CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP025348	Bordetella pertussis strain J234 chromosome, complete genome	4 crisprs	csa3,cas3,DinG,DEDDh	0	0	28	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP025348_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025348_1

250589-250673

Orphan

Consensus_repeat	Method
GGTGCCTGTCCCCGCGGGGACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025348_1

>merge|CP025348|1|250589-250673|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAGATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAGGGTGCCTGTCCCCGCGGGGACAG

>CP025348|1|1|250589-250673|CRISPRCasFinder
GGTGCCTGTCCCCGCGGGGACAG	ATACCGTCTTGGCCGTCAAGCGTTCATGGCGTATGACAG
GGTGCCTGTCCCCGCGGGGACAG

Protein	Signature genes	Signature genes Name	Protein_function
CP025348.1\|AZW84499.1\|257790_258771_-\|AEC-family-transporter	unknown	unknown	gnl\|CDD\|223751
CP025348.1\|AZW84487.1\|241547_243650_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|129868
CP025348.1\|AZW84490.1\|246523_247879_-\|polynucleotide-adenylyltransferase-PcnB	unknown	unknown	gnl\|CDD\|130997
CP025348.1\|AZW84500.1\|258906_259890_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	unknown	unknown	gnl\|CDD\|270295
CP025348.1\|AZW84496.1\|253597_254236_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182775
CP025348.1\|AZW84502.1\|260960_262715_+\|gamma-glutamyltransferase	unknown	unknown	gnl\|CDD\|223482
CP025348.1\|AZW84484.1\|238114_238525_+\|4-carboxymuconolactone-decarboxylase	unknown	unknown	gnl\|CDD\|131478
CP025348.1\|AZW84488.1\|245060_246017_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025348.1\|AZW84495.1\|251621_253511_-\|DNA-mismatch-repair-protein-MutL	unknown	unknown	gnl\|CDD\|234630
CP025348.1\|AZW84486.1\|240333_241377_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270320
CP025348.1\|AZW84498.1\|256382_257774_+\|class-II-fumarate-hydratase	unknown	unknown	gnl\|CDD\|234779
CP025348.1\|AZW84493.1\|249528_250578_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
CP025348.1\|AZW84489.1\|246035_246527_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	unknown	unknown	gnl\|CDD\|172582
CP025348.1\|AZW84494.1\|250683_251625_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
CP025348.1\|AZW84491.1\|247879_248578_-\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
CP025348.1\|AZW84497.1\|255694_256231_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|223873
CP025348.1\|AZW84485.1\|239546_240290_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP025348.1\|AZW84501.1\|259954_260854_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176107
CP025348.1\|AZW87683.1\|254378_255623_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|182376
CP025348.1\|AZW84492.1\|248574_249276_-\|DnaA-regulatory-inactivator-Hda	unknown	unknown	gnl\|CDD\|236347

Protein	Function_ID	Function_description	E-value
CP025348.1\|AZW84499.1\|257790_258771_-\|AEC-family-transporter	gnl\|CDD\|223751	COG0679, COG0679, Predicted permeases [General function prediction only].	1.13912e-41
CP025348.1\|AZW84487.1\|241547_243650_+\|hypothetical-protein	gnl\|CDD\|129868	TIGR00786, TRAP_transporter_permease_protein_SiaT, TRAP transporter, DctM subunit. The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	2.77055e-96
CP025348.1\|AZW84490.1\|246523_247879_-\|polynucleotide-adenylyltransferase-PcnB	gnl\|CDD\|130997	TIGR01942, pcnB, poly(A) polymerase. This model describes the pcnB family of poly(A) polymerases (also known as plasmid copy number protein). These enzymes sequentially add adenosine nucleotides to the 3' end of RNAs, targeting them for degradation by the cell. This was originally described for anti-sense RNAs, but was later demonstrated for mRNAs as well. Members of this family are as yet limited to the gamma- and beta-proteobacteria, with putative members in the Chlamydiacae and spirochetes. This family has homology to tRNA nucleotidyltransferase (cca).	4.58369e-147
CP025348.1\|AZW84500.1\|258906_259890_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE	gnl\|CDD\|270295	cd13577, PBP2_BugE_Glu, Glutamate transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.35876e-158
CP025348.1\|AZW84496.1\|253597_254236_+\|hypothetical-protein	gnl\|CDD\|182775	PRK10847, PRK10847, DedA family protein.	1.10927e-69
CP025348.1\|AZW84502.1\|260960_262715_+\|gamma-glutamyltransferase	gnl\|CDD\|223482	COG0405, Ggt, Gamma-glutamyltransferase [Amino acid transport and metabolism].	0
CP025348.1\|AZW84484.1\|238114_238525_+\|4-carboxymuconolactone-decarboxylase	gnl\|CDD\|131478	TIGR02425, putative_gamma-carboxymuconolactone_decarboxylase, 4-carboxymuconolactone decarboxylase. Members of this family are 4-carboxymuconolactone decarboxylase, which catalyzes the third step in the catabolism of protocatechuate (and therefore the fourth step in the catabolism of para-hydroxybenzoate, of 3-hydroxybenzoate, of vanillate, etc.). Most members of this family are encoded within protocatechuate catabolism operons. This protein is sometimes found as a fusion protein with other enzymes of the pathway, as in Rhodococcus opacus, Streptomyces avermitilis, and Caulobacter crescentus. [Energy metabolism, Other].	1.36265e-47
CP025348.1\|AZW84488.1\|245060_246017_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	6.01101e-118
CP025348.1\|AZW84495.1\|251621_253511_-\|DNA-mismatch-repair-protein-MutL	gnl\|CDD\|234630	PRK00095, mutL, DNA mismatch repair endonuclease MutL.	0
CP025348.1\|AZW84486.1\|240333_241377_-\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270320	cd13602, PBP2_TRAP_BpDctp6_7, Substrate-binding domain of a pyroglutamic acid binding DctP subfamily of the tripartite ATP-independent periplasmic transporters; contains the type 2 periplasmic binding protein fold. DctP6 and DctP7 groups of the TRAP transporters that involved in pyroglutamic acid transport. TRAP transporters are a large family of solute transporters ubiquitously found in bacteria and archaea. They are comprised of a periplasmic substrate-binding protein (SBP; often called the P subunit) and two unequally sized integral membrane components: a large transmembrane subunit involved in the translocation process (the M subunit) and a smaller membrane of unknown function (the Q subunit). The driving force of TRAP transporters is provided by electrochemical ion gradients (either protons or sodium ions) across the cytoplasmic membrane, rather than ATP hydrolysis. This substrate-binding domain belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.99378e-85
CP025348.1\|AZW84498.1\|256382_257774_+\|class-II-fumarate-hydratase	gnl\|CDD\|234779	PRK00485, fumC, fumarate hydratase; Reviewed.	0
CP025348.1\|AZW84493.1\|249528_250578_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
CP025348.1\|AZW84489.1\|246035_246527_-\|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase	gnl\|CDD\|172582	PRK14092, PRK14092, 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.	2.78166e-87
CP025348.1\|AZW84494.1\|250683_251625_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	4.17279e-156
CP025348.1\|AZW84491.1\|247879_248578_-\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	3.91431e-64
CP025348.1\|AZW84497.1\|255694_256231_-\|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|223873	COG0802, COG0802, Predicted ATPase or kinase [General function prediction only].	2.28113e-54
CP025348.1\|AZW84485.1\|239546_240290_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	5.58304e-45
CP025348.1\|AZW84501.1\|259954_260854_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176107	cd08415, PBP2_LysR_opines_like, The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefaciens, NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region. OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon. LysR is the transcriptional activator of lysA gene encoding diaminopimelate decarboxylase, an enzyme that catalyses the decarboxylation of diaminopimelate to produce lysine. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.62875e-38
CP025348.1\|AZW87683.1\|254378_255623_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|182376	PRK10319, PRK10319, N-acetylmuramoyl-L-alanine amidase AmiA.	7.29619e-86
CP025348.1\|AZW84492.1\|248574_249276_-\|DnaA-regulatory-inactivator-Hda	gnl\|CDD\|236347	PRK08903, PRK08903, DnaA regulatory inactivator Hda; Validated.	2.81236e-100

