protein	NA	NA	NA	NA
AZW92295.1\|942746_943928_-	PepSY domain-containing protein	NA	NA	NA	NA
AZW92296.1\|944091_944826_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
AZW92297.1\|944827_947440_-	penicillin-binding protein	NA	NA	NA	NA
AZW92298.1\|947575_949489_-	S9 family peptidase	NA	NA	NA	NA
AZW92299.1\|950104_950515_-	PaaI family thioesterase	NA	NA	NA	NA
AZW92300.1\|950612_951698_+	DNA polymerase IV	NA	NA	NA	NA
AZW92301.1\|951796_952747_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92302.1\|952743_953718_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92303.1\|953842_954754_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
AZW94912.1\|955030_955423_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZW92304.1\|955552_956503_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92305.1\|956532_956715_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZW92306.1\|956753_957011_-	hypothetical protein	NA	NA	NA	NA
AZW92307.1\|957487_958669_-	MFS transporter	NA	NA	NA	NA
AZW92308.1\|958884_959562_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW92309.1\|959558_960332_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AZW92310.1\|960409_960991_-	OmpA family protein	NA	NA	NA	NA
AZW92311.1\|961361_964043_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZW92312.1\|964042_965176_+	phosphoserine aminotransferase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
AZW92313.1\|965168_966254_+	prephenate dehydratase	NA	NA	NA	NA
AZW92314.1\|966340_967240_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AZW92315.1\|967236_968565_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZW92316.1\|968579_969251_+	cytidylate kinase	NA	NA	NA	NA
AZW92317.1\|969423_971154_+	30S ribosomal protein S1	NA	NA	NA	NA
AZW92318.1\|971155_971515_+	integration host factor subunit beta	NA	NA	NA	NA
AZW92319.1\|971706_972021_+	DUF1049 domain-containing protein	NA	NA	NA	NA
AZW92320.1\|972063_973284_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZW92321.1\|973280_974222_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZW92322.1\|974218_975208_+	ADP-L-glycero-D-mannoheptose-6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZW92323.1\|975242_975827_+	DUF655 domain-containing protein	NA	NA	NA	NA
AZW92324.1\|975925_976876_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

996276 : 1068792

Enterococcus_phage(14.29%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92339.1\|996276_997227_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92340.1\|997331_998381_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
AZW94914.1\|998518_999535_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW92341.1\|1001043_1001616_-	chorismate--pyruvate lyase	NA	NA	NA	NA
AZW92342.1\|1001675_1002407_+	rRNA pseudouridine synthase	NA	NA	NA	NA
AZW94915.1\|1002458_1003376_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92343.1\|1004183_1007363_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AZW92344.1\|1007359_1008742_+	multidrug transporter	NA	NA	NA	NA
AZW92345.1\|1008811_1009063_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AZW92346.1\|1009208_1009859_-	SCO family protein	NA	NA	NA	NA
AZW92347.1\|1010009_1012124_-	M3 family peptidase	NA	NA	NA	NA
AZW92348.1\|1012199_1013051_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
AZW92349.1\|1013047_1013674_-	DNA-binding response regulator	NA	NA	NA	NA
AZW92350.1\|1013670_1015425_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
AZW92351.1\|1015717_1018423_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AZW92352.1\|1018435_1020097_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
AZW92353.1\|1020109_1021900_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
AZW92354.1\|1022121_1023297_-	flagellin FliC	NA	NA	NA	NA
AZW92355.1\|1024387_1025128_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AZW92356.1\|1025322_1027359_+	transketolase	NA	NA	NA	NA
AZW92357.1\|1027376_1028387_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZW92358.1\|1028504_1029698_+	phosphoglycerate kinase	NA	NA	NA	NA
AZW92359.1\|1029727_1030501_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW92360.1\|1030497_1031688_-	acetate kinase	NA	NA	NA	NA
AZW92361.1\|1031713_1032652_-	phosphate acetyltransferase	NA	NA	NA	NA
AZW94916.1\|1032648_1034997_-	DUF3141 domain-containing protein	NA	NA	NA	NA
AZW92362.1\|1035151_1035859_-	glutathione S-transferase	NA	NA	NA	NA
AZW92363.1\|1035896_1037030_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92364.1\|1037306_1037855_-	damage-inducible protein DinB	NA	NA	NA	NA
AZW92365.1\|1037873_1038359_-	N-acetyltransferase	NA	NA	NA	NA
AZW92366.1\|1038536_1039475_+	curved DNA-binding protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
AZW92367.1\|1039477_1039795_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZW92368.1\|1039840_1040785_+	hypothetical protein	NA	NA	NA	NA
AZW92369.1\|1042465_1043116_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AZW92370.1\|1043169_1043505_+	hypothetical protein	NA	NA	NA	NA
AZW92371.1\|1043501_1044362_+	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
AZW92372.1\|1044378_1044660_-	hypothetical protein	NA	NA	NA	NA
AZW92373.1\|1044733_1044997_-	translation initiation factor IF-1	NA	NA	NA	NA
AZW92374.1\|1045240_1046191_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92375.1\|1046489_1047227_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AZW92376.1\|1047662_1047986_+	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AZW92377.1\|1048020_1048581_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
AZW92378.1\|1048701_1049577_+	flagellar motor stator protein MotA	NA	NA	NA	NA
AZW92379.1\|1049589_1050537_+	motility protein MotB	NA	NA	NA	NA
AZW92380.1\|1050638_1050932_+	response regulator	NA	NA	NA	NA
AZW92381.1\|1050958_1053016_+	chemotaxis protein CheA	NA	NA	NA	NA
AZW92382.1\|1053030_1053531_+	chemotaxis protein CheW	NA	NA	NA	NA
AZW92383.1\|1053604_1055311_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AZW92384.1\|1056174_1057227_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AZW92385.1\|1057279_1057669_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AZW92386.1\|1057677_1058310_+	protein phosphatase CheZ	NA	NA	NA	NA
AZW94917.1\|1058409_1059426_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW94918.1\|1060256_1061264_+	aldo/keto reductase	NA	NA	NA	NA
AZW92387.1\|1061260_1062904_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
AZW92388.1\|1062900_1063803_-	magnesium/cobalt efflux protein	NA	NA	NA	NA
AZW92389.1\|1063928_1064402_-	endoribonuclease YbeY	NA	NA	NA	NA
AZW92390.1\|1064391_1065414_-	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	8.7e-50	45.4
AZW92391.1\|1065410_1066838_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZW94919.1\|1067775_1068792_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

1072545 : 1134621

Catovirus(20.0%)

transposase,tRNA,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92395.1\|1072545_1073682_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZW92396.1\|1073678_1074752_-\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AZW92397.1\|1074909_1076346_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZW94920.1\|1076436_1077078_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZW94921.1\|1077413_1078430_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW92398.1\|1080306_1080486_+	hypothetical protein	NA	NA	NA	NA
AZW94922.1\|1080472_1081423_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94923.1\|1082625_1084047_-	siroheme synthase	NA	NA	NA	NA
AZW92399.1\|1084310_1085027_+	hypothetical protein	NA	NA	NA	NA
AZW92400.1\|1085111_1085429_+	DUF883 domain-containing protein	NA	NA	NA	NA
AZW92401.1\|1085469_1085883_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW92402.1\|1085884_1086244_+	hypothetical protein	NA	NA	NA	NA
AZW92403.1\|1086286_1087831_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
AZW92404.1\|1087914_1088745_+	transglycosylase	NA	NA	NA	NA
AZW92405.1\|1088779_1089934_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZW92406.1\|1089976_1090849_+	hypothetical protein	NA	NA	NA	NA
AZW92407.1\|1090965_1093254_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW92408.1\|1094460_1094925_+	barstar family protein 2	NA	NA	NA	NA
AZW92409.1\|1094951_1095902_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94924.1\|1096269_1097046_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-17	28.7
AZW92410.1\|1097090_1097948_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AZW92411.1\|1097969_1098986_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZW92412.1\|1099120_1100161_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
AZW92413.1\|1100355_1102437_-	polyphosphate kinase 1	NA	NA	NA	NA
AZW92414.1\|1102672_1104166_+	exopolyphosphatase	NA	NA	NA	NA
AZW92415.1\|1104396_1105191_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW92416.1\|1105411_1106770_-	phosphoglucosamine mutase	NA	NA	NA	NA
AZW92417.1\|1106766_1107609_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
AZW92418.1\|1107627_1109514_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
AZW92419.1\|1109751_1110384_-	ribosomal RNA large subunit methyltransferase E	NA	NA	NA	NA
AZW92420.1\|1110402_1111005_+	hypothetical protein	NA	NA	NA	NA
AZW92421.1\|1111156_1112107_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92422.1\|1112909_1113710_-	hypothetical protein	NA	NA	NA	NA
AZW92423.1\|1113753_1114740_-	homoserine kinase	NA	NA	NA	NA
AZW92424.1\|1114879_1115893_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AZW92425.1\|1115889_1116840_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92426.1\|1116952_1117411_-	CBS domain-containing protein	NA	NA	NA	NA
AZW92427.1\|1117447_1118761_-	hypothetical protein	NA	NA	NA	NA
AZW92428.1\|1118778_1119150_+	DUF2069 domain-containing protein	NA	NA	NA	NA
AZW92429.1\|1119146_1120610_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
AZW92430.1\|1120702_1121479_+	DNA-binding response regulator	NA	NA	NA	NA
AZW92431.1\|1121460_1124340_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AZW92432.1\|1124522_1125473_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92433.1\|1125640_1126465_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
AZW92434.1\|1126464_1127343_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW92435.1\|1128247_1129363_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92436.1\|1129370_1130186_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.5e-12	23.7
AZW92437.1\|1130182_1132048_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
AZW92438.1\|1132126_1132759_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW92439.1\|1132755_1133058_-	hypothetical protein	NA	NA	NA	NA
AZW92440.1\|1133100_1134621_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0