>CP025348.1|AZW84493.1|249528_250578_+|phosphoribosylformylglycinamidine-cyclo-ligase
MTNQHSAPLTYRDAGVDIDAGDALVDRIKPLAARTMRPGVLAGIGGFGALFEVPKKFREPVLVSGTDGVGTKLRLAFDWNRHDTVGIDLVAMSVNDILVQGAEPLYFLDYFACGKLSVDTAAAVVGGIARGCELAGCALIGGETAEMPGMYPDGEYDLAGFAVGAVDKSAIIDGKSIQPGDVVLGLASSGAHSNGYSLVRKILERAGARPDQDFHGQPLVDVVMAPTRIYVKQVLAALDRHGPAIKGLAHITGGGLLDNVPRILQPGMAAQLQRDGWEMPKLFQWLQQQGSVADAEMHRVFNCGIGMVLVVAADQADAVAATLREQGEIVNRIGEIVPQQDGMAQTVVV
>CP025348.1|AZW84492.1|248574_249276_-|DnaA-regulatory-inactivator-Hda
MNRQLLLDVLPAPAPALNNYIAGPNGQALAAAHALTAGRAIYLWGPAGCGRTHLLRGLSARPEAIYIDAARAAQSLRELAEADSTAPMPRLVAVDDVHRMDDARQAGLFALYNRWRESAATGRAFALAVSGDRAPMSLPLREDLRTRLGWDLVFRLDPLSDADKLAALTAQAAERGLQLAPEVINWMLTHHERDIRKLAALLDALDRYSLATGRPITIPLLRAMLADPHSQAT
>CP025348.1|AZW84491.1|247879_248578_-|HAD-IB-family-hydrolase
MTTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLFDHLEDAKS
>CP025348.1|AZW84490.1|246523_247879_-|polynucleotide-adenylyltransferase-PcnB
MITETIRKFVGRLFAPALRGPQRIGAERHGIDRRNVSRHAIKVCDVLRQHGYEAYIVGGAVRDLIVGLEPKDFDVATNATPEQIRPLFRRARIIGRRFQLVHVVFGQEIIETSTFRAPASDDQETDEHGRILRDNVFGSQEEDAARRDFTMNALYYDPHTEEVIDYHQGVQDLKKRQVRIIGDPVKRYREDPVRMLRAVRFAAKLNGSIDTATRQPIRTMASLIENVPASRLFDEMLKLLTCGHAMDCLRQLRNDGLHHGLLPLLDVVLEQPGGENFVELALERTDARVRAGKTISPSFLFAALLWQLVDVRWKQLRAQGEHNIPALVQAADSVLDEQTEKLAIQRRFSSDMREIWFMQPRFERRAGKTIYRMLEQPRFRAACDFLQLRAAAGEFDSVLAQWWMDLANGDDATRAEMIEETAHLPRETGDAPAQKRRRPRRRPSNRPREPQ
>CP025348.1|AZW84489.1|246035_246527_-|2-amino-4-hydroxy-6--hydroxymethyldihydropteridine-diphosphokinase
MNGSPASTLAYVGLGASLGDAAATLRSVLAELAAAPGILACKASRLYRTAPVEAQGPDFVNAVAALDTTLAPLDLLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGEQAIDHPRLSVPHPRMHERAFVLAPLCELVPALRLAQGDCAALLAALEDQAIEPLR
>CP025348.1|AZW84488.1|245060_246017_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKKRIWGTLLAAAMTVGSGAAHAGYPDKAVRIVVPFAAGGGVDALARPFAKELGDILGQSIVVENKPSNTGQIGATDVARAAADGYTLLLSSAAFATTPAFYPQVPYDPVKDFSPVMIMAAAPQVLVASNRFKAASLPDVLAQARQSDRINFALSASTGIQALATAMLAGQGGVTFMTIPYKGAGAAFMDLISGEVDLMIDNPASSLVHVRAGKLRVLATTGSKRMAILPDVPTVAETLPGFEARNWFVLAAPQGTPPAVIQKLNEASARALNTPAMRQMLERDGIDLVADSPAHAAAFLQDEIAKWGKVVKEGNLQP
>CP025348.1|AZW84487.1|241547_243650_+|hypothetical-protein
MSSIEMPAPVMPIEPAELAGASPYPLAIDQDFCLIRWMAAISRACGALATVALLLMALSMCYEIFSRYLFNAPTAWATEISGYLLVATVFFGLAAAQASNSHVQVELWIDRLSAPVRLRVELLCQWLALLFCVVLGWQMASFNVREYLNDTRDWGLLSTPQWMPELAVSVGMVVFCMSILVDIYRLSPPAQAWRRWLTPALLALLAAALVALGANAVPMAAGGRFDWGMALIVAALLACAWAWSGVRTLAHVVLVVGGCAVLYGLARGQSLGWVAFLLVASMMLLLFLGVRIGVALGLVGLFGVYFLLSRPQLSLLAERAWSSTNTFTLTAVPMFIFMGGLLLRSGITAGMFDALVRWFGRAPGGLAHASAGASAVFAAVSGSSLATAATLGKVACPDMIERGYSPRLTYGVAAAGATLGILIPPSIPMIIYGTTVGASVTHLFLAGMLPGLLLMACFMLGALVWALAVPGSAPVARAYTLREKLSASRGMVPFVAIIGAVLGSMYTGVATPTEAAAIGAVSAFVLCLVRRQLSWRALFEIAHDSAKVTALLLLIVVGAGIFSWVFDYLRLPREVVNLIQGADLSPALIVAAMVLAYLVLGMFVESIAMMLMTLPVTYPIAMSLGLDPIWFGVFLVLMIELGLITPPVGMVLFVLRSMNEKARFTDIIRGALPFVLIILLFLCLIYIYPQIVMWLPQQVK
>CP025348.1|AZW84486.1|240333_241377_-|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MSQRFPLPRGFQAALAAAALCTASWSGAAAAQTYDLTMAVITSPGDGYSILTASVPERVAKATDGKVKVTVSDSLVPPAQIATAVREGRVDMSAALHTYLAADEPRMGIFNLPGLINNIQEYKQVCDAFWCEDTRKIWKDKWNAIVLAEGAWCTQQLFSKDPIHKVEDFKGKRLRVHNPQTAEVVNALGGKPVAMPTTEIFPALERGVIDGLFISTCVGGSLEFWRIAKNVQNWSLGPINGWAILANPDSWQKLPADVQKQVQGAMDALQQEAFGNYDTFVSNAQQEMMKKGVTFWVAPEEERAKLMQQQYIGPSYEAWNKRAKQVGFDGPAYLDRVRTTLGKSASN
>CP025348.1|AZW84485.1|239546_240290_-|GntR-family-transcriptional-regulator
MPFPFCNTNRMTSPAAPEGEFKVQRVASVLRHSVTESIRNAILVGRFRPGERLPERELCEMTGVSRTLVREALRQLESEGLIVVIPHRGPVVERLSPEQARGIYQVREELEGLACQLFAEHATEPQLAALQEAFQALKRALTRGTPLEQIAAKNAFYQQLLDGAGNEALTTTLRLLNSRVMLLRSTSMQAPGRAKHSVAELSNLLQALVARDGKAARKAGSLHVRNAASVAIAILQDSLADAAATAE
>CP025348.1|AZW84484.1|238114_238525_+|4-carboxymuconolactone-decarboxylase
MALRPEFQTEQFQKGLAVRRAVVGDAYVDKSLNSADDLTASLQKLVTEYCWGEVWTRPGLERKTRSFLNLAMLIALNRPNELRLHLRGAINNGVTKDEIVEVVLQAAIYCGVPAALDAMKAVREVVETMEKEGAFA
>CP025348.1|AZW84494.1|250683_251625_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MTPRAIICLAGPTAAGKSASTLALAQRWPLEIINVDSATIYRGMDIGTAKPSAAERAQVPQHLLDIRDPAQSYSAAEFRADALRLIAEIHARGRIPLLAGGTMLYYKALREGLDDLPQADPALRAELEARAARLGWPALHAELALLDPATAARLSPNDSQRIQRALEICRLAGQPMSALLQGERRGDAPSPYRYVTLSLEPSERAALHARIAQRFDAMLAAGLVEEVRGLHARPDLHPGLPSVRCVGYRQMWSYLDGDIDLDTAREQGVAATRQLAKRQLTWLRAQPERVIIDCLAGDAVARTVDAMARALPD
>CP025348.1|AZW84495.1|251621_253511_-|DNA-mismatch-repair-protein-MutL
MSDRRPIATLPDLLISQIAAGEVIERPASVLKEILENAIDAGARAIEVRLEGGGIRRIAVTDDGSGIPPEELPLALTRHATSKIRSLDELESVASMGFRGEALASIASVADLTIISRTRGAEHAWQIDGGSLQVSPASGPPGTTIDVRQLFDRVPARRKFLRSEATEFGHCVDAMERIALAHPEVAFRLFHHDRAQRQWLPADHGQRIRDVLGAEFVGHVLPVLAAAGAIALMGMVTRPTAARARADRQYLYVNGRFVRDRTVSHALRSAYADVLHGDRQPAYVLYLDIDPGAVDVNVHPAKHEVRFRDSGAVHRFVSQVVGQTLAQTGGAEAVPAGVPDGAAPDTAYAGEPAAAAPGLAEPRAPYPAAYPSPGQSPYQGSPARPHTQVPFRLHGEPAGIPATDWQSLYRPLPGDAAPAATALRAAPATPLPTADEHPLGQALAQLHGIYILAQNSRGLVLVDMHAAHERVVYEQLKRALDDRALPRQDLLVPVVFHAAEKDVALVEEHETQLNELGFEMRPSGPASIAVRSVPALLARGDIESLARAVLRDLGAVGVSRLLTEQRNELLSTMACHGSVRANRRLTLEEMNALLRQMEITERADQCNHGRPTWVQWSVNDLDKLFLRGQ
>CP025348.1|AZW84496.1|253597_254236_+|hypothetical-protein
MLDFFNMVLHIDQTLGIWVEQYGVWVYLVLFLIVFAETGLVVLPFLPGDSLLFIAGAFGATGHMDPVLTAALLIVAAISGNTVNYTIGRYIGPRVFSMNLRFLDRNALMRTHAFYEKHGGKTIVMSRFIPVIRTFAPFVAGVADMRLARFQLFNIGGALLWVISLVAAGYFFGNIPLVREHLNTIVLIGLGAAIVPVVIGALVRLLQVRRGQ
>CP025348.1|AZW87683.1|254378_255623_-|N-acetylmuramoyl-L-alanine-amidase
MRTWPADEYTRVTLELDSELKAEHFTLENPHRLVVDIEGLSVNAALNDLVSKVRHDDPYIQGLRVAQNRPNVVRLVFDLKQSVAPQVFTLKPVADYQYRLVLDLYPKVAQDPLMAILNKQSGPDVDDPLARVLDEIARNQPAPDQPAAPLARGQEPAPALPAPPIKPLPAPGRSASRKRMLTIALDPGHGGEDPGAIGRSGLREKDVVLRIARRLKTLIDAQPYMRAYLTRDDDYFVPLHVRVQKARRVRADLFVSIHADAFIKPTANGSSVFALSERGASSTQARWLADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGSAFLDEIKKINRLHKNRVEQAGFAVLKAPDIPSILVETAFISNPKEEALLRSAAHQEKLAQAMMTGIDRYFTANPPLARVGDVS
>CP025348.1|AZW84497.1|255694_256231_-|bifunctional-alanine-racemase/tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MSAPPTTLCLHLPDEAATENLARQLAPLVDGRRGGQPGGQIHLQGDLGAGKTAFTRALLRECGIQGRIKSPSYALLESYKVSNLYFYHLDFYRFSDSREWLDAGFRDLLRDDAVVLIEWPERAAGLLPPPDLLISLAYADQGRDASLTAHTARGQTWLNAIVPPPTARSLPAPPPADA
>CP025348.1|AZW84498.1|256382_257774_+|class-II-fumarate-hydratase
MKTRTEKDTFGPIEVPEQHLWGAQTQRSLHFFAISTEKMPVPLVAAMARLKRAAAKVNAELGELDPQVADAIMRAADEVIAGKWPDEFPLSVWQTGSGTQSNMNMNEVLANRASELLGGERGEGRKVHPNDHVNRGQSSNDTFPTAMHVAAAVEVEHRVLPALKALRGTLAAKSAAFYDIVKIGRTHLQDATPLTLGQEISGYVAQLDLAEQQIRATLAGLHQLAIGGTAVGTGLNAHPQFSAKVSAELAHDTGSAFVSAPNKFQALASHEALLFAHGALKTLAAGLMKIANDVRWLASGPRSGLGEISIPENEPGSSIMPGKVNPTQCEAVTMLAAQVMGNDVAINVGGASGNFELNVFKPLVIHNFLQSVRLLADGMVSFDKHCAAGIEPNRERITELVERSLMLVTALNPHIGYDKAAQIAKKAHKENLSLKEAALALGHLTEAQFAEWVVPGDMTNARR
>CP025348.1|AZW84499.1|257790_258771_-|AEC-family-transporter
MSENSSLRRDAEAPLLSIFLPGSMSVALLVLPDFMLVALGWALRHKLGFSREFFAGTERMVYFVLFPALLFQSILRTPISAGHAMQLLQATAALMACGVALAWLAGPVLRPAPVALASAAQCGYRFNTYIGLALAASLAGGPGQTIMALIVGFAVPMANVAAVYGLARHSGNGLLRELARNPLLVSTLLSLACNLAGLSLPGPIDTVMARLGAAALALGIMCVGASLAWEGGKGHGRLIGWMLAVKLAAMPSAALGIAWALGLPALETRMLVLFSALPTASAAYVLAMRMGGDGRMVAVLISLGTLASAATIPLWLTAAAGLGAPN
>CP025348.1|AZW84500.1|258906_259890_+|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugE
MNKVRTLVQAIAVATGLVAAAGAQAADAYPSKAIRVIVPFAPGGSTDIIARLVTQRMSQELGQPMVVENKGGAGGAIGASEAARAEPDGYTLSIATVSTMAVNPACRPKDLPYDPIKDFQPVTNFANTANVVAVNPKFPAKDFKGFLEELKKNPGKYSYGSSGTCGVLHLMGESFKMATGTDIVHVPYKGSGPAVADAVGGQIELIFDNLPSSMPQIQAGKLRAMAIAWPTRIDAIKDVPTFADAGFPVLNQPVWYGLLAPKGTPMDVVNKLRDAAVVALKDPKVIKALDDQGSAPSGNTPEEFAKEIKEQYDWAQDVVKKQNIKLD
>CP025348.1|AZW84501.1|259954_260854_-|LysR-family-transcriptional-regulator
MRLRHIEIFEAIRRTGSLTEAAAALHISQPAASKLLAHAEAQLGFKLFERVKGRLVATREAEILAPEVARLNQDLGSVRRLAASLRDRPHGHLRLGCAPALGLGLLPGVVRASRDAQPGITFDIHTHHSAELVQGLLAHELDLAITFDANNHPGLTRTSLGHTELVHLSRLPGAGTTRLQELGGETLIVLDARDASGSLLQMALDAQGLAPRVAIQVQTHYVACALAEAGCGDAVVDAITARAMLRPGMALRRLEPALRVPISVMTRSQDALSTLHHDFIERLRQACSVLQAQPAPQPE
>CP025348.1|AZW84502.1|260960_262715_+|gamma-glutamyltransferase
MPLRTLLAALCAAAICQAPAWAREAPGVAREDVNPEIASARSERAQAHAQRYMIATANPLASEAGYRILRAGGSATDAIIAAQLVLNLVEPQSSGIGGGAFMVHYDRGAGELRVYDSRETAPAAARPDRFLREGKPLSYAESVNNGRAVGTPGLLRGLELAHRQHGKLPWQALFEPAIAMAEQGFAVSPRLHESIAGDKALAAQPAAARYFYGPDGQAWPVGHRLRNPEFAATLRSIAREGADAFYRGPIARDIVAAVRAHPTPGDLAEADLAGYRAVVREPVCGLYRGYRLCGAPPPSSGPLAVLQMLGELEQYPLARMRPGSVEAVHYFSEAGRLAFADRDFYVADPAFVDVPVRALLDPAYLRQRGALIRPDRSMKTALPGDPQGLLAERARDDAIEVPSTSHLVAVDAAGNVVSMTSTIEAAFGSKIFVRGFLLNNEMTDFSSSYRDPEGRLVANRVEPGKRPRSSMAPMIVFRAGKPVLALGSPGGSAIINYVAKTLVGVLDWKLDVQQAIALPNLGSRNKETELERGTALEALAPALRRMGHEVRITDFPSGIQGIVIGPHGLAGGADPRREGLALGD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025348_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025348_2

433081-433174

Orphan

Consensus_repeat	Method
GTGCCTGTCCCCGCCGGGACAGGCAC	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of CP025348_2

>merge|CP025348|2|433081-433174|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCACCCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGCGTGCCTGTCCCCGCCGGGACAGGCAC

>CP025348|2|2|433081-433174|CRISPRCasFinder
GTGCCTGTCCCCGCCGGGACAGGCAC	CCGGGCCCAGGAAAACCCCCACGCTGCGCCCGCTGTGCGGGC
GTGCCTGTCCCCGCCGGGACAGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
CP025348.1\|AZW87693.1\|426097_427411_-\|short-chain-fatty-acids-transporter	unknown	unknown	gnl\|CDD\|224942
CP025348.1\|AZW84666.1\|442091_443069_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
CP025348.1\|AZW84661.1\|437452_437971_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
CP025348.1\|AZW84665.1\|441109_442081_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
CP025348.1\|AZW84657.1\|432451_432850_-\|elongation-factor-G	unknown	unknown	gnl\|CDD\|234569
CP025348.1\|AZW84649.1\|420420_421479_-\|glycosyltransferase	unknown	unknown	gnl\|CDD\|133030
CP025348.1\|AZW84667.1\|443194_444367_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173841
CP025348.1\|AZW84662.1\|438081_438837_+\|TerC-family-protein	unknown	unknown	gnl\|CDD\|223930
CP025348.1\|AZW84659.1\|433819_434164_-\|TIGR01244-family-phosphatase	unknown	unknown	gnl\|CDD\|225984
CP025348.1\|AZW84656.1\|431369_432320_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025348.1\|AZW84664.1\|440257_441043_+\|enoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|181723
CP025348.1\|AZW84655.1\|428190_428925_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|235574
CP025348.1\|AZW84651.1\|422195_423173_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025348.1\|AZW84658.1\|433260_433731_-\|universal-stress-protein	unknown	unknown	gnl\|CDD\|366180
CP025348.1\|AZW84660.1\|434263_435664_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP025348.1\|AZW84652.1\|423368_424574_+\|sodium/glutamate-symporter	unknown	unknown	gnl\|CDD\|129314
CP025348.1\|AZW84653.1\|424570_426082_+\|TRAP-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
CP025348.1\|AZW84654.1\|427601_427781_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377342
CP025348.1\|AZW84650.1\|421608_422103_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP025348.1\|AZW84663.1\|439032_440265_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110