DBSCAN-SWA_10

1156539 : 1218710

Erysipelothrix_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92454.1\|1156539_1157490_-\|transposase	IS481 family transposase IS481v2	NA	NA	NA	NA
AZW92455.1\|1157588_1158221_-	fimbrial protein	NA	NA	NA	NA
AZW92456.1\|1158385_1160668_-	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW92457.1\|1160822_1163519_-	alpha-ketoglutarate dehydrogenase	NA	NA	NA	NA
AZW92458.1\|1163644_1164133_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW92459.1\|1166543_1169414_+	2-oxoglutarate dehydrogenase E1 component	NA	NA	NA	NA
AZW92460.1\|1169459_1170674_+	dihydrolipoyllysine-residue succinyltransferase	NA	NA	NA	NA
AZW92461.1\|1170903_1172331_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-41	28.1
AZW92462.1\|1172371_1173520_+	cell division protein ZapE	NA	NA	NA	NA
AZW92463.1\|1173532_1174291_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW92464.1\|1174378_1175281_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92465.1\|1175277_1176228_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92466.1\|1176357_1177341_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92467.1\|1177395_1178118_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW92468.1\|1179596_1180952_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AZW92469.1\|1181032_1183408_-	protein tex	NA	NA	NA	NA
AZW92470.1\|1183572_1185648_+	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	2.4e-75	30.0
AZW92471.1\|1185709_1186510_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
AZW92472.1\|1186611_1187574_+	RluA family pseudouridine synthase	NA	NA	NA	NA
AZW92473.1\|1187561_1188317_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
AZW92474.1\|1188424_1190062_+	class I poly(R)-hydroxyalkanoic acid synthase	NA	NA	NA	NA
AZW92475.1\|1190129_1190867_+	beta-ketoacyl-ACP reductase	NA	NA	NA	NA
AZW92476.1\|1190969_1191545_+	polyhydroxyalkanoate synthesis repressor PhaR	NA	NA	NA	NA
AZW92477.1\|1191717_1192254_+	hypothetical protein	NA	NA	NA	NA
AZW92478.1\|1192256_1192601_+	cupredoxin domain-containing protein	NA	NA	NA	NA
AZW92479.1\|1192616_1193462_+	FTR1 family iron permease	NA	NA	NA	NA
AZW92480.1\|1193500_1194880_+	4Fe-4S binding domain-containing protein	NA	NA	NA	NA
AZW92481.1\|1194957_1195839_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
AZW92482.1\|1195937_1196888_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92483.1\|1196884_1197295_-	VOC family protein	NA	NA	NA	NA
AZW92484.1\|1197402_1198257_-	2-pyrone-4,6-dicarboxylate hydrolase	NA	NA	NA	NA
AZW92485.1\|1198249_1199212_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92486.1\|1199257_1200382_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.5e-31	28.3
AZW94926.1\|1200493_1201366_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92487.1\|1201490_1202270_+	short-chain dehydrogenase	NA	NA	NA	NA
AZW92488.1\|1202423_1203845_+	MFS transporter	NA	NA	NA	NA
AZW92489.1\|1204279_1205977_+	sodium:proline symporter	NA	NA	NA	NA
AZW92490.1\|1206005_1206128_+	hypothetical protein	NA	NA	NA	NA
AZW94927.1\|1206203_1207145_-	LD-carboxypeptidase	NA	NA	NA	NA
AZW92491.1\|1207471_1208218_+	hypothetical protein	NA	NA	NA	NA
AZW92492.1\|1208225_1209152_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92493.1\|1209273_1210191_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW92494.1\|1210230_1211184_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92495.1\|1211208_1211787_+	amino acid synthesis family protein	NA	NA	NA	NA
AZW92496.1\|1213460_1214069_+	hypothetical protein	NA	NA	NA	NA
AZW94928.1\|1214146_1214500_-	hypothetical protein	NA	NA	NA	NA
AZW92497.1\|1214583_1215573_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZW92498.1\|1215775_1216726_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92499.1\|1216812_1217763_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92500.1\|1217759_1218710_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1291673 : 1328439

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92553.1\|1291673_1292624_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92554.1\|1293245_1294973_-	sodium-independent anion transporter	NA	NA	NA	NA
AZW92555.1\|1295084_1296443_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW92556.1\|1296563_1296749_+	hypothetical protein	NA	NA	NA	NA
AZW92557.1\|1296735_1297686_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92558.1\|1297726_1298797_+	FUSC family protein	NA	NA	NA	NA
AZW92559.1\|1298819_1299698_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW92560.1\|1299869_1300841_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW92561.1\|1301003_1301846_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92562.1\|1302007_1302688_+	anti-sigma factor	NA	NA	NA	NA
AZW92563.1\|1302681_1303851_+	amine oxidase	NA	NA	NA	NA
AZW92564.1\|1303847_1304879_+	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZW92565.1\|1304922_1306164_+	MFS transporter	NA	NA	NA	NA
AZW92566.1\|1306198_1307731_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW92567.1\|1307811_1308435_+	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW92568.1\|1308465_1309077_+	LysE family translocator	NA	NA	NA	NA
AZW92569.1\|1309112_1309583_+	DUF1801 domain-containing protein	NA	NA	NA	NA
AZW92570.1\|1310014_1311019_+	peptidase M20	NA	NA	NA	NA
AZW92571.1\|1311055_1312570_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92572.1\|1312573_1313533_+	ABC transporter permease	NA	NA	NA	NA
AZW92573.1\|1313561_1314365_+	ABC transporter permease	NA	NA	NA	NA
AZW92574.1\|1314366_1316001_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZW92575.1\|1316084_1317146_+	LacI family transcriptional regulator	NA	NA	NA	NA
AZW92576.1\|1317344_1317614_+	hypothetical protein	NA	NA	NA	NA
AZW92577.1\|1317617_1318142_+	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZW92578.1\|1318557_1319508_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92579.1\|1319504_1320575_-	metal-dependent hydrolase	NA	NA	NA	NA
AZW92580.1\|1320647_1321286_+	DedA family protein	NA	NA	NA	NA
AZW92581.1\|1321580_1321808_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW92582.1\|1321930_1322644_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW92583.1\|1322888_1323839_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92584.1\|1323942_1324224_+	hypothetical protein	NA	NA	NA	NA
AZW92585.1\|1324338_1325787_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW92586.1\|1325897_1326848_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92587.1\|1326844_1327294_-	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AZW92588.1\|1327313_1327502_+	hypothetical protein	NA	NA	NA	NA
AZW92589.1\|1327488_1328439_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_12

1572120 : 1643274

Ectocarpus_siliculosus_virus(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92809.1\|1572120_1573071_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92810.1\|1573092_1574313_+	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
AZW92811.1\|1574498_1575911_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZW92812.1\|1575974_1577042_+	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZW92813.1\|1577038_1578529_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZW94941.1\|1578538_1579483_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92814.1\|1579642_1580341_+	pirin family protein	NA	NA	NA	NA
AZW92815.1\|1580418_1581324_+	pirin family protein	NA	NA	NA	NA
AZW92816.1\|1581343_1582294_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92817.1\|1582392_1583187_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AZW92818.1\|1583191_1584862_-	iron ABC transporter permease	NA	NA	NA	NA
AZW92819.1\|1584985_1586035_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92820.1\|1586356_1587133_+	ferredoxin--NADP reductase	NA	NA	NA	NA
AZW92821.1\|1587197_1588100_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92822.1\|1589393_1590197_+	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AZW92823.1\|1592890_1593277_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
AZW92824.1\|1593292_1595383_+	DNA helicase RecG	NA	NA	NA	NA
AZW92825.1\|1595434_1596388_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AZW94942.1\|1596402_1597290_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92826.1\|1597427_1598954_+	methylmalonate-semialdehyde dehydrogenase (CoA acylating)	NA	NA	NA	NA
AZW94943.1\|1599052_1599553_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AZW92827.1\|1599876_1601832_-	capsular biosynthesis protein	NA	NA	NA	NA
AZW92828.1\|1601999_1604084_-	hypothetical protein	NA	NA	NA	NA
AZW92829.1\|1604110_1604896_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-12	32.0
AZW92830.1\|1605751_1606522_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AZW92831.1\|1606521_1607262_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW92832.1\|1607303_1608473_+	capsule biosynthesis protein	NA	NA	NA	NA
AZW92833.1\|1608504_1610589_+	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AZW92834.1\|1610585_1611476_+	capsular biosynthesis protein	NA	NA	NA	NA
AZW92835.1\|1611472_1612570_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW92836.1\|1612592_1613882_+	nucleotide sugar dehydrogenase	NA	NA	NA	NA
AZW92837.1\|1613893_1614919_+	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AZW92838.1\|1614915_1616973_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW92839.1\|1616986_1618162_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZW92840.1\|1618243_1619194_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92841.1\|1619252_1620026_+	oxidoreductase	NA	NA	NA	NA
AZW92842.1\|1620018_1621575_+	LTA synthase family protein	NA	NA	NA	NA
AZW92843.1\|1621571_1622522_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92844.1\|1623848_1624451_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW92845.1\|1624690_1625392_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW92846.1\|1625385_1626168_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZW92847.1\|1626352_1627303_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92848.1\|1627401_1628139_-	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZW92849.1\|1628328_1629087_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW92850.1\|1629133_1630123_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92851.1\|1630300_1631269_-	transporter	NA	NA	NA	NA
AZW92852.1\|1632808_1633777_+	AAA family ATPase	NA	NA	NA	NA
AZW92853.1\|1633785_1634727_+	DUF58 domain-containing protein	NA	NA	NA	NA
AZW92854.1\|1635200_1636211_+	hypothetical protein	NA	NA	NA	NA
AZW94944.1\|1636201_1637716_+	VWA domain-containing protein	NA	NA	NA	NA
AZW92855.1\|1637712_1639059_+	hypothetical protein	NA	NA	NA	NA
AZW94945.1\|1639061_1640096_+	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
AZW92856.1\|1640145_1641771_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZW92857.1\|1642323_1643274_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1664065 : 1725413

uncultured_Caudovirales_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92871.1\|1664065_1665016_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94951.1\|1665309_1666032_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AZW92872.1\|1666470_1667658_-	MFS transporter	NA	NA	NA	NA
AZW92873.1\|1667661_1668042_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AZW92874.1\|1669761_1670733_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW92875.1\|1670746_1671460_+	NAD-dependent oxidoreductase	NA	NA	NA	NA
AZW92876.1\|1671464_1672382_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW92877.1\|1672488_1672785_+	hypothetical protein	NA	NA	NA	NA
AZW92878.1\|1672883_1673834_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92879.1\|1674992_1677926_+	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AZW92880.1\|1677925_1678270_+	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AZW92881.1\|1678266_1679895_+	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AZW92882.1\|1679891_1680371_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AZW92883.1\|1680367_1680652_+	K+/H+ antiporter subunit F	NA	NA	NA	NA
AZW92884.1\|1680648_1680975_+	cation:proton antiporter	NA	NA	NA	NA
AZW92885.1\|1681130_1682081_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92886.1\|1682124_1682667_+	hypothetical protein	NA	NA	NA	NA
AZW92887.1\|1682764_1683613_+	hydrolase	NA	NA	NA	NA
AZW92888.1\|1683605_1684112_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.4e-07	38.4
AZW92889.1\|1684108_1685110_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
AZW92890.1\|1685122_1685917_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW92891.1\|1685965_1687867_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW92892.1\|1687863_1688487_-	hypothetical protein	NA	NA	NA	NA
AZW92893.1\|1688613_1689738_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92894.1\|1690055_1691723_+	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.6e-53	28.9
AZW92895.1\|1691878_1692655_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
AZW92896.1\|1692739_1693738_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92897.1\|1693734_1694508_+	ABC transporter permease	NA	NA	NA	NA
AZW92898.1\|1695492_1696443_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92899.1\|1696466_1696931_-	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
AZW92900.1\|1697077_1698286_+	flavohemoprotein	NA	NA	NA	NA
AZW92901.1\|1698296_1698767_+	DNA-binding protein	NA	NA	NA	NA
AZW92902.1\|1698885_1700175_+	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW92903.1\|1702915_1703866_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92904.1\|1703964_1704981_-	folate-binding protein	NA	NA	NA	NA
AZW92905.1\|1705147_1706194_+	endolytic transglycosylase MltG	NA	NA	NA	NA
AZW92906.1\|1706190_1706817_+	thymidylate kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
AZW92907.1\|1706813_1707866_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
AZW92908.1\|1707915_1708686_+	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW92909.1\|1708736_1709573_+	hypothetical protein	NA	NA	NA	NA
AZW92910.1\|1709768_1710509_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW92911.1\|1710583_1711327_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92912.1\|1711988_1712762_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	37.7
AZW92913.1\|1713899_1715189_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AZW92914.1\|1716799_1718047_-	Zn-dependent hydrolase	NA	NA	NA	NA
AZW92915.1\|1718056_1719766_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
AZW92916.1\|1719762_1720701_-	CoA ester lyase	NA	NA	NA	NA
AZW92917.1\|1720697_1721981_-	TRAP transporter large permease	NA	NA	NA	NA
AZW92918.1\|1721984_1722467_-	TRAP transporter small permease	NA	NA	NA	NA
AZW92919.1\|1722467_1723454_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW92920.1\|1723626_1724346_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW92921.1\|1724462_1725413_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1831601 : 1890871

Klosneuvirus(40.0%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW92998.1\|1831601_1832552_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW92999.1\|1832676_1833486_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW93000.1\|1833686_1834637_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93001.1\|1835910_1837128_+	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
AZW93002.1\|1838184_1839087_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW93003.1\|1839163_1840036_+	MOSC domain-containing protein	NA	NA	NA	NA
AZW93004.1\|1840166_1840535_+	aspartate 1-decarboxylase	NA	NA	NA	NA
AZW93005.1\|1840592_1841639_+	CDP-6-deoxy-delta-3,4-glucoseen reductase	NA	NA	NA	NA
AZW93006.1\|1841834_1843091_+	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW93007.1\|1843095_1844433_+	glycerol-3-phosphate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93008.1\|1844582_1845539_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93009.1\|1847011_1847362_+	hypothetical protein	NA	NA	NA	NA
AZW93010.1\|1847409_1848984_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93011.1\|1849036_1849981_+	ABC transporter permease	NA	NA	NA	NA
AZW93012.1\|1849998_1850829_+	ABC transporter permease	NA	NA	NA	NA
AZW93013.1\|1850821_1852456_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.2e-18	32.7
AZW93014.1\|1852452_1853808_+	amidase	NA	NA	NA	NA
AZW93015.1\|1854714_1856292_+	lipoprotein	NA	NA	NA	NA
AZW93016.1\|1856295_1857570_+	hypothetical protein	NA	NA	NA	NA
AZW94957.1\|1857667_1858042_+	hypothetical protein	NA	NA	NA	NA
AZW93017.1\|1859757_1860891_+	general secretion pathway protein	NA	NA	NA	NA
AZW93018.1\|1860928_1861534_+	prepilin-type cleavage/methylation domain-containing protein	NA	NA	NA	NA
AZW93019.1\|1861530_1862349_+	hypothetical protein	NA	NA	NA	NA
AZW93020.1\|1862420_1865045_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.7e-81	39.4
AZW93021.1\|1865031_1865286_+	sulfurtransferase TusA family protein	NA	NA	NA	NA
AZW93022.1\|1865352_1865934_-	hypothetical protein	NA	NA	NA	NA
AZW93023.1\|1866237_1866498_+	30S ribosomal protein S16	NA	NA	NA	NA
AZW93024.1\|1866663_1867287_+	ribosome maturation factor RimM	NA	NA	NA	NA
AZW93025.1\|1867286_1868060_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
AZW93026.1\|1868056_1869265_-	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
AZW93027.1\|1869290_1869764_-	RidA family protein	NA	NA	NA	NA
AZW93028.1\|1869837_1870788_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93029.1\|1870886_1871837_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93030.1\|1871935_1873285_-	two-component sensor histidine kinase	NA	NA	NA	NA
AZW93031.1\|1874050_1874806_+	MipA/OmpV family protein	NA	NA	NA	NA
AZW93032.1\|1874898_1877781_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	3.7e-138	37.1
AZW93033.1\|1878103_1878529_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	2.1e-21	43.2
AZW93034.1\|1878556_1879705_+	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
AZW93035.1\|1879701_1880208_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZW93036.1\|1880214_1881510_+	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin)	NA	NA	NA	NA
AZW93037.1\|1881550_1882855_+\|tRNA	histidine--tRNA ligase	NA	NA	NA	NA
AZW93038.1\|1882856_1883495_+	hypothetical protein	NA	NA	NA	NA
AZW93039.1\|1883497_1884658_+	outer membrane protein assembly factor BamB	NA	NA	NA	NA
AZW93040.1\|1884684_1886040_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
AZW93041.1\|1886043_1887114_+	histidinol-phosphate aminotransferase 1	A0A1X6WGT4	Pacmanvirus	2.5e-15	25.7
AZW93042.1\|1887252_1887489_+	RNA-binding protein Hfq	NA	NA	NA	NA
AZW93043.1\|1887576_1888683_+	GTPase HflX	NA	NA	NA	NA
AZW93044.1\|1888648_1889953_+\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
AZW93045.1\|1889971_1890871_+\|protease	protease modulator HflC	NA	NA	NA	NA