Protein	Function_ID	Function_description	E-value
CP025348.1\|AZW87693.1\|426097_427411_-\|short-chain-fatty-acids-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.57351e-166
CP025348.1\|AZW84666.1\|442091_443069_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.33368e-60
CP025348.1\|AZW84661.1\|437452_437971_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.12064e-44
CP025348.1\|AZW84665.1\|441109_442081_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	2.06741e-117
CP025348.1\|AZW84657.1\|432451_432850_-\|elongation-factor-G	gnl\|CDD\|234569	PRK00007, PRK00007, elongation factor G; Reviewed.	1.37761e-90
CP025348.1\|AZW84649.1\|420420_421479_-\|glycosyltransferase	gnl\|CDD\|133030	cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.	4.18053e-89
CP025348.1\|AZW84667.1\|443194_444367_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173841	cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26. Putative acyl-CoA dehydrogenases (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha, beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	4.27565e-82
CP025348.1\|AZW84662.1\|438081_438837_+\|TerC-family-protein	gnl\|CDD\|223930	COG0861, TerC, Membrane protein TerC, possibly involved in tellurium resistance [Inorganic ion transport and metabolism].	1.14565e-78
CP025348.1\|AZW84659.1\|433819_434164_-\|TIGR01244-family-phosphatase	gnl\|CDD\|225984	COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown].	3.40043e-35
CP025348.1\|AZW84656.1\|431369_432320_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.02206e-23
CP025348.1\|AZW84664.1\|440257_441043_+\|enoyl-CoA-hydratase	gnl\|CDD\|181723	PRK09245, PRK09245, crotonase/enoyl-CoA hydratase family protein.	5.15941e-155
CP025348.1\|AZW84655.1\|428190_428925_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|235574	PRK05711, PRK05711, DNA polymerase III subunit epsilon; Provisional.	2.40573e-142
CP025348.1\|AZW84651.1\|422195_423173_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.0826e-23
CP025348.1\|AZW84658.1\|433260_433731_-\|universal-stress-protein	gnl\|CDD\|366180	pfam00582, Usp, Universal stress protein family. The universal stress protein UspA is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. UspA enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae UspA reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, though UspA lacks ATP-binding activity.	9.38587e-30
CP025348.1\|AZW84660.1\|434263_435664_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	3.43796e-109
CP025348.1\|AZW84652.1\|423368_424574_+\|sodium/glutamate-symporter	gnl\|CDD\|129314	TIGR00210, Sodium/glutamate_symport_carrier_protein, sodium--glutamate symport carrier (gltS). [Transport and binding proteins, Amino acids, peptides and amines].	1.2444e-106
CP025348.1\|AZW84653.1\|424570_426082_+\|TRAP-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	9.13066e-82
CP025348.1\|AZW84654.1\|427601_427781_-\|hypothetical-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	0.00323203
CP025348.1\|AZW84650.1\|421608_422103_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.34959e-07
CP025348.1\|AZW84663.1\|439032_440265_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	8.36236e-118

>CP025348.1|AZW84657.1|432451_432850_-|elongation-factor-G
MTRRTSIERYRNIGISAHIDAGKATTTERILFYTGITHKLGEVHEGAATMDWMEQEQGRGITITSAATTAFWRGMAGNYPEHRINIIDTPGHVDFTIEVERSMRVLDGACMVYDSVGGVQEVATVMVVLPGQ
>CP025348.1|AZW84656.1|431369_432320_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDKYNLLTVHS
>CP025348.1|AZW84655.1|428190_428925_-|DNA-polymerase-III-subunit-epsilon
MRQIIFDTETTGLDPAQGHRIVEIGCVEIVNRMVTGNNLHLYLNPDRDSDPEALAVHGLTTEFLADKPRFAEVAEQFLAFIADAELIAHNAAFDVKFFNAELQRIGRDPLNTHCENIVDSLLHARSLHPGKRNSLDALCDRYGISNAHRTLHGALLDSQLLAEVWLAMTRGQDALLIDVDDQGANANGALVLGKFDASVLTVLAASEAELAEHAAYLQALDKAVGGACAWRAIEPLPAESGQPG
>CP025348.1|AZW84654.1|427601_427781_-|hypothetical-protein
MHPDTNTMLIIIAAAVALMIVGFGLRDRNLGLGLLGIGLIAALATIAYKAYITFNSFYY
>CP025348.1|AZW87693.1|426097_427411_-|short-chain-fatty-acids-transporter
MFKLMSRSAVKMVERYLPDPYVFVVLLTLVAAGAAMIIEGQTPMAVVRWWGNGFWGLLTFAMQMLLVLVTGYMLASTPLVKRMLARLASLATSAGGAIILVSVVSLAASWINWGFGLVVGALFAKQIARQVRVDYRLLVASAYSGFIIWHGGLAGSIPLTIATEGHFSADKIGIIPTGDTIFAVFNLVIVVAMFILVPLVNRLMLPDEKESVYVDPARLEEASVPASDDDKRPAARLENSRLLAWLIAAGGLAYMFDYYVVRGAGLNLNVINFSFLILAILLHGTPRRLLASLDEAIKGGAGIVIQFPFYAGIMAIMMDSGLAATLSEWFVSIASAATLPFWTFISAGIVNIFIPSGGGQWAVQSPIVISAAQALGADMPRVAMAVAWGDAWTNMLQPFWALPVLAIAGLKAKDIMGYCIIQLLVTGVIISVGLSFF
>CP025348.1|AZW84653.1|424570_426082_+|TRAP-transporter-substrate-binding-protein
MTMFIRWLILSACLLLAACSRAPDTEILQRDVGQTLAATYGPDLFDIVALRRMGSATDSTAPPGQTRRVVYYDVVLGLKKDLTLGAWDQPGAAALVSLLGAGPRSISGVKSSGNAAGDQIVAHASAIYQRDAEQWVHVAPASFTATEAPSLDTGAPPPVTRQLLQTLEQITRSVPYSASSTAQHVVQQELERSVARINGRLARLQKGYPLATGPDKGEYLAFGQALAAIGRNEQVRVIPLITGGSADNMAMLRSGAAVAALSQADIAQLAYEGKGPFESQGPFSGLRALGSLYPELVHIVVRQGDGIATVGALRGKKIALGPSGSAVRTTLETVLAAHGLQPGRDYAVIDTPAAAALPQLSEGRVDAVAQVIGTPAAPLRAALTQARLALLPLDRAAIDKLVQADPTLMALDIPANTYPSQAAAIPTVGMAALLVTTADLTRDEAAHMVDVVYRAGQDLLAAGSAQGAQVSAANAGRGLSIPLHDGAVEAFEKLGAPPLPEGR
>CP025348.1|AZW84652.1|423368_424574_+|sodium/glutamate-symporter
MISLTPVQSLLACCLVLVAGRILTTRIGVLSRYSIPDPIVGGLLFAVLATALDTWGGIQISLETNIKPTLLLIFFGCIGLTADLKLLARGGPRLIAFLLALIPFLVLQNAVGLGLAWLLDMHPLMGLIGGTITLVGGHGTGAAYAARFADINNIQDVMALAMTAATIGLVLGGIIGGPVAEWLIRRHKLDPRMAGKDANQVLPEVETTAEAPTATSFITSLTAVFVTVVVGTYLAGLVEDAPISLPNFLWCLATGAIIRNFGGYVGIRLDDRVSEIIGSISLSLFLGLTMMTLDLSSVVRLAGPLALMLVAQALVCALYAGWAVFRMLKRDYEAAVMAAAFCGFAMGATATAIANMQALTRRHGPAPESFIVVPVTGAFLVDILNVIVLTSLIALPFVGGM
>CP025348.1|AZW84651.1|422195_423173_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHSYMVRADLAG
>CP025348.1|AZW84650.1|421608_422103_+|GNAT-family-N-acetyltransferase
MPQSYIVRTMRPADVEAVLRVQAAVYPASLLESAALFQNRIEIAPATCQVALDGQDLIGYLIAYPWDAGLPPALDRSLERLPGAADTWFVHDCAVLPAAQGGGVAAALLAGGRAQARRLGLRRASLVALAQAVGYWLRHGYQPLADSDALRAKLAGYGDGARYM
>CP025348.1|AZW84649.1|420420_421479_-|glycosyltransferase
MFMYTEFRSQLLAGAGTSAAGQSARMAVLAGDGATGVQVSCVVPGLNEAANLRVLVPALRACLEQWCASWEIIVVDDGSTDDTAELMAQWSAVEGIRYVQLSRNFGKEAALTAGLEAADGDAVICLDADMQHPPELIGDMLAAWRNGADMVYAVRRQRDDEPWFKRVGARAFYRLLSTARGVEVPPHAGDFRLMDRRVVEALVALPERTRFMKGLYAWVGFKSQAVPYTPQARRHGASHFSAWKLFRLACDGLTAFTTWPLRLVSLIGVLFALLSLSYGGYLVADYLISGNAVSGWTTIVTALLFFAGINLISLGVVGEYVARIFDEVKGRPLFIARQRRGRAKRAAKARSQ
>CP025348.1|AZW84658.1|433260_433731_-|universal-stress-protein
MFKKILIPTDGSPLSAQAANAGICFARSTGAEVVALHVTQPFAATIGFDGMAAAYAITDEDYEKASAEQAEKYLKLILDRAETAGVKAESRAVSNFNVADGIVQAAGEAGCDLIFIGSHGRSGLSRLLLGSVTAKVLSLAHTAVLVYRVKEDKDKK
>CP025348.1|AZW84659.1|433819_434164_-|TIGR01244-family-phosphatase
MSAAIKPLTENFAVAPQLGPADMADVAAAGYKSVIINRPDFEGGPDQPTAADVSQAAQALGLQVEYQPVVGSAMTAADVARFAELLRTMPGPVLAYCRTGTRCTNLFAAAQQLG
>CP025348.1|AZW84660.1|434263_435664_-|PLP-dependent-aminotransferase-family-protein
MRQADATLVTQLADDLARRIDEHGLRPGTRLPSIRRMAEQSGVSRFTVVEAYDRLVARGLVQSRHGAGFFVRARSASLTALASARVPQAAPETPVRVDVSWLLRNMFRETAAGMPGGAGLLPPEWLDPDMVAAAVRAVGRTVRGNLVSYGSPQGYAPLRQQLASMLQADGVPAHPERNLLTTNGVTHGLDIVARHLIKPGDTVLVEDPAWFVIFGRLAAFGARPVGVPRGPDGPDLAMLDRLAAEHKPRLYIINGAVHNPIGHTLSAGAAYDILRLAERHDFMVVEDDTYADLHPGGAMKLAALDRLERVILVGGFSKMLAASLRVGYIAAGAETLQRLTDLKMLAGLTSPELGERVVHRVLVEGQYQRHIERVRARVNEARLRSIQALQQLGLSVPHEPHAGMFVWADCGRDSEPVARNAAERGMLLAPGTLFSPSGAPSTMLRFSVAMVDTPGIWQSIAAVMAQ
>CP025348.1|AZW84661.1|437452_437971_-|MgtC/SapB-family-protein
MDTVWMEIWTTVRNEFADIPDVAEATRIVLRLGMAVALGGLLGYERERSGKAAGLRTHMLVALGAALFVLVPLQGGMEVGDLSRVLQGVIAGIGFLGAGVIIKLGNEGEIRGLTTSAGIWLTAAIGVAAGMGREATALASTLIALFVLAALRRLEKRIAARDDKRVVAQPPP
>CP025348.1|AZW84662.1|438081_438837_+|TerC-family-protein
MDYLVSLAQQPAAWAALATLIAMEVVLGIDNLIFISILTNKLPPQHQTKARRIGIGMALILRLALLGTVAFIVQLTQPVFELFGHGFSWRDVILVAGGLFLVWKATKEIHHHVDPNPGDDMFGGKAATLGFAAAVAQILMLDLVFSIDSIITAVGMTEHIPIMFVAVIVAVAVMLLAAEPLARFIERNPTVVMLALAFLMMIGMTLIAEGFGAHVPKGYIYAAMAFSALVEGLNMMARRAREGRGAGAAGG
>CP025348.1|AZW84663.1|439032_440265_+|CoA-transferase
MSGPLEGVRILDVTTVLMGPYATQILGDLGADVIKVEPPAGDNVRGIGPGRHADMGGIFLHANRSKRSIALDLKNPAGREALLKVAATCDVLVYNVRPQAMARLGLSYAEVAQANPSILYVGMYGYDQRGPYAARAAYDDLIQGAVGIPSLSVEAGSDIPRYAPSAMVDRIVGISAANAVTAGLYHRARTGQGQAIDVPMFETMAHLILGDHMMGQTFEPPLGPPGYPRILNADRRPYATRNGHICVLLYADKHWKAFFELIGQPGRDAADPRFRDIGTRTQHIHAIYRLVSDAIASRTTEEWLAAFEAADIPAMPVHTMASLLRDPHLEAIGFFGMVDHPSEGAVRMMAVPSRWSGTPPQPRGHAPRLGEHSVDVLKEAGYDDEAIAALVRNGAAIAAARQLPEGTDHD
>CP025348.1|AZW84664.1|440257_441043_+|enoyl-CoA-hydratase
MTDFLRHERHGGVLLLTMDRERTRNALSDADAVEALVQACARIGADLSVRAVVLTGSHGVFSSGGNLKTLSDTVGAGLGEPVHSLQAYRSGIQRIPLALYNLEVPTIAAVNGPAIGAGCDLACMCDIRLAARQASFAESFVKLGLTPGDGGAWLLPRIVGMSRACELAFTGRSIDAARARELGLVSEVFDADALLPAALALAQEIAQHSGHALRLTKRLLREGQHTRLDTLLELSAGFQALAHHTQEHAGALDAHLSRKRG
>CP025348.1|AZW84665.1|441109_442081_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MHSRTLALALLSVAALAQGGSARAASDYPAHPVKIIVSLPPGSGADTTARFLSKHLAERFKQPFVVENRPGGNSFIAAQAVATAPPDGYTLFVASNSPMTTNAAVFKNLPYDAVKDFAPVAPIARFPMALVVPANSPYRSVADLVAAARAAPGQLNFASGTATYQVVLELFHEQNGIKATHVPYKGTSAALADVAGGVVQYSVADVSAALPLIRGGKLRPLAVTSTRRIKDLPDVPTMQESGNKGFEAYAWTAAFFPAKVDPAIVARVSDAVQALVRSQEGKAFMEQLGGEPFVGGPDTLAAFQRDELASMRRIAKLANIQQE
>CP025348.1|AZW84666.1|442091_443069_-|LysR-family-transcriptional-regulator
MWTGQYIVHIASPAHHWRRAVELRQLKQLLVLSETLNFHRAAERLHMAQPPLSTAIKKLEQELGVQLFERLPAGLQPTPAAEVVLRYARATLFYADEIQRAAQEGASGKQGMLKVGFVGSSIYSLMPQLLSAFRKDYPRVDLVIEESTTVDLLRRLDAHTLDVALVRFPVLEPSTARITLLQADHLMLAVPAGSRYAQRDDVALDELADEPFIGYSRTHVPGMHALIMYAFQQYGVVPHIAQEAIQVQTILSLVESGLGLAIVPKVACRQAGSGVRLVNVPQLAETIKVGIALAVHPDNATPTTANFVDMACRLMQTEPAAGQAR
>CP025348.1|AZW84667.1|443194_444367_+|acyl-CoA-dehydrogenase
MGAILGTIIEALQLAAIPAHDEALRPAVRAFLDEALREMPADRRARSWMGHDAEFSRALARQGWLGLTLPVEYGGAGRSNFARFVLSEELLAVGAPVSAHWVADRQTAPLILRFGSPAQRAFYLPRIIRGEAFFAIGMSEPDTGSDLASVRTRATPVADGWLLNGRKIWTTNAHRSHYMCALVRTSGAPEDRHRGLSQMIFDLALPGIEIRPIRDIAGDAHFCEVLFDNVLLPHDALVGEEGSGWRQVMAELALERSGPERIYSSMVLLDGWLAHLRCDAAPQRAQVCLAGRLAARLAVLRSMSLAVSQRLEQGADASLAAVLVKDLGTEFEQAVPELIGQALHASPQPAPDDVLMRTLAYLTLINPTFSLRGGTRHILRGIIARELGLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025348_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025348_3