DBSCAN-SWA_15

1901111 : 1944385

Staphylococcus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93053.1\|1901111_1902062_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93054.1\|1902160_1903111_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93055.1\|1903097_1903298_-	hypothetical protein	NA	NA	NA	NA
AZW93056.1\|1903310_1904396_+	AI-2E family transporter	NA	NA	NA	NA
AZW93057.1\|1904411_1905173_-	ABC transporter permease	NA	NA	NA	NA
AZW93058.1\|1905169_1906093_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-23	33.6
AZW93059.1\|1906191_1906716_-	N-acetyltransferase	NA	NA	NA	NA
AZW93060.1\|1906724_1907468_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
AZW93061.1\|1907563_1907803_-	hypothetical protein	NA	NA	NA	NA
AZW93062.1\|1907816_1907969_-	lipoprotein	NA	NA	NA	NA
AZW93063.1\|1908054_1909545_-	cytochrome c oxidase accessory protein CcoG	NA	NA	NA	NA
AZW93064.1\|1909636_1910575_-	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
AZW93065.1\|1910571_1910748_-	CcoQ/FixQ family Cbb3-type cytochrome c oxidase assembly chaperone	NA	NA	NA	NA
AZW93066.1\|1910750_1911413_-	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
AZW94959.1\|1913034_1913178_-	cbb3-type cytochrome oxidase assembly protein CcoS	NA	NA	NA	NA
AZW93067.1\|1913174_1914149_-	hypothetical protein	NA	NA	NA	NA
AZW93068.1\|1914315_1915266_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93069.1\|1915262_1916537_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	9.6e-14	28.9
AZW93070.1\|1916634_1917834_+	8-amino-7-oxononanoate synthase	NA	NA	NA	NA
AZW93071.1\|1917830_1918484_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW93072.1\|1918480_1919917_+	dethiobiotin synthase	NA	NA	NA	NA
AZW93073.1\|1919904_1920264_+	CidA/LrgA family protein	NA	NA	NA	NA
AZW93074.1\|1921236_1922187_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93075.1\|1922183_1924049_-	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
AZW94960.1\|1924306_1925827_+	aldehyde dehydrogenase	NA	NA	NA	NA
AZW93076.1\|1925914_1926565_-	flavodoxin family protein	NA	NA	NA	NA
AZW93077.1\|1927513_1928809_+	DUF445 domain-containing protein	NA	NA	NA	NA
AZW93078.1\|1928830_1929715_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW94961.1\|1929813_1930689_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
AZW93079.1\|1930678_1931035_-	DUF1428 domain-containing protein	NA	NA	NA	NA
AZW93080.1\|1931108_1932140_+	AraC family transcriptional regulator	NA	NA	NA	NA
AZW93081.1\|1932269_1932449_-	DUF3008 domain-containing protein	NA	NA	NA	NA
AZW93082.1\|1932546_1933071_+	DUF302 domain-containing protein	NA	NA	NA	NA
AZW93083.1\|1933081_1933918_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW93084.1\|1934030_1934402_+	transcriptional regulator	NA	NA	NA	NA
AZW93085.1\|1934398_1934950_+	ATPase	NA	NA	NA	NA
AZW93086.1\|1934965_1936657_-	sodium-independent anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	5.0e-42	27.3
AZW93087.1\|1936705_1937386_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW93088.1\|1937633_1938098_-	hypothetical protein	NA	NA	NA	NA
AZW93089.1\|1938267_1939197_+	ZIP family metal transporter	NA	NA	NA	NA
AZW93090.1\|1939209_1939857_-	hypothetical protein	NA	NA	NA	NA
AZW93091.1\|1939930_1941748_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.3e-37	27.4
AZW93092.1\|1941831_1942782_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93093.1\|1943434_1944385_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1957591 : 1996120

Erysipelothrix_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94963.1\|1957591_1958608_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW93105.1\|1958750_1960103_-	glutathione-disulfide reductase	A0A2K5B2C5	Erysipelothrix_phage	2.9e-45	27.6
AZW93106.1\|1960277_1960574_+	hypothetical protein	NA	NA	NA	NA
AZW93107.1\|1961711_1962662_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93108.1\|1962760_1963711_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93109.1\|1964196_1964373_-	hypothetical protein	NA	NA	NA	NA
AZW93110.1\|1964344_1964983_+	hypothetical protein	NA	NA	NA	NA
AZW93111.1\|1965057_1966029_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93112.1\|1966032_1966887_+	polysaccharide deacetylase	NA	NA	NA	NA
AZW93113.1\|1966905_1967727_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW93114.1\|1967758_1968553_+	amidase	NA	NA	NA	NA
AZW93115.1\|1968601_1969207_+	hypothetical protein	NA	NA	NA	NA
AZW94964.1\|1969203_1969998_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW93116.1\|1970283_1971789_-	microcystin degradation protein MlrC	NA	NA	NA	NA
AZW93117.1\|1971830_1972613_-	exodeoxyribonuclease III	NA	NA	NA	NA
AZW93118.1\|1972682_1973129_-	hypothetical protein	NA	NA	NA	NA
AZW93119.1\|1973125_1974352_-	NnrS family protein	NA	NA	NA	NA
AZW93120.1\|1974344_1974749_-	preprotein translocase subunit TatC	NA	NA	NA	NA
AZW93121.1\|1974908_1975211_+	SelT/SelW/SelH family protein	NA	NA	NA	NA
AZW93122.1\|1975207_1976158_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93123.1\|1976144_1976336_-	hypothetical protein	NA	NA	NA	NA
AZW93124.1\|1976379_1977330_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93125.1\|1977428_1978394_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93126.1\|1978531_1979431_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93127.1\|1982025_1983513_+	hypothetical protein	NA	NA	NA	NA
AZW93128.1\|1983523_1984720_+	acetyl-CoA acetyltransferase	NA	NA	NA	NA
AZW93129.1\|1984792_1986112_+	phenylacetate--CoA ligase family protein	NA	NA	NA	NA
AZW93130.1\|1986108_1986984_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW93131.1\|1987014_1988184_-	CoA transferase	NA	NA	NA	NA
AZW93132.1\|1988180_1988495_-	ferredoxin	NA	NA	NA	NA
AZW93133.1\|1988516_1989239_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW93134.1\|1989238_1990057_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW93135.1\|1990061_1990589_-	ring-hydroxylating dioxygenase subunit beta	NA	NA	NA	NA
AZW93136.1\|1990594_1991860_-	ring-hydroxylating oxygenase subunit alpha	NA	NA	NA	NA
AZW93137.1\|1992209_1993349_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93138.1\|1993426_1994299_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW93139.1\|1995169_1996120_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2132731 : 2196820

Lake_Baikal_phage(18.18%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93244.1\|2132731_2134000_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93245.1\|2134570_2134783_-	hypothetical protein	NA	NA	NA	NA
AZW93246.1\|2134800_2135532_-	hypothetical protein	NA	NA	NA	NA
AZW93247.1\|2135566_2136208_-	CoA transferase subunit B	NA	NA	NA	NA
AZW93248.1\|2136200_2136917_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW93249.1\|2139081_2139858_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW93250.1\|2139879_2141037_-	thiolase	NA	NA	NA	NA
AZW93251.1\|2141033_2141465_-	hypothetical protein	NA	NA	NA	NA
AZW93252.1\|2141461_2142265_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW93253.1\|2142278_2142734_-	MaoC family dehydratase	NA	NA	NA	NA
AZW93254.1\|2142746_2143718_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93255.1\|2143783_2145007_-	CoA transferase	NA	NA	NA	NA
AZW93256.1\|2145234_2146185_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93257.1\|2146308_2148762_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZW93258.1\|2148950_2150255_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZW93259.1\|2150359_2151013_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZW93260.1\|2151015_2152326_-	trigger factor	NA	NA	NA	NA
AZW93261.1\|2152504_2153083_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZW93262.1\|2153194_2153395_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZW93263.1\|2153740_2154307_-	DUF924 domain-containing protein	NA	NA	NA	NA
AZW93264.1\|2154390_2154594_-	cold-shock protein CspA	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZW93265.1\|2154900_2155221_-	hypothetical protein	NA	NA	NA	NA
AZW93266.1\|2155262_2155544_-	hypothetical protein	NA	NA	NA	NA
AZW93267.1\|2155618_2156875_-	autotransporter Phg	NA	NA	NA	NA
AZW93268.1\|2157257_2157587_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW93269.1\|2159156_2159978_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZW93270.1\|2159977_2161117_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZW93271.1\|2161123_2162020_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZW93272.1\|2162016_2163942_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZW93273.1\|2164301_2166914_+	TonB-dependent receptor	NA	NA	NA	NA
AZW93274.1\|2166966_2169267_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZW93275.1\|2169263_2170472_-	acyl-CoA desaturase	NA	NA	NA	NA
AZW93276.1\|2170733_2171108_+	hypothetical protein	NA	NA	NA	NA
AZW93277.1\|2171104_2172055_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94971.1\|2172153_2174148_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.4e-21	33.3
AZW93278.1\|2174207_2175173_+	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
AZW93279.1\|2175162_2178024_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
AZW93280.1\|2178026_2178533_+	lipoprotein signal peptidase	NA	NA	NA	NA
AZW93281.1\|2178637_2179846_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
AZW93282.1\|2179847_2180786_-	hypothetical protein	NA	NA	NA	NA
AZW93283.1\|2180947_2181421_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW93284.1\|2181417_2182368_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93285.1\|2182354_2182534_-	hypothetical protein	NA	NA	NA	NA
AZW93286.1\|2182478_2182919_-	DUF937 domain-containing protein	NA	NA	NA	NA
AZW93287.1\|2183047_2184277_-	lytic murein transglycosylase	NA	NA	NA	NA
AZW93288.1\|2184315_2185137_-	DUF455 domain-containing protein	NA	NA	NA	NA
AZW93289.1\|2185190_2186342_+	N-acetyltransferase	NA	NA	NA	NA
AZW93290.1\|2186433_2186922_-	DUF1854 domain-containing protein	NA	NA	NA	NA
AZW93291.1\|2189448_2192022_+	cyanophycin synthetase	NA	NA	NA	NA
AZW93292.1\|2192092_2194666_+	cyanophycin synthetase	NA	NA	NA	NA
AZW93293.1\|2194931_2195132_+	CsbD family protein	NA	NA	NA	NA
AZW93294.1\|2195163_2195325_+	DUF1328 domain-containing protein	NA	NA	NA	NA
AZW93295.1\|2195382_2195721_+	phospholipid-binding protein	NA	NA	NA	NA
AZW93296.1\|2195869_2196820_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2212790 : 2231530

Moraxella_phage(40.0%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94975.1\|2212790_2213807_+\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW93311.1\|2213904_2214945_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.1e-91	51.3
AZW93312.1\|2215079_2216372_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.7e-66	36.0
AZW93313.1\|2217731_2218115_+	thioredoxin	V9SJ74	Achromobacter_phage	8.1e-09	25.8
AZW93314.1\|2218132_2218720_-	DUF1949 domain-containing protein	A0A1X9I5T8	Streptococcus_phage	4.7e-16	35.8
AZW93315.1\|2218757_2219708_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93316.1\|2219806_2220757_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93317.1\|2220855_2221416_-	diaminobutyrate acetyltransferase	NA	NA	NA	NA
AZW93318.1\|2221412_2221958_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW93319.1\|2222153_2223182_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AZW93320.1\|2223222_2224563_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-18	22.8
AZW93321.1\|2224671_2225676_+	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93322.1\|2225782_2228383_+	DUF3394 domain-containing protein	NA	NA	NA	NA
AZW93323.1\|2228481_2229432_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93324.1\|2229530_2230481_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93325.1\|2230579_2231530_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2578633 : 2645133

uncultured_Caudovirales_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93619.1\|2578633_2579584_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93620.1\|2579953_2580526_+	flagellar basal body-associated protein FliL	NA	NA	NA	NA
AZW93621.1\|2580528_2581539_+	flagellar motor switch protein FliM	NA	NA	NA	NA
AZW93622.1\|2581531_2582032_+	flagellar motor switch protein FliN	NA	NA	NA	NA
AZW93623.1\|2582042_2582384_+	flagellar biosynthetic protein FliO	NA	NA	NA	NA
AZW93624.1\|2582395_2583187_+	flagellar biosynthetic protein FliP	NA	NA	NA	NA
AZW93625.1\|2583203_2583473_+	flagellar biosynthetic protein FliQ	NA	NA	NA	NA
AZW93626.1\|2583495_2584284_+	flagellar biosynthetic protein FliR	NA	NA	NA	NA
AZW94991.1\|2584330_2585347_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW93627.1\|2585563_2587006_-	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	1.0e-35	41.8
AZW93628.1\|2587184_2588804_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	45.3
AZW93629.1\|2588924_2590745_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-11	52.6
AZW93630.1\|2590823_2592356_-	flagellar hook-associated protein 3	NA	NA	NA	NA
AZW93631.1\|2592389_2594036_-	flagellar hook-associated protein FlgK	NA	NA	NA	NA
AZW93632.1\|2594105_2595128_-	flagellar assembly peptidoglycan hydrolase FlgJ	A0A088F6W1	Sulfitobacter_phage	1.9e-12	31.4
AZW93633.1\|2595145_2596279_-	flagellar biosynthesis protein FlgI	NA	NA	NA	NA
AZW93634.1\|2596281_2596971_-	flagellar L-ring protein	NA	NA	NA	NA
AZW93635.1\|2596970_2597756_-	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
AZW93636.1\|2597799_2598564_-	flagellar basal body rod protein FlgF	NA	NA	NA	NA
AZW93637.1\|2598602_2600024_-	flagellar hook protein FlgE	NA	NA	NA	NA
AZW93638.1\|2600089_2600794_-	flagellar basal body rod modification protein	NA	NA	NA	NA
AZW93639.1\|2600841_2601261_-	flagellar basal body rod protein FlgC	NA	NA	NA	NA
AZW93640.1\|2601273_2601681_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
AZW94992.1\|2601864_2602575_+	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
AZW93641.1\|2602701_2602992_+	flagellar biosynthesis anti-sigma factor FlgM	NA	NA	NA	NA
AZW93642.1\|2603009_2603492_+	flagellar protein FlgN	NA	NA	NA	NA
AZW93643.1\|2607997_2609152_-	flagellar type III secretion system protein FlhB	NA	NA	NA	NA
AZW94993.1\|2609457_2610474_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW93644.1\|2610720_2611509_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93645.1\|2611575_2612256_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW93646.1\|2612252_2613023_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-30	39.1
AZW93647.1\|2613121_2614072_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93648.1\|2614127_2615045_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
AZW93649.1\|2615055_2616234_-	mandelate racemase	NA	NA	NA	NA
AZW93650.1\|2616253_2617249_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93651.1\|2618837_2619446_+	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
AZW93652.1\|2619433_2620474_+	LacI family transcriptional regulator	NA	NA	NA	NA
AZW93653.1\|2620491_2621454_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93654.1\|2621450_2622644_-	CoA transferase	NA	NA	NA	NA
AZW93655.1\|2622640_2623438_-	citryl-CoA lyase	NA	NA	NA	NA
AZW93656.1\|2623463_2624450_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93657.1\|2624468_2626508_-	acetyl-CoA synthetase	NA	NA	NA	NA
AZW94994.1\|2626709_2627390_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW93658.1\|2627403_2628315_-	CoA ester lyase	NA	NA	NA	NA
AZW93659.1\|2628311_2628890_-	NADPH-dependent oxidoreductase	NA	NA	NA	NA
AZW93660.1\|2629028_2629934_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93661.1\|2629941_2633361_+	nuclease	NA	NA	NA	NA
AZW93662.1\|2633348_2635949_-	BP1344/BB2830 family autotransporter	NA	NA	NA	NA
AZW93663.1\|2636904_2637537_-	PadR family transcriptional regulator	NA	NA	NA	NA
AZW93664.1\|2637930_2638689_+	hypothetical protein	NA	NA	NA	NA
AZW93665.1\|2638685_2639888_+	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW93666.1\|2640075_2641026_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93667.1\|2641933_2643079_+	DUF3182 domain-containing protein	NA	NA	NA	NA
AZW94995.1\|2643098_2643821_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW93668.1\|2643937_2644117_+	hypothetical protein	NA	NA	NA	NA
AZW93669.1\|2644182_2645133_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2673248 : 2710660

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93684.1\|2673248_2674199_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93685.1\|2674297_2675248_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93686.1\|2675340_2675880_+	peroxiredoxin	NA	NA	NA	NA
AZW93687.1\|2675986_2676331_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
AZW93688.1\|2676388_2677837_-	CoA transferase	NA	NA	NA	NA
AZW93689.1\|2678024_2678360_-	tetratricopeptide repeat protein	NA	NA	NA	NA
AZW93690.1\|2679987_2681166_+	DUF1501 domain-containing protein	NA	NA	NA	NA
AZW93691.1\|2681248_2681749_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
AZW93692.1\|2681774_2682560_+	thiol:disulfide oxidoreductase	NA	NA	NA	NA
AZW93693.1\|2682571_2683036_+	N-acetyltransferase	NA	NA	NA	NA
AZW93694.1\|2683032_2683326_+	biotin--protein ligase	NA	NA	NA	NA
AZW93695.1\|2683322_2684099_+	lipoate--protein ligase family protein	NA	NA	NA	NA
AZW93696.1\|2684127_2684955_+	DUF3298 domain-containing protein	NA	NA	NA	NA
AZW93697.1\|2685080_2685551_+	hypothetical protein	NA	NA	NA	NA
AZW93698.1\|2685677_2686571_+	phosphatidylserine decarboxylase proenzyme	NA	NA	NA	NA
AZW93699.1\|2686618_2687800_+	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AZW93700.1\|2687812_2688628_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93701.1\|2688761_2689289_-	RES domain-containing protein	NA	NA	NA	NA
AZW94998.1\|2689285_2689783_-	DUF2384 domain-containing protein	NA	NA	NA	NA
AZW93702.1\|2689930_2690308_+	DUF423 domain-containing protein	NA	NA	NA	NA
AZW93703.1\|2690529_2691480_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94999.1\|2691578_2692190_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW93704.1\|2692424_2693552_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93705.1\|2693662_2694751_-	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
AZW93706.1\|2694803_2695655_-	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
AZW93707.1\|2695674_2696556_-	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
AZW95000.1\|2696732_2698046_-	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AZW93708.1\|2698256_2699090_+	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AZW93709.1\|2699086_2699668_+	hypothetical protein	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
AZW93710.1\|2700021_2700972_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93711.1\|2700987_2702103_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93712.1\|2702205_2703132_+	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
AZW93713.1\|2703131_2704370_+	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
AZW93714.1\|2704366_2705134_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
AZW93715.1\|2705134_2705836_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
AZW95001.1\|2705917_2706364_-	glutamate racemase	NA	NA	NA	NA
AZW93716.1\|2707253_2707892_+	glutathione S-transferase	NA	NA	NA	NA
AZW93717.1\|2708660_2709611_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93718.1\|2709709_2710660_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2816121 : 2873279