999502-999596

Orphan

Consensus_repeat	Method
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025348_3

>merge|CP025348|3|999502-999596|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTTATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAGTAAAAGGGCACCCGCAAGGGTGCCTTTTT

>CP025348|3|3|999502-999596|CRISPRCasFinder
TAAAAGGGCACCCGCAAGGGTGTCCTTTT	ATTGCGAAAAGATATCTGGAAGAAAGCCTTTTCAGAG
TAAAAGGGCACCCGCAAGGGTGCCTTTTT

Protein	Signature genes	Signature genes Name	Protein_function
CP025348.1\|AZW85142.1\|997876_998749_-\|multidrug-DMT-transporter-permease	unknown	unknown	gnl\|CDD\|274527
CP025348.1\|AZW87720.1\|1006648_1007566_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
CP025348.1\|AZW85144.1\|999645_1000371_+\|CoA-pyrophosphatase	unknown	unknown	gnl\|CDD\|239518
CP025348.1\|AZW85148.1\|1005865_1006597_+\|rRNA-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|224108
CP025348.1\|AZW85143.1\|999054_999435_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
CP025348.1\|AZW85140.1\|996060_997335_+\|radical-SAM-protein	unknown	unknown	gnl\|CDD\|275263
CP025348.1\|AZW85147.1\|1005233_1005806_-\|chorismate--pyruvate-lyase	unknown	unknown	gnl\|CDD\|225703
CP025348.1\|AZW85149.1\|1008373_1011553_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
CP025348.1\|AZW85146.1\|1001521_1002571_+\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
CP025348.1\|AZW85151.1\|1013001_1013253_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	unknown	unknown	gnl\|CDD\|225170
CP025348.1\|AZW85137.1\|988095_988737_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239314
CP025348.1\|AZW85141.1\|997488_997869_+\|hypothetical-protein	unknown	unknown	unknown
CP025348.1\|AZW85136.1\|986186_988013_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173842
CP025348.1\|AZW87719.1\|1002708_1003725_-\|IS110-family-transposase-IS1663	unknown	unknown	gnl\|CDD\|376773
CP025348.1\|AZW85145.1\|1000466_1001417_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025348.1\|AZW87718.1\|993659_994568_+\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
CP025348.1\|AZW85138.1\|988926_989961_+\|sulfate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224529
CP025348.1\|AZW85150.1\|1011549_1012932_+\|multidrug-transporter	unknown	unknown	gnl\|CDD\|273830
CP025348.1\|AZW85139.1\|991797_992862_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	unknown	unknown	gnl\|CDD\|213263
CP025348.1\|AZW85135.1\|985013_985943_+\|electron-transfer-flavoprotein-subunit-alpha	unknown	unknown	gnl\|CDD\|224936

Protein	Function_ID	Function_description	E-value
CP025348.1\|AZW85142.1\|997876_998749_-\|multidrug-DMT-transporter-permease	gnl\|CDD\|274527	TIGR03340, phn_DUF6, phosphonate utilization associated putative membrane protein. This family of hydrophobic proteins has some homology to families of integral membrane proteins such as (pfam00892) and may be a permease. It occurs in the vicinity of various types of operons for the catabolism of phosphonates in Vibrio, Pseudomonas, Polaromonas and Thiomicrospira.	3.74356e-26
CP025348.1\|AZW87720.1\|1006648_1007566_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.56316e-67
CP025348.1\|AZW85144.1\|999645_1000371_+\|CoA-pyrophosphatase	gnl\|CDD\|239518	cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes. The need of CoAses mainly arises under conditions of oxidative stress. CoAse has a conserved Nudix fold and requires a single divalent cation for catalysis. In addition to a signature Nudix motif G[X5]E[X7]REUXEEXGU, where U is Ile, Leu, or Val, CoAse contains an additional motif upstream called the NuCoA motif (LLTXT(SA)X3RX3GX3FPGG) which is postulated to be involved in CoA recognition. CoA plays a central role in lipid metabolism. It is involved in the initial steps of fatty acid sythesis in the cytosol, in the oxidation of fatty acids and the citric acid cycle in the mitochondria, and in the oxidation of long-chain fatty acids in peroxisomes. CoA has the important role of activating fatty acids for further modification into key biological signalling molecules.	5.50907e-72
CP025348.1\|AZW85148.1\|1005865_1006597_+\|rRNA-pseudouridine-synthase	gnl\|CDD\|224108	COG1187, RsuA, 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis].	7.73356e-72
CP025348.1\|AZW85143.1\|999054_999435_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	1.34063e-62
CP025348.1\|AZW85140.1\|996060_997335_+\|radical-SAM-protein	gnl\|CDD\|275263	TIGR04470, hypothetical_protein_ALIPUT_00462, radical SAM mobile pair protein B. Members of this family are the downstream member (B) of a pair of tandem-encoded radical SAM enzymes. Most of these radical SAM gene pairs have an additional upstream regulatory gene in the MarR family. Examples of high sequence identity (over 96 percent) from cassettes in several Treponema species of the oral cavity to those in multiple Firmicutes in the gut microbiome suggest recent lateral gene transfer, as might be expected for antibiotic resistance genes. The function is unknown.	4.71758e-24
CP025348.1\|AZW85149.1\|1008373_1011553_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
CP025348.1\|AZW85146.1\|1001521_1002571_+\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
CP025348.1\|AZW85151.1\|1013001_1013253_-\|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein	gnl\|CDD\|225170	COG2261, COG2261, Predicted membrane protein [Function unknown].	2.42408e-12
CP025348.1\|AZW85137.1\|988095_988737_+\|peroxiredoxin	gnl\|CDD\|239314	cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.	3.35179e-132
CP025348.1\|AZW85147.1\|1005233_1005806_-\|chorismate--pyruvate-lyase	gnl\|CDD\|225703	COG3161, UbiC, 4-hydroxybenzoate synthetase (chorismate lyase) [Coenzyme metabolism].	1.05194e-17
CP025348.1\|AZW85136.1\|986186_988013_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|173842	cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5. Putative acyl-CoA dehydrogenase (ACAD). Mitochondrial acyl-CoA dehydrogenases (ACAD) catalyze the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. The ACD family includes the eukaryotic beta-oxidation, as well as amino acid catabolism enzymes. These enzymes share high sequence similarity, but differ in their substrate specificities. The mitochondrial ACD's are generally homotetramers and have an active site glutamate at a conserved position.	6.94362e-153
CP025348.1\|AZW87719.1\|1002708_1003725_-\|IS110-family-transposase-IS1663	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	2.74666e-23
CP025348.1\|AZW85145.1\|1000466_1001417_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	8.66858e-23
CP025348.1\|AZW87718.1\|993659_994568_+\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
CP025348.1\|AZW85138.1\|988926_989961_+\|sulfate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224529	COG1613, Sbp, ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism].	0
CP025348.1\|AZW85150.1\|1011549_1012932_+\|multidrug-transporter	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	9.9815e-102
CP025348.1\|AZW85139.1\|991797_992862_+\|sulfate/thiosulfate-import-ATP-binding-protein-CysA	gnl\|CDD\|213263	cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter. Part of the ABC transporter complex cysAWTP involved in sulfate import. Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	3.07125e-165
CP025348.1\|AZW85135.1\|985013_985943_+\|electron-transfer-flavoprotein-subunit-alpha	gnl\|CDD\|224936	COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion].	1.05379e-120