Diachasmimorpha_longicaudata_entomopoxvirus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93807.1\|2816121_2817072_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW95008.1\|2818233_2818740_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AZW93808.1\|2818736_2819501_-	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AZW93809.1\|2819516_2819801_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AZW93810.1\|2819865_2820855_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AZW93811.1\|2821026_2821956_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AZW93812.1\|2821927_2822614_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AZW93813.1\|2822647_2823193_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AZW93814.1\|2823237_2824503_+	peptidase M48	NA	NA	NA	NA
AZW93815.1\|2824499_2825402_+	ribosome biogenesis GTPase	NA	NA	NA	NA
AZW93816.1\|2826583_2827528_-	ABC transporter permease	NA	NA	NA	NA
AZW93817.1\|2827622_2829140_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93818.1\|2829181_2830810_-	gamma-glutamyltransferase	NA	NA	NA	NA
AZW93819.1\|2830917_2831799_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93820.1\|2834911_2835286_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AZW93821.1\|2835310_2835649_-	P-II family nitrogen regulator	NA	NA	NA	NA
AZW93822.1\|2835692_2837327_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AZW93823.1\|2837365_2838712_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AZW95009.1\|2838819_2840241_+	argininosuccinate lyase	NA	NA	NA	NA
AZW93824.1\|2840310_2840895_-	nitroreductase	NA	NA	NA	NA
AZW93825.1\|2840997_2841948_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93826.1\|2842082_2843189_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93827.1\|2843199_2844297_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
AZW93828.1\|2844441_2845647_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZW93829.1\|2845653_2846175_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AZW93830.1\|2846171_2846663_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AZW93831.1\|2846659_2846911_-	MoaD/ThiS family protein	NA	NA	NA	NA
AZW93832.1\|2846891_2847377_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
AZW93833.1\|2847512_2850974_+	hypothetical protein	NA	NA	NA	NA
AZW93834.1\|2850970_2851876_+	dienelactone hydrolase family protein	NA	NA	NA	NA
AZW93835.1\|2851885_2852317_-	lipoprotein	NA	NA	NA	NA
AZW95010.1\|2852563_2853067_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AZW93836.1\|2853078_2854545_+	MFS transporter	NA	NA	NA	NA
AZW93837.1\|2854619_2855495_-	hypothetical protein	NA	NA	NA	NA
AZW95011.1\|2855491_2856499_-	biotin synthase	NA	NA	NA	NA
AZW93838.1\|2856966_2857272_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW93839.1\|2857362_2857953_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW95012.1\|2858143_2859160_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW93840.1\|2859351_2861688_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.2e-124	42.8
AZW93841.1\|2861770_2862205_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
AZW93842.1\|2862303_2863254_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93843.1\|2863352_2864303_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93844.1\|2864299_2865094_-	N-formylglutamate deformylase	NA	NA	NA	NA
AZW93845.1\|2865125_2865830_-	oxidoreductase	NA	NA	NA	NA
AZW93846.1\|2865904_2866705_-	SURF1 family protein	NA	NA	NA	NA
AZW93847.1\|2866701_2867109_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AZW93848.1\|2867105_2867747_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AZW93849.1\|2867739_2869761_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW93850.1\|2871000_2872332_+	MFS transporter	NA	NA	NA	NA
AZW93851.1\|2872328_2873279_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2906516 : 2972394

uncultured_Mediterranean_phage(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93867.1\|2906516_2906831_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AZW93868.1\|2907058_2907304_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AZW93869.1\|2907398_2907917_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
AZW93870.1\|2908016_2909222_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AZW93871.1\|2909337_2910735_-	chloride channel protein EriC	NA	NA	NA	NA
AZW93872.1\|2910851_2911430_-	superoxide dismutase [Fe]	NA	NA	NA	NA
AZW93873.1\|2911502_2912894_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AZW93874.1\|2913061_2914012_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93875.1\|2914292_2914913_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AZW93876.1\|2914909_2915323_+	biopolymer transporter ExbD	NA	NA	NA	NA
AZW93877.1\|2915319_2916363_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZW93878.1\|2916418_2916607_+	hypothetical protein	NA	NA	NA	NA
AZW93879.1\|2916616_2917381_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZW93880.1\|2917471_2918128_+	adenylate kinase	NA	NA	NA	NA
AZW93881.1\|2918219_2918978_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW93882.1\|2919003_2920605_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZW93883.1\|2920805_2921810_+	DUF4880 domain-containing protein	NA	NA	NA	NA
AZW93884.1\|2921910_2922174_+	30S ribosomal protein S20	NA	NA	NA	NA
AZW93885.1\|2922291_2923068_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZW93886.1\|2926991_2928104_-	malate dehydrogenase	NA	NA	NA	NA
AZW93887.1\|2928160_2929111_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93888.1\|2929319_2929541_-	YgdI/YgdR family lipoprotein	NA	NA	NA	NA
AZW93889.1\|2929754_2931161_-	threonine synthase	NA	NA	NA	NA
AZW93890.1\|2931157_2932462_-	homoserine dehydrogenase	NA	NA	NA	NA
AZW93891.1\|2932458_2933766_-	alanine transaminase	NA	NA	NA	NA
AZW93892.1\|2933862_2934315_+	hypothetical protein	NA	NA	NA	NA
AZW93893.1\|2934317_2934782_+	peroxiredoxin	NA	NA	NA	NA
AZW93894.1\|2934861_2936541_+	PhoH family protein	A0A2I7SAD7	Vibrio_phage	7.3e-70	36.7
AZW93895.1\|2936645_2937623_+	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
AZW93896.1\|2937702_2938671_+	bile acid:sodium symporter	NA	NA	NA	NA
AZW93897.1\|2938691_2940065_-	replicative DNA helicase	C7BGG1	Burkholderia_phage	4.0e-135	58.2
AZW93898.1\|2940061_2940898_-	hypothetical protein	NA	NA	NA	NA
AZW93899.1\|2941014_2941470_-	50S ribosomal protein L9	NA	NA	NA	NA
AZW93900.1\|2941485_2941758_-	30S ribosomal protein S18	NA	NA	NA	NA
AZW93901.1\|2941850_2942174_-	primosomal replication protein N	NA	NA	NA	NA
AZW93902.1\|2942221_2942602_-	30S ribosomal protein S6	NA	NA	NA	NA
AZW93903.1\|2942821_2943619_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
AZW93904.1\|2943775_2945638_-	1-deoxy-D-xylulose-5-phosphate synthase	NA	NA	NA	NA
AZW93905.1\|2945687_2946599_-	polyprenyl synthetase family protein	NA	NA	NA	NA
AZW93906.1\|2946603_2946870_-	exodeoxyribonuclease 7 small subunit	NA	NA	NA	NA
AZW95014.1\|2946956_2947787_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW93907.1\|2947961_2948927_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93908.1\|2949097_2950108_+	hypothetical protein	A0A0F6TJ51	Escherichia_coli_O157_typing_phage	3.6e-16	24.6
AZW93909.1\|2950114_2951407_+	aromatic ring-hydroxylating dioxygenase subunit alpha	NA	NA	NA	NA
AZW93910.1\|2952549_2954022_-	magnesium transporter	NA	NA	NA	NA
AZW93911.1\|2954032_2954443_-	acyl-CoA thioesterase	NA	NA	NA	NA
AZW93912.1\|2954506_2955553_-	YeiH family putative sulfate export transporter	NA	NA	NA	NA
AZW93913.1\|2955659_2956538_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93914.1\|2956551_2957748_-	amidohydrolase	NA	NA	NA	NA
AZW93915.1\|2957809_2959501_+	long-chain fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	9.4e-33	28.1
AZW93916.1\|2959497_2960448_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93917.1\|2960434_2960680_-	hypothetical protein	NA	NA	NA	NA
AZW93918.1\|2960568_2961465_-	inositol monophosphatase	NA	NA	NA	NA
AZW93919.1\|2963742_2965968_+	glycosyl hydrolase	NA	NA	NA	NA
AZW93920.1\|2966132_2967221_+	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZW93921.1\|2967177_2967831_+	ABC transporter permease	NA	NA	NA	NA
AZW93922.1\|2967878_2968676_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93923.1\|2969207_2970158_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93924.1\|2970238_2971387_+	alcohol dehydrogenase	NA	NA	NA	NA
AZW93925.1\|2971443_2972394_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