>CP025348.1|AZW85143.1|999054_999435_+|50S-ribosomal-protein-L19
MNLIAILEQEEIARLTGGNAVTEFAPGDTVVVSVNVVEGTRKRVQAFEGVVIAKRNRGLNSSFIVRKISSGEAVERTFQLYSPQIAGIEVKRRGDVRRAKLYYLRSRSGKSARIKEKLVLKKAKSA
>CP025348.1|AZW85142.1|997876_998749_-|multidrug-DMT-transporter-permease
MSYTSLILVVLAAMAHAAWNLLAKRAAMVGPMFVFAYGLAATILYAPWVIWVLAHDGMVWSWPVVLCILASSMLHLGYSLCLQRGYQVADLSVVYPIARGTGPLLSTMGAFTLLSEPATTTGIAGMLCVVGGVLLIATQGRLGMFRQAQAWIGVRWGVVIGLFIAAYTVVDAYGVKILLIMPVLFDWFTCATRTLMMTPHVLRRRAQYWPAMRGYWHLAIAVGVLSPLGYILVLYALRNGAPLSLVAPAREMSMMLGTLAGMFLLREKVGIGRLAGCLAILAGVVLLGSS
>CP025348.1|AZW85141.1|997488_997869_+|hypothetical-protein
MTIATTLDAATSLPTAVPGRTLGALRRLARAWAGAAVPQRKWPFPPTPPGQAQPCTPCTDSQPRSVQAVQPAQARALHAQAELSGAATQAATQVLSTKAKIIDVLLVAVWGAMIPALMWLGAAGGF
>CP025348.1|AZW85140.1|996060_997335_+|radical-SAM-protein
MASTEHSFSAGFGSPAAAPAALRGRGAVTNVPHRFQQADRVRVDDGWANPDYTAGSDAAALPSVAEALGQGGRRAIPIAVEGADASPNTCAQAPAPRTIVQAEEARKMLSRNDSPDIPFDVAANPYRGCEHGCVYCYARPTHAYLGYSPGLDFETRLVAKANAVAALRAELARPGYRASPINIGSATDAYQPIERTWRLTRGMLELLLQTRHPLTVVTKNALVERDLDLLQDLARQKLVTVFVSITTLDAAMARTLEPRASAPYRRLQTVRTLAQAGVPVGVLVAPVIPFINDESLEHILQEASAAGACYASYTVLRLPWEVKEVFETWLQAHFPDRAQRVLHRIEDLRNGRRNDTAFGSRMRGTGIWADLLRQRFALATRKLDLNRHRPELDTHRFVPPLEPGLPPARGRREARAQPGQLALF
>CP025348.1|AZW87718.1|993659_994568_+|sulfate-adenylyltransferase-subunit-CysD
MSAVMTRSHLDWLESEAIFILREVAAECARPALLFSGGKDSVVLLRLAEKAFRPGRFPFPLLHIDTGHNYDEVISFRDARAAELGETLLVRSVEDSIARGSVALRRETDSRNAAQAVTLLEAIEELGLDACIGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPELWNLFNTRVHRGENMWVFPISNWTELDVWQYIQRERLALPSIYYSHTREVVRRKGLLVPVTRLTPPAEGETVEQLAVRFRTVGDISCTCPVASDAADPAAIIAETAVTDITERGATRMDDQTSEASMERRKREGYF
>CP025348.1|AZW85139.1|991797_992862_+|sulfate/thiosulfate-import-ATP-binding-protein-CysA
MSIEVRGLSKRFGAFRALDEVSLHIETGELVALLGPSGCGKTTLLRIIAGLESADAGSVLFAGEDATEVDVRQRQVGFVFQHYALFKHMTVFENVAFGLRVRHRSQRPSEARIRAKVLDLLGLVQLDWLADRYPAQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLRRLHDELHVASVFVTHDQEEALEVTDRVVLMNAGRIEQVGSPREVWERPATPFVYGFLGDVNQLHGHATRGVWRLGEVALPAPDLPEADNQRAIAYVRPHDIDLARAGTAAPGIPVRLNHVYLAGPSAYLELARQDDQAIIEAQVPEPLFRSLGLKEGEALLAQPRRARVFAVQP
>CP025348.1|AZW85138.1|988926_989961_+|sulfate-ABC-transporter-substrate-binding-protein
MPRNTAGIRGAIVALATVFSLGLPWAVQAQDKQTLLNVSYDPTRELYRAVDEAFIKEYQARAGVDLTVRQSHGGSGRQARSVIDGLDADVVTLALAYDIDAIADRGLLPQDWQKRLPRNSSPYTSTIVFLVRKGNPRQIHDWDDLVKDGVQVITPNPKTSGGARWNYLAAWAYALARNEGSEAKAREFVGQLLSHVPVLDTGARGSTTTFVERGVGDVLLAWENEAFLAREELGPDKFDIVVPSLSILAEPPVAVVDKVVDRKGTRAAAQAYLEYLYTPAAQEIIARNFYRPTDAGVAAKYASRFPKLKLVTIDDPIFGGWRKAQKDHFSDGGTFDQVYQPQRK
>CP025348.1|AZW85137.1|988095_988737_+|peroxiredoxin
MGQLRLGDTAPDFEQKSSIGPLRLYDYLGDSWGVLFSHPADFTPVCTTELGYTAKLAGEFAKRNVKVLALSVDPVDSHTKWIDDINDTQSTTVNFPILADDDRKVSELYDMIHPNANATLTVRSVFVIDPAKKVRLTITYPASTGRNFDEILRVIDSLQLTDSHSVATPVNWKDGEDVIIVPSLKDEAVIKEKFPKGYKALRPYLRITPQPNK
>CP025348.1|AZW85136.1|986186_988013_+|acyl-CoA-dehydrogenase
MTYATPLQDFRFALNELAGLEEILKLPGFEEVTPDLVDAILEENARFVQQAIAPLNVAGDTKPPVWNDGQVTTTPGFSQGFADYTAGGWQGLQHPQKWGGQGLPKVVAAPAGENIQAASLAFSLCPMLTDGVIEALLTVGSEAQRQTYVPKLIGGQWTGTMNLTEPQAGSDLAQVATRAVRQDDGSYRLSGQKIFITYGEHDLAENIIHLVLARTPDAPAGVKGISLFIVPKYLVNEDGSRGKRNDVWCASLEHKLGIHGSPTAVLLYGAGKGEVGEGAVGYLVGEANRGLEYMFIMMNAARYSVGQQGIGVSERAYQHAQAYARERVQGRAIEGSAAPVTIAHHPDVQRMLLTMRALTEAARAVSYVAAAAHDKGTHHPDAEVRARNRAFYEYLVPIVKGFSTESAVEVASLGIQVHGGMGFIEETGAAQHYRDARILPIYEGTTAIQANDLVGRKTLRDGGATAHASIAAMRDTLKAVAAEAQRADTADHTALRVLRDNFDQAIQSYEGAVEFILAHAASNVRAVYSSSVPYLMLAGVVHGGWQMARAALACRRHLAAGSGDAFHRHKLGTALFYGAHILPRALALAAAVRAGDVADSCGSMADIA
>CP025348.1|AZW85135.1|985013_985943_+|electron-transfer-flavoprotein-subunit-alpha
MTTLVIAEHDNAQLKGATLNTIAAASRLGGEVHVLVAGSGAQAVAEQAAQAARVSKVLLADAPQLAEGLAENLAAQVLAVAGGYSHILFAATASGKNVAPRVAAKLDVAQISDIIGVESADTFQRPIYAGNAIATVQSGDAVKVITVRTTGFDAVAAQGGSAAVEALDAVADSGLSRFVGREVAKSDRPELAGARVVVSGGRGLGSAENFKILDPLADKLGAALGASRAAVDAGYAPNDWQVGQTGKIVAPQLYVAVGISGAIQHLAGMKDSKVIVAINKDPEAPIFGVADYGLVGDLFQVVPELTGAL
>CP025348.1|AZW85144.1|999645_1000371_+|CoA-pyrophosphatase
MSDSAPSRPRRTPVRPLFDPMAQPWETANQGLARVDERLLTPPELRSSLRPADHWRLDPLCAAEPRAPGREGSLVAAAVLIPLVMRADGVRVMLTQRAAHLHDHAGQVSFPGGRIEVSDATPVAAALREAQEETGLPVQQVEVLGSMPQYFTATGFAITPVVSLVQPDFELAPDAFEVAEVFEVPLSFLMDPANHRLYRAALPDGYVRQYYAMPWQRYFIWGATAGMLRNLYQTVREALPG
>CP025348.1|AZW85145.1|1000466_1001417_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025348.1|AZW85146.1|1001521_1002571_+|NADP(H)-dependent-aldo-keto-reductase
MKYRKLGHTDLDVSLIGLGTMTWGEQNTEAQAHEQLDYALAHGINLVDAAEMYPVPPKPETQGRTESCIGSWLARTGRRHEVVLASKAAGPVRDAKRPSHIRDGKTFLDRKNLTQALDASLKRLQTDYLDLYQLHWPDRTTNTFGKLAYPWVDDAHTVPIEETLEVLQDFVRAGKVRHVGLSNETPWGVARFLQAAEKHGLPKVATIQNPYNLLNRIFEIGLAEFSHREGVGLLAYSPLAMGILSGKYLDGARPEGSRLALFTRFTRYSNPQAEAAARDYVMLARDHGLAPAQMALAWVNQRPFVSSNLMGATTLAQLKENIESVEVTLSDEVLQGIEAIHARQPNPAP
>CP025348.1|AZW87719.1|1002708_1003725_-|IS110-family-transposase-IS1663
MADSSLLSAGGQVHVFIGIDVSKAKLDCTLLTAEADKCKTKVVVNTAAGVQALLAWCAKHGAQPAQLHAILEPTGLYHEQAATALPQVRVSLVNPAQARDFAKALALRSKNDALDSYVLARYGQTLSPALWHPAPLHARQLRALLTRREALSKDLLRELNRKEKSQFSPSAPLVDGSIDKAIAFLREQIKQIERAIDQHIDNHPDLKQDCELLNSIPAIGPQAGNAILAVMHNRHIDSAQSLAAYLGVVPVQRQSGSSLNSCARLSKAGPSQVRATLYMAALVGTRHNPHIRALYQRLLKAGKSKKAALGAAMRKLVHLCFGVLKNRIPYQPNYAMNG
>CP025348.1|AZW85147.1|1005233_1005806_-|chorismate--pyruvate-lyase
MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRLRVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGMRRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFWRAGQPLLVAECFLPAFWSLARAPVAPR
>CP025348.1|AZW85148.1|1005865_1006597_+|rRNA-pseudouridine-synthase
MEKVRISKLMSERGLCSRREADSYIERGWVRVDGVVVSELGARALPDQVITLERAAAARQTARVTILLHKPVGYVSGQAEKGYTPAVALIDARSRYAGDRAPQRFERGQLQGLAVAGRLDIDSQGLLVLTQDGRIAKKLIGEDSEVDKEYLVRVQGRLSEAGLALLNHGLSLDGKPLRPAQVRWQNADQLRFVLREGKKRQIRRMCELVGLRVVGLKRVRIGRVSLGDLPAGQWRYLRADERF
>CP025348.1|AZW87720.1|1006648_1007566_-|LysR-family-transcriptional-regulator
MELFVEVARTLSFGRAAENLAIPKSTLSRQVAELERSVGLRLLSRTTRRVELTEAGQLYFERCQRIVAEARIAHEELQNLVETPSGPLRVNMPADFGTDFLSEAFTEFSRRYPEVTFYLDLASPEHAERVFQTCDVSIEIGDLPDSTHIARLLGVLPAHLYASPDYLARHGEPQHPDDLPRHECIQFRAGTGRVTRWPLNSGERHVEITPGNRFSVNSVSMVRNLATLGAGIAILAPMGNVREDIESGRLKRILPDWLAGPFPVYAVTDTRMLPAKTRIFVEFLMERLSNKTLAGQNNPAFLNLR
>CP025348.1|AZW85149.1|1008373_1011553_+|multidrug-efflux-RND-transporter-permease-subunit
MAKFFIDRPVFAWVIAIVLMMAGALSILSLPVAQYPNIAPPAISINVTYPGASAQTVQDTVVQVIEQQMNGIDNLQYISSESNSDGSMSITLTFSQGTNPDTAQVQVQNKLAVAQPLLPLEVQQQGIRVTKATKNFLIVAGFVSTDGTMDKSDLADYVASYIQDPISRTPGVGNFQLFGAPYAMRIWISPEKLVNFGLTASDVTTAIREQNVQVSSGQLGGQPAVRGQQLNATVIGPSRLQTPEAFGRILLKVNRDGSQVRLKDVASIELGAQTYAIDSYYNGKPASGLAIKLASGANALDTAQAVRETINGLKPYFPPGMDVVYPYDTTPFVSLSIEGVVKTLFEAVLLVFLVMYLFLQNVRATLIPTLAVPVVLLGTFGVLAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVMAEEGLSPRQATRKSMGQITGALIGIAMVLAAVFVPMAFFGGSTGVIYRQFSITIVSSMVLSVVVAIVFTPALCATMLKPIPKGHHGSKKGFFGWFNRTFERSSQAYANNVARSMGRTKRLLLIYVVILLGMAWMFMRIPTAFLPDEDQGILFAQVQAPAGATSERTQATIDAAVKYLLEDEKESVASVFAVNGFSFGGRGQNAAILFIKLRDWNERKGAEHRAAAVAARANAKFRAELRDAQAAVFAPPAVMELGNATGFDFQLQDRAGVGHEKLLAARNQLLQEAGASPMLVAVRPNGIEDAPQYQLDIDREKARALGVSITEINNTLATAWGSSYVNDFIDRGRVKKVFVQGEASSRMLPQDLDKWYVRNNAGDMVPFSAFSSAQWTFGPQKLNRYNGVPSYNIQGQAAPGYSSGDAMAEMERLADKLPLGIGYDWTGLSFEERLSGAQAPALYAISLIVVFLCLAALYESWSIPTAVMLVVPLGVVGALLATMTRGLSNDVYFQVGLLTTIGLAAKNAILIVEFAKEHYEEGASLTEAAVHAARQRLRPILMTSLAFILGVVPLAISTGAGSGSQNAIGTGVIGGMLTGTFLAIFFVPLFFVLTLRLFKVKRASENREDDDPHGGAQPATHGGQPQ
>CP025348.1|AZW85150.1|1011549_1012932_+|multidrug-transporter
MKPVVMRTLLSLAVATALAGCSLAPTYERPQAPVDAAYPSGPAYGAPGQAAAGAPAAADVGWRDFFGDPLLQELLALSLANNRDLRVAALNVEAARLNPSGQAGISRSYQVGASLSTWELDLFGRIRSLSEQALQLYLAQDETRLATQLTLVAETANAYLTLRADQELLALTRQTLAAQQESYKLTRQSYDLGVATELDLSQAEISLRTAERNLSQYTRMAAQDRNALVLLVGQPLPAGIGAQLDQAVALPDGVVLADLPAGLPSDLLARRPDIRAAEHQLQAANASIGAARAAFFPRISLTGSAGTASASLGGLFDAGSGAWSFAPQISVPIFAGGALRASLDLAKIQKDIGIARYEQAIQSGFREVSDALAGRGTLQEQIRSQELLVQANQRAYDLSQQRYQQGIDNYLSVLDSQRSLYTAQQTLVETRLARLSNLIQLYKALGGGWSERTVAAAQAG
>CP025348.1|AZW85151.1|1013001_1013253_-|GlsB/YeaQ/YmgE-family-stress-response-membrane-protein
MNIIIMIIVGFVVGLITRAIMPGDQNMGYIMTTILGIIGSVVAGFLGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP025348_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP025348_4

3432492-3432601

Orphan

Consensus_repeat	Method
TTGACTGCCAAGACGGTATCTGTCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP025348_4

>merge|CP025348|4|3432492-3432601|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCCGCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGCTTGACGGCCAAGACGGTATCTGTCCCC

>CP025348|4|4|3432492-3432601|CRISPRCasFinder
TTGACTGCCAAGACGGTATCTGTCCCC	GCAGGGAGGGTGCCTGTCCCCGCCGGGACAGGCACACTGCTGTACGCCATCGACGC
TTGACGGCCAAGACGGTATCTGTCCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP025348.1\|AZW87102.1\|3444856_3445672_+\|septum-site-determining-protein-MinD	unknown	unknown	gnl\|CDD\|225447
CP025348.1\|AZW87100.1\|3441990_3443754_+\|glutamine--tRNA-ligase	unknown	unknown	gnl\|CDD\|235424
CP025348.1\|AZW87092.1\|3430453_3431239_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	unknown	unknown	gnl\|CDD\|180789
CP025348.1\|AZW87101.1\|3443865_3444744_+\|septum-site-determining-protein-MinC	unknown	unknown	gnl\|CDD\|178806
CP025348.1\|AZW87085.1\|3419158_3422137_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375438
CP025348.1\|AZW87099.1\|3440534_3441875_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
CP025348.1\|AZW87088.1\|3426837_3427305_-\|ribonuclease-HI	unknown	unknown	gnl\|CDD\|178927
CP025348.1\|AZW87094.1\|3433132_3433813_+\|DUF533-domain-containing-protein	unknown	unknown	gnl\|CDD\|377342
CP025348.1\|AZW87095.1\|3433817_3434816_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
CP025348.1\|AZW87098.1\|3438040_3439465_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|236531
CP025348.1\|AZW87087.1\|3425890_3426841_+\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025348.1\|AZW87084.1\|3418791_3419160_-\|hypothetical-protein	unknown	unknown	unknown
CP025348.1\|AZW87093.1\|3432602_3432995_-\|OsmC-family-peroxiredoxin	unknown	unknown	gnl\|CDD\|224679
CP025348.1\|AZW87086.1\|3423063_3423942_+\|fatty-acid-desaturase	unknown	unknown	gnl\|CDD\|366126
CP025348.1\|AZW87097.1\|3437339_3438041_+\|DNA-binding-response-regulator	unknown	unknown	gnl\|CDD\|181883
CP025348.1\|AZW87090.1\|3428138_3428939_+\|hydroxyacylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|274569
CP025348.1\|AZW87089.1\|3427347_3428118_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP025348.1\|AZW87083.1\|3417854_3418805_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025348.1\|AZW87096.1\|3434884_3435835_-\|IS481-family-transposase	unknown	unknown	gnl\|CDD\|366234
CP025348.1\|AZW87091.1\|3428949_3430359_+\|lytic-transglycosylase	unknown	unknown	gnl\|CDD\|182727

Protein	Function_ID	Function_description	E-value
CP025348.1\|AZW87102.1\|3444856_3445672_+\|septum-site-determining-protein-MinD	gnl\|CDD\|225447	COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].	7.6448e-163
CP025348.1\|AZW87091.1\|3428949_3430359_+\|lytic-transglycosylase	gnl\|CDD\|182727	PRK10783, mltD, membrane-bound lytic murein transglycosylase D; Provisional.	5.28635e-76
CP025348.1\|AZW87092.1\|3430453_3431239_+\|enoyl-[acyl-carrier-protein]-reductase-FabI	gnl\|CDD\|180789	PRK06997, PRK06997, enoyl-[acyl-carrier-protein] reductase FabI.	1.22848e-177
CP025348.1\|AZW87101.1\|3443865_3444744_+\|septum-site-determining-protein-MinC	gnl\|CDD\|178806	PRK00030, minC, septum site-determining protein MinC.	3.47756e-166
CP025348.1\|AZW87085.1\|3419158_3422137_+\|hypothetical-protein	gnl\|CDD\|375438	pfam17936, Big_6, Bacterial Ig domain. This domain is found in a wide variety of extracellular bacterial proteins often in multiple tandem copies.	1.32844e-07
CP025348.1\|AZW87099.1\|3440534_3441875_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	2.21087e-123
CP025348.1\|AZW87088.1\|3426837_3427305_-\|ribonuclease-HI	gnl\|CDD\|178927	PRK00203, rnhA, ribonuclease H; Reviewed.	4.07937e-102
CP025348.1\|AZW87095.1\|3433817_3434816_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	7.76869e-129
CP025348.1\|AZW87100.1\|3441990_3443754_+\|glutamine--tRNA-ligase	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
CP025348.1\|AZW87087.1\|3425890_3426841_+\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025348.1\|AZW87098.1\|3438040_3439465_+\|ATP-binding-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	3.78414e-42
CP025348.1\|AZW87093.1\|3432602_3432995_-\|OsmC-family-peroxiredoxin	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	4.86152e-16
CP025348.1\|AZW87086.1\|3423063_3423942_+\|fatty-acid-desaturase	gnl\|CDD\|366126	pfam00487, FA_desaturase, Fatty acid desaturase.	2.20669e-12
CP025348.1\|AZW87097.1\|3437339_3438041_+\|DNA-binding-response-regulator	gnl\|CDD\|181883	PRK09468, ompR, osmolarity response regulator; Provisional.	4.05363e-90
CP025348.1\|AZW87090.1\|3428138_3428939_+\|hydroxyacylglutathione-hydrolase	gnl\|CDD\|274569	TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase. Members of this protein family are hydroxyacylglutathione hydrolase, a detoxification enzyme known as glyoxalase II. It follows lactoylglutathione lyase, or glyoxalase I, and acts to remove the toxic metabolite methylglyoxal and related compounds. This protein belongs to the broader metallo-beta-lactamase family (pfam00753). [Cellular processes, Detoxification].	2.85848e-146
CP025348.1\|AZW87089.1\|3427347_3428118_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	9.0439e-10
CP025348.1\|AZW87083.1\|3417854_3418805_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	9.05216e-23
CP025348.1\|AZW87096.1\|3434884_3435835_-\|IS481-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	7.3142e-23
CP025348.1\|AZW87094.1\|3433132_3433813_+\|DUF533-domain-containing-protein	gnl\|CDD\|377342	pfam04391, DUF533, Protein of unknown function (DUF533). Some family members may be secreted or integral membrane proteins.	5.6465e-62

>CP025348.1|AZW87092.1|3430453_3431239_+|enoyl-[acyl-carrier-protein]-reductase-FabI
MGFLAGKRILMTGVLSNRSIAYGIARACRDQGADLAFTYVGDRFKERITEFAASFGSDIVLPCDVAEDSQIDAAFAELGKRWDGLDGLVHAIGFAPREAIAGDFLDGLSRENFRIAHDISAYSFPAMAKAALPLMEGRKGSVLTLSYLGSERVVANYNTMGLAKASLEASVRYLATALGPRGIRANAISAGPIKTLAASGIKDFSSILKFVEANAPLRRNVTIEDVGNVAAFMLSDLAAGITGEITHVDAGFSTVVPGMEN
>CP025348.1|AZW87091.1|3428949_3430359_+|lytic-transglycosylase
MRFLRLLLPLFLAVLAGCAGTAKQNQAAGPSSNRYIAQDTSRTVDLTSPPSDAWDRIRRGFAIPNLNTDLAQEWTDYYASHPESVQRMAERAGKYLYFIVDEINRRGLPTELALLPFVESAYNPTALSRSQASGLWQFIPTTGQHFNLKQDWWRDERRDPIASTYAALDYLEKLFEMQGDWYLALASYNWGEGSVQRAMAKNEAAGLSTDYLSLNMPDETRNYVPKLQAIKNIIANPRKFAVVLPPVENTPYFVAVQKNRDIDIELAARLAEMPLDEFKALNPAFNRPLIRGEHAPTLLLPADRADRFNANLQNYKGDLSSWKVYHTRRGESYAAIAKRFGISEAKLRASNDIGSKRKVAADQALLIPGVPSGDGAANIQLASLSPPVGALDNVGEPRAAAAPRGKAPARVASARPNVRTHKVSSGDTLFGLARKYGTSVGALRALNNLKGNNLKLGSQLRIPGTGTRG
>CP025348.1|AZW87090.1|3428138_3428939_+|hydroxyacylglutathione-hydrolase
MQTAPPLSAVVPLPAFSDNYIWALAHEGQAAVVDPGDAAPVLRWLRATGATLRAILLTHHHPDHVGGVLELVQATGATVYGPAGETLPHCDVRLAEGDRVTLPELALALEVLDVPGHTAGHIAYTGRAAGVERVLFCGDTLFAGGCGRLFEGTPAQMLDSLEKLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQERETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNFK
>CP025348.1|AZW87089.1|3427347_3428118_-|class-I-SAM-dependent-methyltransferase
MAEETPPIVELAEWFQTPPGQYVLAWEQAQFDEAVADIFGYYAWQVGLAEPNLLRANRMPFKAWVGAGVPPPELAQGWQACVAAAPEALPFESQSVDLLVLPHAFECAEAPHLVLREVERVLVPEGRVVISGFNPWSLWGARNLMPGMEAWLPLPLSAQVALPRLKDWFKLLSFEVERGRFGCYAPACRTDKWLRRWRFMERYGQRWWGLGGAVYVVTATKKVAAMRLIGPAWKTRRKRAQAASVVVNRQADDPGR
>CP025348.1|AZW87088.1|3426837_3427305_-|ribonuclease-HI
MQNLEGSGDGQQVEMWTDGACKGNPGPGGWGVLMRAGQHEKTMHGGERQTTNNRMELMAVIEGLRALKRPCRVTIHTDSQYVMKGMTEWLANWKRRGWRTADKKPVKNVELWQALDEQVGRHQVQWRWVRGHAGDPGNERADALANQGMEAARGR
>CP025348.1|AZW87087.1|3425890_3426841_+|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025348.1|AZW87086.1|3423063_3423942_+|fatty-acid-desaturase
MVRPAEWLRHRRDWQSVLYLAALPALAAWQWVHGWHWALYAPMLFLTLGVGVIHHNHAHRRMWRPRWLNRLTDFWLTLLQGHPTFVFHAAHNANHHRYKHGPRDVARTYRFGGDTNHLAGYLLHPLQAVVVLYPLFLASLRRLRSRRPGVWRYCLRQYAAWLGLWGGLLALDPGKAFWLVIVPQLHGLHWLLATNYLQHAHADGGPGRHAALSYARNFEGWVNPLLFNIGLHTAHHENPRAHWSELRALHWQHYRDRVPSRLNERGLAPYMARVFVLGLFSRRCRTHTLMRP
>CP025348.1|AZW87085.1|3419158_3422137_+|hypothetical-protein
MQLWLPDGTATSVRANAAGGFEASSAGDMTSGLIRARATDRYGDTSQEVTYAYTDTVDKTAPVLSIAGVATDEATGRVTVTGRSEPDAQVTIRFPGGGRKTVRADANGAYRVRSDGDLPAGVIVVQAADAAGNSTQAQQAYQDTVDRTAPEPVQIALDTDAATGRLTVSGQAEPGGSVTVTWPDGTTQTVRVDADGGFRVTSAGDAAQGDVVVVVADQAGNRAAPVRAHYADPVDRTAPMTPTVRHATDAQTGRVTVMGRTEAGALVTVQFPDGSSKTVRAQNDGGYAATSDTDMVSGPIVVSAGDADGNRTPAQQVMYTDTLDKTAPASPSLTVREDAASGRATVTGQAEPGAAVRVVFPNGEAQTVTAGSDGAYSVTSTADMVAGEITVVAADASGNQSAPARTVFADAVDKTAPAAPTLALSEAADSGRLTVSGRTEPGASVRVTFPDGETVTVTAKADGTYTATSRADMIGGNVTVVATDTAGNAAAPVRAAYADTVDRTPPVLDTPVLNVASDSGRVTVTGVTEPGARVQVAIPGESLQTVTADSAGRYRAVSPGDVLQSGTVRVIATDAHGNASAPRDVPYQDAVDRTAPPLTIEAAVEQARTGVVNVSGKTEPNLMVSATFPDGQTAQARADGQGRYQLASPADVARSGRIAVSASDAAGNRAAARAEFTDQVDKTAPAVTIRAVTEQAGTGVATVSGATEPGATVSVTFPDGQVARATADRSGAYTVHSARDVTARGNISVIATDAAGNASPSVSRQFSNTVADTVPPSLTIAMVTTDPGNGRITVSGVTEAGARVHVVFPGGASDTVTADSKGGYRATSAGDVGSGAVTAQATDASANRSPLKTYAYTDAWQPRQLSAKDFSQSRYFVPLTTRGGTDNEPLLRITTNQQIPTAELRVALKPYKTEDRAGRLVREAITLKWGNAPGVGGDARALHFYVPDSAKAKLRKELTEVERSNDYKFWIEFTDTRFGGVARLYIKVISTL
>CP025348.1|AZW87084.1|3418791_3419160_-|hypothetical-protein
MHVGQGLGDAVHGNAPGGRVGANLGNAQRQDDFLAPRIEHDAVLAPDEILQACAPVEWRGRVLRAAAQLPRQGLAQIQPHAQLDASCEDSIGCMHGSSEPDLRNWKSPPPQFTQGARPDEHP
>CP025348.1|AZW87083.1|3417854_3418805_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWHRPHQGIGRAVPISRLNLDEYNLLTVHT
>CP025348.1|AZW87093.1|3432602_3432995_-|OsmC-family-peroxiredoxin
MTIQVRANTPGGLQYTATAEGHELPLAMPQPQGEGPDPHDYFDTALGGCKALTLMVYAQRKGLPLQAVDVDVVRDASEERKGIYRLTAKLKLHGDLDDAQIDELLKVADKCPLHKLMTATDIQVSTIVVE
>CP025348.1|AZW87094.1|3433132_3433813_+|DUF533-domain-containing-protein
MSARQLLDQLLQSGQSLMQGAGAQAQQATQGGKGTFLAGLGGGALGAGALGLLLGSKKARKIGGKVAMYGGMAALGALAYRAYDQYQRNQAGGAAAPAPQTLDRLPPAPAEQHSNAVLVAMIGAAKADGHIGPDERQLLETELAKLSGDAGDRAWLEAELARPLDPAVIAQQARTPEMGAEMYLASLLVADEQSFMERAYLDELARQLKLPAELKQQLEAQVPAAA
>CP025348.1|AZW87095.1|3433817_3434816_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRPVAPMTTMKSQVSILLAGCLLGAGAAAAQAPATYPDHAITIVVTFPPGGGTDLLARKLGAAMQQRLGQPVVVENRPGASGNIGARAVAEARPDGYTLLMVNSSFAVNPGVFRNLDFSPTRDFTAVINVAYVPSVIVTAEPAGDAGLPERLRQADTQSRTLAFASCGNGTPQHLAGEMLRQASGAWLQHVPYRGCGPALTDVLSRQVPLGIVTASSAAPFIHAGKLRALAVTSAQRSPLLPDVPTVAEQGAPGYELDQWHGLLAPAGTPPAVIQRLYEALSAIVAEPAMRRELESLGFNPVSEGPERFEALVQADIARFAALTARMGLRAD
>CP025348.1|AZW87096.1|3434884_3435835_-|IS481-family-transposase
MNTHKHARLTFLRRLEMVQQLIAHQVCVPEAARAYGVTAPTVRKWLGRFLAQGQAGLADASSRPTVSPRAIAPAKALAIVELRRKRLTQARIAQALGVSASTVSRVLARAGLSHLADLEPAEPVVRYEHQAPGDLLHIDIKKLGRIQRPGHRVTGNRRDTVEGAGWDFVFVAIDDHARVAFTDIHPDERFPSAVQFLKDAVAYYQRLGVTIQRLLTDNGSAFRSRAFAALCHELGIKHRFTRPYRPQTNGKAERFIQSALREWAYAHTYQNSQHRADAMKSWLHHYNWQRPHQGIGRAVPISRLNLDEYNLLTVHS
>CP025348.1|AZW87097.1|3437339_3438041_+|DNA-binding-response-regulator
MDNPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDASDLAARITRYAPDLLVLDRMLPGGDGADACRRLRDQGEDIPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAVLRRKRGPSALTKDAPVSFGPFVFDPATRQLLRDDTPVKLTGGEINLLEALVRNAGKPLSRERLLALARDDDGGERNDRAIDIAILRLRRAIEEDPKQPRWIQTVWGIGYRFSP
>CP025348.1|AZW87098.1|3438040_3439465_+|ATP-binding-protein
MKLLRLPAPRSLRMRLILLVLGSVLLAQAATLATVSYFRHKFMEDVAIDYIATTIRTLRASLSQVPTDERAEFVRQASGNQWRLWSRSLPADARLQRWHRGPQEDEAERERMRREYERRHPPPDDIRRDLRGLVSELNERLSDGTRVALSRGPRPEIFISLAPSPSPDDAPPLREWLVIPLERLDPPVATPLIAFWVGGIGLVLLLAAWFSWHITRPLTRLADAADQLAAGQPQRVEPSGPHETRVLGERFNAMLDALAESDSVRRTLLSGLPHDLKGPLSRMWLRIEMADDPTLKEGLRKDLQDMQHMVDQFIGFVRGTDPAAYRYAPLALGEWLAERVGAWQGAGTDIRLQAPDNGALGIQADAVALGRLLDNLIGNALHHGAPPVEVSLRRDADMAVLEVSDHGPGIAPERRTEALRPFARLDDARTRTGNVGLGLALAEAIARAHGGGLELRQAPSGGLLVRITLPLAKA
>CP025348.1|AZW87099.1|3440534_3441875_-|cytochrome-ubiquinol-oxidase-subunit-I
MNIPPLLLARAQFTASLGFLALFLAISLALAWLLLFFKLRARWSGQSGWTAAYRFWVRIFALAFVLALACAVPVLIQLGSLWSGLMDKIGNLAGPLLGYGVLSIFIVKSCFLGVMLFGQRRVSDAAHTLAVLMVAIGQLVAVGWVLALFSWLQTPDGAVLIDGRYQVYDWRAVVLNPSFGWRLGLTVLGAFLTAGFLMLGVTAMQALRRPLDDGERHAFRAGLTVALLASLLLGPVAAGMGEVTARLQPAKAAAAAGFWHSGAEPELVVFGWPSARAQANLAAVSLAGAGGRWLHRDASLGYLGLDKFSGMQPPVAFTFWSLRLALGLGLLMLAASCATLALTCRRGFDPVALPRWWLRVLSLLMFAGALGVVATWCYDLAGMQPYAVNRAVTQSEVLGPVTTPALLYSLAGHIALYAVLLAAFVGMLFHAARYGVVPVRKTGGSS
>CP025348.1|AZW87100.1|3441990_3443754_+|glutamine--tRNA-ligase
MTHAPTPPAASNFLRPIIEDDLQANRFQGKLWAGKPGPAALQAQGQPDPARIRTRFPPEPNGYLHIGHAKSICVNFGLARDYGGVCHLRFDDTNPEKEEQEYVDAIIEAVHWLGFDWQADGNDNLYFASDYFEFMYEFAEALVQAGHAYVDEQSAEEIRASRGTLTEPGTDSPWRDRPADESLLRLREMRDGKHPDGSLVLRARIDMASPNINLRDPVMYRVRHATHHRTGNAWCIYPMYSWAHPVEDALEGITHSICTLEFEDQRPFYDWILARLAELGKLARPLPHQYEFARLNLTYVVTSKRKLLQLVREGYVDGWDDPRMPTLFGLRRRGYTPSSIRLFCDRTAVSKSDSRIDYSLLEQAVRDDLDPVAPRSVAVLDPLKLVITNYPEGRSETCSAPRNPHDPQAGVREFPFTRELWIEQDDFREEPPKKYFRLFPGNTVRLKYGYVVRCTGFTKDESGKVVEVQAEYLPDTKSGTPGADSVKVKGNITWVSAAHAVPAQVHLYDRLFADAHPDGGDKDFLACLNPNSKQTVQAWLEPGIEAVPGATWQFERLGYFTVDSKDSRPEAPVLNRIVTLRDSWQAA
>CP025348.1|AZW87101.1|3443865_3444744_+|septum-site-determining-protein-MinC
MNTESLALDFKSATLYAIRVVLHDADTTRLRAALDKRMADAGSFFENEPVVIDATRVDAPVDWPALLQALADHNLPPIGVVAEGANLQGARDAGLVPVELSTSVARAPQVIDTAPPNDVATPVPSVPEATAEATAKAGPQDDEADGEQADEAPAHNPESVPTRAARETTEANRPTATPPQSSSALVITKPLRSGQRVYARHTDLIVIGMVSQGAEVIADGNVHVYGPLRGKAMAGARGDTSARIFTTQLDAELLAVAGVYRVVEDKLDRALHNQPALVRLDGDTLRIEALKG
>CP025348.1|AZW87102.1|3444856_3445672_+|septum-site-determining-protein-MinD
MTRIVVVTSGKGGVGKTTTSASFSAGLAMRGHKTAVIDFDVGLRNLDLIMGCERRVVYDFVNVIQGEASLKQALIKDKQLENLFILPASQTRDKDALTQEGVEKVIDELKEMGFDYIVCDSPAGIEAGALMAAYFADDALVVTNPEVSSVRDSDRILGILAAKSRRAVQGDEPVKEYLLLTRYNPKRVNDGEMLSLSDIEDILRIKLIGVIPESEAVLQASNQGLPAIHLKDTDVSEAYKDVVARFLGEERSLRFTDYEKPGLLKRLFGGK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 70443