2982169 : 3034774

Ostreococcus_lucimarinus_virus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW93936.1\|2982169_2983408_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93937.1\|2983449_2984712_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW93938.1\|2984718_2985471_+	DNA-binding protein	NA	NA	NA	NA
AZW93939.1\|2985522_2985708_-	hypothetical protein	NA	NA	NA	NA
AZW95017.1\|2985983_2986448_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AZW93940.1\|2986479_2987139_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AZW93941.1\|2987283_2989392_+	AsmA family protein	NA	NA	NA	NA
AZW93942.1\|2989388_2990339_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93943.1\|2990442_2991063_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW95018.1\|2991166_2991907_+	oxidoreductase	NA	NA	NA	NA
AZW93944.1\|2993041_2994166_-	hypothetical protein	NA	NA	NA	NA
AZW93945.1\|2994211_2994580_-	hypothetical protein	NA	NA	NA	NA
AZW93946.1\|2994821_2995772_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93947.1\|2996807_2997350_-	hypothetical protein	NA	NA	NA	NA
AZW93948.1\|2997554_2997749_+	hypothetical protein	NA	NA	NA	NA
AZW93949.1\|2997735_2998686_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93950.1\|2998682_2999648_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93951.1\|2999717_3000554_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.6e-33	33.3
AZW93952.1\|3001030_3002176_+	porin	NA	NA	NA	NA
AZW93953.1\|3002237_3003188_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93954.1\|3003380_3004163_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW95019.1\|3004176_3004926_-	NAD(P)-dependent oxidoreductase	A0A0M4JSW6	Mollivirus	1.2e-11	26.4
AZW95020.1\|3004953_3006300_-	MFS transporter	NA	NA	NA	NA
AZW93955.1\|3006325_3007255_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW93956.1\|3007370_3008276_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93957.1\|3008293_3009493_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW93958.1\|3009565_3010258_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	4.7e-07	29.9
AZW95021.1\|3010306_3012796_-	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.3e-86	33.8
AZW93959.1\|3013943_3014312_-	DUF861 domain-containing protein	NA	NA	NA	NA
AZW93960.1\|3014598_3015525_+	VOC family protein	NA	NA	NA	NA
AZW93961.1\|3015568_3016579_+	alcohol dehydrogenase	NA	NA	NA	NA
AZW93962.1\|3016575_3017010_+	PaaI family thioesterase	NA	NA	NA	NA
AZW93963.1\|3018135_3018924_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-33	40.0
AZW93964.1\|3018933_3019716_+	ABC transporter permease	NA	NA	NA	NA
AZW93965.1\|3019719_3020811_-	DUF2817 domain-containing protein	NA	NA	NA	NA
AZW93966.1\|3020916_3022392_+	long-chain fatty acid--CoA ligase	Q75ZG1	Hepacivirus	3.0e-35	25.6
AZW93967.1\|3022533_3023082_+	cysteine dioxygenase	NA	NA	NA	NA
AZW93968.1\|3023097_3023559_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW93969.1\|3023659_3024649_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW93970.1\|3024947_3025649_+	riboflavin synthase	NA	NA	NA	NA
AZW93971.1\|3025687_3027061_-	amidase	NA	NA	NA	NA
AZW93972.1\|3027099_3028386_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW93973.1\|3029272_3030175_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93974.1\|3030122_3031343_-	MFS transporter	NA	NA	NA	NA
AZW93975.1\|3031339_3031849_-	nucleoside deaminase	NA	NA	NA	NA
AZW93976.1\|3031838_3032534_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
AZW93977.1\|3032604_3033474_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW93978.1\|3033823_3034774_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3236701 : 3271539

Erwinia_phage(20.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94134.1\|3236701_3237652_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94135.1\|3238096_3238408_-	cell division protein ZapA	NA	NA	NA	NA
AZW94136.1\|3238407_3238938_-	hypothetical protein	NA	NA	NA	NA
AZW94137.1\|3239100_3240051_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94138.1\|3240340_3240805_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AZW94139.1\|3240819_3242325_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
AZW94140.1\|3242578_3244186_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW94141.1\|3244241_3245147_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW94142.1\|3245587_3246538_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94143.1\|3246636_3247587_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94144.1\|3247668_3248250_-	ATP:cob(I)alamin adenosyltransferase	NA	NA	NA	NA
AZW95036.1\|3248674_3248980_+	RND transporter	NA	NA	NA	NA
AZW94145.1\|3248993_3250328_-	HslU--HslV peptidase ATPase subunit	A0A191ZC11	Erwinia_phage	3.5e-43	29.6
AZW94146.1\|3250349_3250889_-	HslU--HslV peptidase proteolytic subunit	NA	NA	NA	NA
AZW94147.1\|3251036_3251501_-	RNA polymerase-binding protein DksA	NA	NA	NA	NA
AZW94148.1\|3251643_3252759_-	GTP-binding protein	NA	NA	NA	NA
AZW94149.1\|3253035_3253539_-	transcriptional repressor	NA	NA	NA	NA
AZW94150.1\|3253676_3253877_+	hypothetical protein	NA	NA	NA	NA
AZW94151.1\|3253867_3254590_+	metal ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.1e-11	30.0
AZW94152.1\|3254586_3255483_+	metal ABC transporter permease	NA	NA	NA	NA
AZW94153.1\|3255479_3256415_+	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW95037.1\|3256420_3257044_+	DUF1007 domain-containing protein	NA	NA	NA	NA
AZW94154.1\|3257034_3258003_+	nickel transporter	NA	NA	NA	NA
AZW94155.1\|3258051_3260193_+	TonB-dependent receptor	NA	NA	NA	NA
AZW94156.1\|3260205_3261186_-	tyrosine recombinase XerC	A0A166YH27	Gordonia_phage	3.3e-14	30.5
AZW94157.1\|3261200_3261893_-	DUF484 domain-containing protein	NA	NA	NA	NA
AZW94158.1\|3261919_3262831_-	diaminopimelate epimerase	NA	NA	NA	NA
AZW94159.1\|3262873_3263764_-	acyltransferase	NA	NA	NA	NA
AZW94160.1\|3263760_3264615_-	lipid A biosynthesis lauroyl acyltransferase	NA	NA	NA	NA
AZW94161.1\|3264763_3266062_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.6e-125	60.9
AZW94162.1\|3266172_3266424_+	DUF1289 domain-containing protein	NA	NA	NA	NA
AZW94163.1\|3266503_3267544_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
AZW94164.1\|3267823_3269242_+	adenosylhomocysteinase	S4VPF6	Pandoravirus	8.7e-40	29.4
AZW94165.1\|3269312_3269648_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW94166.1\|3269647_3270490_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZW94167.1\|3270588_3271539_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3283368 : 3334246

Planktothrix_phage(33.33%)

integrase,protease,transposase,tRNA

attL 3317042:3317060|attR 3336930:3336948

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94176.1\|3283368_3284319_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW95039.1\|3284631_3286110_+	phospholipase D family protein	NA	NA	NA	NA
AZW94177.1\|3286116_3287226_-	molybdenum import ATP-binding protein ModC	G9BWD6	Planktothrix_phage	7.5e-23	34.5
AZW94178.1\|3287237_3287918_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AZW94179.1\|3287939_3288695_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW95040.1\|3288830_3289715_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW94180.1\|3289802_3290384_+	hypothetical protein	NA	NA	NA	NA
AZW94181.1\|3290476_3290599_-	hypothetical protein	NA	NA	NA	NA
AZW94182.1\|3290644_3290944_-	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW95041.1\|3291095_3291521_-	hypothetical protein	NA	NA	NA	NA
AZW94183.1\|3293727_3294231_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW94184.1\|3294246_3295197_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94185.1\|3295183_3295381_-	hypothetical protein	NA	NA	NA	NA
AZW94186.1\|3295724_3296498_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW94187.1\|3296630_3297641_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW94188.1\|3297792_3299448_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW94189.1\|3299502_3299844_-	cupin domain-containing protein	NA	NA	NA	NA
AZW94190.1\|3299857_3301297_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW94191.1\|3301429_3302245_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW94192.1\|3302437_3303388_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94193.1\|3304775_3305723_+	hypothetical protein	NA	NA	NA	NA
AZW94194.1\|3305949_3306690_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW94195.1\|3306775_3307726_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94196.1\|3309167_3310739_-	winged helix family transcriptional regulator	NA	NA	NA	NA
AZW94197.1\|3311071_3312925_+	hypothetical protein	NA	NA	NA	NA
AZW94198.1\|3312969_3315534_+	autotransporter outer membrane beta-barrel domain-containing protein	NA	NA	NA	NA
AZW94199.1\|3315952_3316903_+\|transposase	IS481 family transposase	NA	NA	NA	NA
3317042:3317060	attL	NA	NA	NA	NA
AZW94200.1\|3319768_3320263_-	DUF4276 domain-containing protein	NA	NA	NA	NA
AZW94201.1\|3320279_3321230_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94202.1\|3321216_3321417_-	hypothetical protein	NA	NA	NA	NA
AZW94203.1\|3321413_3322625_-	chromosome segregation protein SMC	NA	NA	NA	NA
AZW94204.1\|3322640_3325592_-	restriction endonuclease subunit M	G8I4P9	Mycobacterium_phage	2.9e-21	25.1
AZW94205.1\|3325593_3328713_-	restriction endonuclease	NA	NA	NA	NA
AZW95042.1\|3328709_3328850_-	DEAD/DEAH box helicase	NA	NA	NA	NA
AZW94206.1\|3328860_3329907_-	Fic family protein	NA	NA	NA	NA
AZW94207.1\|3330248_3331376_-\|integrase	site-specific integrase	A0A1B0VMI6	Pseudomonas_phage	1.4e-48	33.6
AZW94208.1\|3331655_3332747_-	redox-regulated ATPase YchF	NA	NA	NA	NA
AZW94209.1\|3332819_3333602_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AZW94210.1\|3333598_3334246_-\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
3336930:3336948	attR	NA	NA	NA	NA