Natrialba_phage(12.5%)

protease,transposase,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84293.1\|0_1920_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
AZW84294.1\|1916_2609_+	ribosomal RNA small subunit methyltransferase G	NA	NA	NA	NA
AZW84295.1\|2605_3403_+	ParA family protein	Q8JL10	Natrialba_phage	5.6e-20	34.9
AZW84296.1\|3409_4171_+	N-acetyltransferase	NA	NA	NA	NA
AZW84297.1\|4214_5132_+	chromosome partitioning protein ParB	I3NLC2	Bifidobacterium_phage	1.9e-16	38.1
AZW84298.1\|6721_7912_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	3.1e-14	29.2
AZW84299.1\|8150_8531_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AZW84300.1\|8540_9074_+	transcription termination/antitermination protein NusG	G3MAW2	Bacillus_virus	1.4e-11	30.5
AZW84301.1\|9137_9569_+	50S ribosomal protein L11	NA	NA	NA	NA
AZW84302.1\|9571_10270_+	50S ribosomal protein L1	NA	NA	NA	NA
AZW84303.1\|10512_11037_+	50S ribosomal protein L10	NA	NA	NA	NA
AZW84304.1\|11118_11502_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AZW84305.1\|11661_15774_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	2.4e-21	28.8
AZW84306.1\|15773_20018_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	3.5e-68	24.7
AZW87669.1\|20126_20531_-	lipoprotein	NA	NA	NA	NA
AZW84307.1\|20771_21947_+	hypothetical protein	NA	NA	NA	NA
AZW84308.1\|24352_25459_-	peptidoglycan-binding protein	NA	NA	NA	NA
AZW84309.1\|26470_27286_+	DNA-binding response regulator	NA	NA	NA	NA
AZW84310.1\|27282_28233_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84311.1\|28314_28650_-	CoA transferase	NA	NA	NA	NA
AZW84312.1\|28674_29109_-	hypothetical protein	NA	NA	NA	NA
AZW84313.1\|29141_30368_-	thiolase family protein	NA	NA	NA	NA
AZW84314.1\|30364_30862_-	dehydratase	NA	NA	NA	NA
AZW87670.1\|31069_31978_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW84315.1\|32163_33006_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW84316.1\|33048_34470_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW84317.1\|34625_35576_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84318.1\|35572_36763_-	MFS transporter	NA	NA	NA	NA
AZW84319.1\|36949_37924_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
AZW84320.1\|37925_40064_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW84321.1\|40060_40600_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
AZW84322.1\|40603_41332_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW84323.1\|41318_42212_+	M48 family peptidase	NA	NA	NA	NA
AZW84324.1\|42282_42678_+	lactoylglutathione lyase	NA	NA	NA	NA
AZW84325.1\|42687_43218_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.7e-12	35.4
AZW84326.1\|43346_43646_-	DUF1974 domain-containing protein	NA	NA	NA	NA
AZW84327.1\|43663_44614_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84328.1\|45113_45749_+	hypothetical protein	NA	NA	NA	NA
AZW84329.1\|45720_45957_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW84330.1\|46084_46978_+	hypothetical protein	NA	NA	NA	NA
AZW84331.1\|48147_49395_+	homoserine O-acetyltransferase	NA	NA	NA	NA
AZW84332.1\|49391_50006_+	methionine biosynthesis protein MetW	NA	NA	NA	NA
AZW84333.1\|51133_52390_+	MFS transporter	NA	NA	NA	NA
AZW84334.1\|53621_54356_-	aspartate/glutamate racemase family protein	NA	NA	NA	NA
AZW84335.1\|54361_54952_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	33.6
AZW84336.1\|54976_55666_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW84337.1\|55662_56424_-	amino acid ABC transporter permease	NA	NA	NA	NA
AZW84338.1\|56503_57403_-	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW84339.1\|57496_58447_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84340.1\|59247_60474_-	type II toxin-antitoxin system HipA family toxin	NA	NA	NA	NA
AZW84341.1\|60473_60893_-	transcriptional regulator	NA	NA	NA	NA
AZW84342.1\|61076_62018_-	hypothetical protein	NA	NA	NA	NA
AZW84343.1\|62441_63278_-	hypothetical protein	NA	NA	NA	NA
AZW84344.1\|63472_64054_-\|protease	protease	NA	NA	NA	NA
AZW84345.1\|64066_64384_-	ferredoxin	NA	NA	NA	NA
AZW84346.1\|64487_65546_-	oxidoreductase	NA	NA	NA	NA
AZW84347.1\|65580_66852_-	TRAP transporter large permease	NA	NA	NA	NA
AZW84348.1\|67481_68663_-	hypothetical protein	NA	NA	NA	NA
AZW84349.1\|69084_70035_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84350.1\|70128_70443_+\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_2

77633 : 136107

Planktothrix_phage(22.22%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84356.1\|77633_78584_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87672.1\|78658_79603_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84357.1\|79599_81474_-	polysaccharide biosynthesis protein	A0A2P1ELS8	Moumouvirus	2.0e-23	26.9
AZW84358.1\|82821_83526_-	DUF2837 domain-containing protein	NA	NA	NA	NA
AZW84359.1\|83522_84629_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
AZW84360.1\|84890_85484_-	sugar transferase	NA	NA	NA	NA
AZW84361.1\|85480_86713_-	UDP-4-amino-4, 6-dideoxy-N-acetyl-beta-L-altrosamine transaminase	NA	NA	NA	NA
AZW84362.1\|86730_87990_-	glycosyltransferase WbuB	NA	NA	NA	NA
AZW84363.1\|88013_89102_-	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A0N9R0B2	Chrysochromulina_ericina_virus	4.8e-46	36.3
AZW84364.1\|89109_90210_-	aminotransferase DegT	A0A2K9L0G1	Tupanvirus	3.3e-31	29.7
AZW84365.1\|90213_90789_-	N-acetyltransferase	NA	NA	NA	NA
AZW84366.1\|90792_91845_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
AZW84367.1\|91975_92983_+	lipopolysaccharide heptosyltransferase I	NA	NA	NA	NA
AZW84368.1\|92984_94271_+	3-deoxy-D-manno-octulosonic acid transferase	NA	NA	NA	NA
AZW84369.1\|94287_94443_-	hypothetical protein	NA	NA	NA	NA
AZW84370.1\|94467_95271_-	type III pantothenate kinase	NA	NA	NA	NA
AZW84371.1\|95267_96134_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
AZW84372.1\|96202_97339_+	ABC transporter permease	NA	NA	NA	NA
AZW84373.1\|97338_98178_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-21	32.4
AZW84374.1\|99110_99713_+	hypothetical protein	NA	NA	NA	NA
AZW84375.1\|99742_100396_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW84376.1\|100528_101785_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	6.2e-66	40.5
AZW84377.1\|101787_102732_+	D-amino acid aminotransferase	NA	NA	NA	NA
AZW84378.1\|102807_103083_+	DUF493 domain-containing protein	NA	NA	NA	NA
AZW84379.1\|103090_103753_+	octanoyltransferase	NA	NA	NA	NA
AZW84380.1\|103814_104816_+	lipoyl synthase	NA	NA	NA	NA
AZW84381.1\|104830_105379_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.7e-47	53.4
AZW84382.1\|105436_106333_-	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
AZW84383.1\|106329_107391_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.6e-78	44.8
AZW84384.1\|107426_108377_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84385.1\|109276_110470_+	cystathionine beta-lyase	NA	NA	NA	NA
AZW84386.1\|110551_111181_-	thiol:disulfide interchange protein DsbA	NA	NA	NA	NA
AZW84387.1\|111242_111926_-	SPOR domain-containing protein	NA	NA	NA	NA
AZW84388.1\|111935_113618_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
AZW87673.1\|113905_114253_+	DUF1840 domain-containing protein	NA	NA	NA	NA
AZW84389.1\|114343_114661_+	hypothetical protein	NA	NA	NA	NA
AZW87674.1\|114943_115960_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW84390.1\|116035_116836_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW84391.1\|116832_117708_-	sugar ABC transporter permease	NA	NA	NA	NA
AZW84392.1\|117718_119011_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW84393.1\|119053_120094_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-22	33.7
AZW84394.1\|120199_121021_-	phosphodiesterase	NA	NA	NA	NA
AZW84395.1\|121121_122072_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84396.1\|122170_123076_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-21	31.7
AZW84397.1\|123072_123906_-	ABC transporter permease	NA	NA	NA	NA
AZW87675.1\|124742_125753_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87676.1\|125749_126139_-	hypothetical protein	NA	NA	NA	NA
AZW87677.1\|127032_128286_+	amidase	NA	NA	NA	NA
AZW84398.1\|128376_130077_-	2-isopropylmalate synthase	NA	NA	NA	NA
AZW84399.1\|130503_131151_-	hypothetical protein	NA	NA	NA	NA
AZW84400.1\|131149_132589_+	RNA polymerase sigma-54 factor	NA	NA	NA	NA
AZW84401.1\|132681_132984_+	bacterioferritin-associated ferredoxin	NA	NA	NA	NA
AZW84402.1\|133011_133890_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW84403.1\|135156_136107_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

164892 : 225403

Diachasmimorpha_longicaudata_entomopoxvirus(11.11%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84426.1\|164892_165843_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84427.1\|167286_168189_-	hypothetical protein	NA	NA	NA	NA
AZW84428.1\|168166_168796_-	LemA family protein	NA	NA	NA	NA
AZW84429.1\|169126_170509_+	RNA helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.3e-42	29.5
AZW84430.1\|170542_171172_+	threonine transporter RhtB	NA	NA	NA	NA
AZW84431.1\|171220_172828_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	9.3e-14	37.8
AZW84432.1\|172852_173536_+	hypothetical protein	NA	NA	NA	NA
AZW87680.1\|173617_174094_-	bacterioferritin	NA	NA	NA	NA
AZW84433.1\|174300_175251_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84434.1\|176366_176894_+	lipoprotein	NA	NA	NA	NA
AZW84435.1\|176985_177801_+	lipoprotein	NA	NA	NA	NA
AZW84436.1\|177861_178596_+	sulfurtransferase	NA	NA	NA	NA
AZW84437.1\|178633_180712_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.5e-27	23.6
AZW84438.1\|180961_181234_-	hypothetical protein	NA	NA	NA	NA
AZW84439.1\|181332_182421_+	iron-sulfur cluster carrier protein ApbC	NA	NA	NA	NA
AZW84440.1\|182424_184329_+	outer membrane protein assembly factor	NA	NA	NA	NA
AZW84441.1\|184325_188000_+	DUF490 domain-containing protein	NA	NA	NA	NA
AZW84442.1\|188060_188624_+	dCTP deaminase	S5VM63	Pseudomonas_phage	2.6e-72	75.3
AZW84443.1\|188631_189054_-	glyoxalase	NA	NA	NA	NA
AZW84444.1\|189081_189501_-	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
AZW87681.1\|189529_189976_-	N-acetyltransferase	Q9AZG4	Lactococcus_phage	1.2e-08	29.4
AZW84445.1\|190102_190600_+	hypothetical protein	NA	NA	NA	NA
AZW84446.1\|190754_193025_+	lysine decarboxylase	NA	NA	NA	NA
AZW84447.1\|193073_194306_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW84448.1\|194404_195355_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84449.1\|195400_196093_+	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	2.4e-83	73.8
AZW84450.1\|196089_196983_+	ZIP family metal transporter	NA	NA	NA	NA
AZW84451.1\|197377_198478_+	aminomethyltransferase	NA	NA	NA	NA
AZW84452.1\|198559_198934_+	glycine cleavage system protein H	NA	NA	NA	NA
AZW84453.1\|198993_201858_+	glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.2e-261	51.4
AZW84454.1\|202002_202743_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW84455.1\|202812_204024_+	CoA transferase	NA	NA	NA	NA
AZW84456.1\|204052_205021_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84457.1\|205634_206585_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84458.1\|206741_207065_+	PsiF repeat family protein	NA	NA	NA	NA
AZW84459.1\|207169_208219_-	cyclase	NA	NA	NA	NA
AZW84460.1\|208215_209040_-	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AZW84461.1\|209040_209337_-	YciI family protein	NA	NA	NA	NA
AZW84462.1\|209362_209638_-	muconolactone delta-isomerase	NA	NA	NA	NA
AZW84463.1\|209694_210339_-	CoA transferase subunit B	NA	NA	NA	NA
AZW84464.1\|210338_211025_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW87682.1\|211154_212006_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW84465.1\|212056_212782_-	short-chain dehydrogenase	NA	NA	NA	NA
AZW84466.1\|212813_214163_-	short-chain fatty acid transporter	NA	NA	NA	NA
AZW84467.1\|214274_215207_-	3-hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
AZW84468.1\|215664_218460_-\|protease	serine protease autotransporter SphB1	NA	NA	NA	NA
AZW84469.1\|219053_221996_-	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
AZW84470.1\|222067_222787_+	7-cyano-7-deazaguanine synthase QueC	A0A0A0RPC6	Escherichia_phage	8.0e-50	43.9
AZW84471.1\|222825_223374_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	41.7
AZW84472.1\|223528_224428_+	virginiamycin B lyase	NA	NA	NA	NA
AZW84473.1\|224452_225403_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

233334 : 287971

Bacillus_phage(25.0%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84480.1\|233334_234285_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84481.1\|234371_235322_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84482.1\|235318_236269_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84483.1\|236367_237165_-	beta-D-hydroxybutyrate dehydrogenase	NA	NA	NA	NA
AZW84484.1\|238114_238525_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AZW84485.1\|239546_240290_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW84486.1\|240333_241377_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW84487.1\|241547_243650_+	hypothetical protein	NA	NA	NA	NA
AZW84488.1\|245060_246017_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84489.1\|246035_246527_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZW84490.1\|246523_247879_-	polynucleotide adenylyltransferase PcnB	A0A1B1IVF3	uncultured_Mediterranean_phage	3.4e-25	36.8
AZW84491.1\|247879_248578_-	HAD-IB family hydrolase	NA	NA	NA	NA
AZW84492.1\|248574_249276_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
AZW84493.1\|249528_250578_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.6e-68	43.6
AZW84494.1\|250683_251625_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
AZW84495.1\|251621_253511_-	DNA mismatch repair protein MutL	A0A1B2LRQ5	Wolbachia_phage	3.3e-79	32.8
AZW84496.1\|253597_254236_+	hypothetical protein	NA	NA	NA	NA
AZW87683.1\|254378_255623_-	N-acetylmuramoyl-L-alanine amidase	A0A2H4JCM7	uncultured_Caudovirales_phage	4.1e-17	30.3
AZW84497.1\|255694_256231_-\|tRNA	bifunctional alanine racemase/tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
AZW84498.1\|256382_257774_+	class II fumarate hydratase	NA	NA	NA	NA
AZW84499.1\|257790_258771_-	AEC family transporter	NA	NA	NA	NA
AZW84500.1\|258906_259890_+	tripartite tricarboxylate transporter substrate binding protein BugE	NA	NA	NA	NA
AZW84501.1\|259954_260854_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW84502.1\|260960_262715_+	gamma-glutamyltransferase	NA	NA	NA	NA
AZW84503.1\|262722_263847_-	CoA transferase	NA	NA	NA	NA
AZW84504.1\|263860_264841_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84505.1\|265571_266522_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84506.1\|267081_267627_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
AZW84507.1\|267710_269330_+	cytochrome d ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW84508.1\|269345_270500_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AZW84509.1\|270513_270639_+	cytochrome bd-I oxidase subunit CydX	NA	NA	NA	NA
AZW84510.1\|270635_272387_+	thiol reductant ABC exporter subunit CydD	W8CYL7	Bacillus_phage	3.4e-09	23.8
AZW84511.1\|272383_274063_+	thiol reductant ABC exporter subunit CydC	W8CYL7	Bacillus_phage	3.6e-16	27.6
AZW84512.1\|274098_274674_+	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.4e-28	43.1
AZW84513.1\|275816_276095_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW84514.1\|277138_278089_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84515.1\|278187_279138_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84516.1\|279124_279340_-	hypothetical protein	NA	NA	NA	NA
AZW84517.1\|279415_279577_+	DUF4224 domain-containing protein	NA	NA	NA	NA
AZW84518.1\|279584_279725_+	hypothetical protein	NA	NA	NA	NA
AZW84519.1\|280243_280693_-\|protease	ClpXP protease specificity-enhancing factor	NA	NA	NA	NA
AZW84520.1\|280702_281314_-	glutathione S-transferase	NA	NA	NA	NA
AZW84521.1\|281472_282327_-	cytochrome c1	NA	NA	NA	NA
AZW84522.1\|282346_283729_-	cytochrome b	NA	NA	NA	NA
AZW84523.1\|283793_284435_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
AZW84524.1\|284574_285033_+	large conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
AZW84525.1\|285057_285834_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
AZW87684.1\|285887_287024_+	PDZ domain-containing protein	W5SAB9	Pithovirus	1.2e-07	31.2
AZW84526.1\|287020_287971_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_5

391904 : 449413

Orpheovirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84625.1\|391904_392855_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84626.1\|392991_393909_+	reductase	NA	NA	NA	NA
AZW84627.1\|393905_394154_+	glutaredoxin family protein	NA	NA	NA	NA
AZW84628.1\|394150_395356_+	CoA transferase	NA	NA	NA	NA
AZW84629.1\|395428_396424_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84630.1\|396446_397667_-	CoA transferase	NA	NA	NA	NA
AZW84631.1\|397663_398308_-	hypothetical protein	NA	NA	NA	NA
AZW84632.1\|400038_400848_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW87690.1\|401065_402106_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	6.1e-59	42.5
AZW84633.1\|402204_403188_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84634.1\|403114_403816_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84635.1\|403864_404635_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW84636.1\|404631_405873_-	CoA transferase	NA	NA	NA	NA
AZW84637.1\|405977_407684_-	thiamine pyrophosphate-binding protein	NA	NA	NA	NA
AZW84638.1\|407680_408577_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW84639.1\|408617_410207_-	sulfurtransferase	NA	NA	NA	NA
AZW84640.1\|410256_411249_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84641.1\|411317_411917_-	hypothetical protein	NA	NA	NA	NA
AZW87691.1\|412377_413355_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84642.1\|413433_414384_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84643.1\|414472_415387_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW84644.1\|415383_416043_+	LysE family translocator	NA	NA	NA	NA
AZW84645.1\|416132_417056_+	alpha/beta hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	4.8e-07	27.2
AZW84646.1\|417061_417517_-	hypothetical protein	NA	NA	NA	NA
AZW84647.1\|417513_418617_-	ChbG/HpnK family deacetylase	NA	NA	NA	NA
AZW87692.1\|418536_418845_+	GtrA family protein	NA	NA	NA	NA
AZW84648.1\|418804_420424_-	phospholipid carrier-dependent glycosyltransferase	NA	NA	NA	NA
AZW84649.1\|420420_421479_-	glycosyltransferase	I1TED8	Salmonella_phage	2.8e-59	40.5
AZW84650.1\|421608_422103_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW84651.1\|422195_423173_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84652.1\|423368_424574_+	sodium/glutamate symporter	NA	NA	NA	NA
AZW84653.1\|424570_426082_+	TRAP transporter substrate-binding protein	NA	NA	NA	NA
AZW87693.1\|426097_427411_-	short-chain fatty acids transporter	NA	NA	NA	NA
AZW84654.1\|427601_427781_-	hypothetical protein	NA	NA	NA	NA
AZW84655.1\|428190_428925_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.4e-41	43.8
AZW84656.1\|431369_432320_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84657.1\|432451_432850_-	elongation factor G	E4ZFJ7	Streptococcus_phage	9.0e-19	44.3
AZW84658.1\|433260_433731_-	universal stress protein	NA	NA	NA	NA
AZW84659.1\|433819_434164_-	TIGR01244 family phosphatase	NA	NA	NA	NA
AZW84660.1\|434263_435664_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW84661.1\|437452_437971_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	2.1e-12	38.9
AZW84662.1\|438081_438837_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	2.9e-42	40.8
AZW84663.1\|439032_440265_+	CoA transferase	NA	NA	NA	NA
AZW84664.