DBSCAN-SWA_26

3383133 : 3436874

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94247.1\|3383133_3384084_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94248.1\|3384488_3385133_-	urease accessory protein UreG	NA	NA	NA	NA
AZW94249.1\|3385157_3385742_-	urease accessory protein UreF	NA	NA	NA	NA
AZW94250.1\|3385842_3386460_-	urease accessory protein UreE	NA	NA	NA	NA
AZW94251.1\|3386462_3388178_-	urease subunit alpha	NA	NA	NA	NA
AZW94252.1\|3388174_3388483_-	urease subunit beta	NA	NA	NA	NA
AZW94253.1\|3388499_3389135_-	urease accessory protein UreJ	NA	NA	NA	NA
AZW94254.1\|3389161_3389464_-	urease subunit gamma	NA	NA	NA	NA
AZW94255.1\|3389564_3390419_-	urease accessory protein UreD	NA	NA	NA	NA
AZW94256.1\|3391000_3391273_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW94257.1\|3391690_3392098_-	GFA family protein	NA	NA	NA	NA
AZW94258.1\|3392467_3393262_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW94259.1\|3393362_3394598_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW94260.1\|3394666_3395683_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW94261.1\|3395679_3397071_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW94262.1\|3397067_3398264_+	MFS transporter	NA	NA	NA	NA
AZW94263.1\|3398260_3399799_-	SpoVR family protein	NA	NA	NA	NA
AZW94264.1\|3399795_3401055_-	hypothetical protein	NA	NA	NA	NA
AZW94265.1\|3402995_3403946_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94266.1\|3404712_3405807_-	CoA transferase	NA	NA	NA	NA
AZW94267.1\|3405799_3407134_-	CoA ligase	NA	NA	NA	NA
AZW94268.1\|3407087_3407771_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW94269.1\|3407796_3408960_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW94270.1\|3408956_3409958_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW94271.1\|3409957_3410830_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW94272.1\|3410826_3411576_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZW94273.1\|3411572_3412364_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZW94274.1\|3412360_3413500_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW94275.1\|3413808_3414561_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW94276.1\|3414594_3415377_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW94277.1\|3415380_3415770_+	DNA-binding protein	NA	NA	NA	NA
AZW94278.1\|3416909_3417773_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZW94279.1\|3417808_3418897_+	hypothetical protein	NA	NA	NA	NA
AZW94280.1\|3418893_3419844_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94281.1\|3419830_3420199_-	hypothetical protein	NA	NA	NA	NA
AZW94282.1\|3420197_3423176_+	hypothetical protein	NA	NA	NA	NA
AZW94283.1\|3424102_3424981_+	fatty acid desaturase	NA	NA	NA	NA
AZW94284.1\|3426929_3427880_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94285.1\|3427876_3428344_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZW94286.1\|3428386_3429157_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW94287.1\|3429177_3429978_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZW94288.1\|3429988_3431398_+	lytic transglycosylase	NA	NA	NA	NA
AZW94289.1\|3431492_3432278_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW95045.1\|3432517_3433534_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW94290.1\|3433641_3434034_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AZW94291.1\|3434171_3434852_+	DUF533 domain-containing protein	NA	NA	NA	NA
AZW94292.1\|3434856_3435855_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW94293.1\|3435923_3436874_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_27

3443029 : 3502327

Acinetobacter_phage(27.27%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94297.1\|3443029_3444793_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AZW94298.1\|3444904_3445783_+	septum site-determining protein MinC	NA	NA	NA	NA
AZW94299.1\|3445895_3446711_+	septum site-determining protein MinD	NA	NA	NA	NA
AZW94300.1\|3446714_3446966_+	cell division topological specificity factor	NA	NA	NA	NA
AZW95046.1\|3447050_3448067_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW94301.1\|3448397_3448619_-	hypothetical protein	NA	NA	NA	NA
AZW94302.1\|3450979_3451897_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW94303.1\|3452394_3453603_-	ABC transporter permease	NA	NA	NA	NA
AZW94304.1\|3453682_3455254_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW94305.1\|3455371_3456307_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZW94306.1\|3456495_3457440_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZW94307.1\|3457508_3457724_-	hypothetical protein	NA	NA	NA	NA
AZW94308.1\|3458007_3463725_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZW94309.1\|3463730_3464858_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZW94310.1\|3464913_3465540_+	aminotransferase	NA	NA	NA	NA
AZW95047.1\|3465811_3466828_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW94311.1\|3466923_3467634_-	oxidoreductase	NA	NA	NA	NA
AZW95048.1\|3467630_3468620_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW94312.1\|3468751_3470347_+	acyl-CoA synthetase	NA	NA	NA	NA
AZW94313.1\|3470349_3471087_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW94314.1\|3471242_3472115_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZW94315.1\|3472383_3473604_+	MFS transporter	NA	NA	NA	NA
AZW94316.1\|3473600_3474260_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW94317.1\|3474331_3474964_+	pyridoxine/pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZW94318.1\|3474993_3475512_+	flavin reductase	NA	NA	NA	NA
AZW94319.1\|3475522_3476632_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW94320.1\|3476678_3477533_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZW94321.1\|3477534_3478437_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW94322.1\|3479659_3480610_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94323.1\|3482364_3483354_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94324.1\|3483529_3484318_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZW94325.1\|3484314_3485346_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZW94326.1\|3485364_3485928_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZW94327.1\|3485983_3487504_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZW94328.1\|3487767_3488472_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW94329.1\|3488479_3489217_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZW94330.1\|3489322_3489697_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZW94331.1\|3489739_3491029_+	hypothetical protein	NA	NA	NA	NA
AZW94332.1\|3491025_3492195_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZW94333.1\|3492191_3493031_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
AZW94334.1\|3493090_3494026_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZW94335.1\|3494038_3494989_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94336.1\|3495087_3496050_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZW94337.1\|3496081_3496441_-	dihydroneopterin aldolase	NA	NA	NA	NA
AZW94338.1\|3496565_3497468_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZW94339.1\|3497469_3499242_-	PDZ domain-containing protein	NA	NA	NA	NA
AZW94340.1\|3499276_3500053_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW94341.1\|3501376_3502327_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

3517265 : 3575338

Planktothrix_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW94353.1\|3517265_3518216_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94354.1\|3518344_3519478_-	peptidase	NA	NA	NA	NA
AZW94355.1\|3519521_3520427_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW94356.1\|3520429_3522130_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
AZW94357.1\|3522126_3523047_-	ABC transporter permease	NA	NA	NA	NA
AZW94358.1\|3523054_3524032_-	ABC transporter permease	NA	NA	NA	NA
AZW94359.1\|3524090_3525125_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZW94360.1\|3527099_3527336_-	hypothetical protein	NA	NA	NA	NA
AZW94361.1\|3527462_3528326_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZW94362.1\|3528414_3529236_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW94363.1\|3529315_3530053_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW94364.1\|3530049_3531042_-	nitronate monooxygenase	NA	NA	NA	NA
AZW94365.1\|3531155_3531818_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW94366.1\|3531862_3533011_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW94367.1\|3535334_3536285_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94368.1\|3536625_3537576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94369.1\|3537674_3538625_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94370.1\|3538921_3539419_+	hypothetical protein	NA	NA	NA	NA
AZW94371.1\|3539461_3541237_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
AZW95051.1\|3541283_3542111_+	copper resistance protein B	NA	NA	NA	NA
AZW94372.1\|3542117_3542852_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW94373.1\|3544021_3544816_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW94374.1\|3545105_3545696_+	cysteine dioxygenase	NA	NA	NA	NA
AZW94375.1\|3545729_3547058_-	amidase	NA	NA	NA	NA
AZW94376.1\|3547132_3548278_-	transporter	NA	NA	NA	NA
AZW94377.1\|3548389_3549388_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94378.1\|3549350_3549785_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AZW94379.1\|3551301_3552186_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW94380.1\|3552182_3553388_-	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW94381.1\|3553384_3554245_-	endonuclease	NA	NA	NA	NA
AZW94382.1\|3554357_3556148_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AZW94383.1\|3556188_3556854_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	6.7e-11	28.4
AZW94384.1\|3556854_3557163_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AZW95052.1\|3557328_3558615_-	hypothetical protein	NA	NA	NA	NA
AZW94385.1\|3560048_3560999_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW94386.1\|3562950_3564165_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AZW94387.1\|3564270_3565260_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AZW94388.1\|3565256_3565865_+	hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AZW94389.1\|3565877_3566507_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZW94390.1\|3566503_3567124_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZW94391.1\|3567155_3567947_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AZW94392.1\|3568789_3569254_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZW94393.1\|3569272_3570199_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZW94394.1\|3570252_3571539_-	cytochrome c	NA	NA	NA	NA
AZW94395.1\|3572469_3573342_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AZW94396.1\|3573338_3574289_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AZW94397.1\|3574387_3575338_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025350

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection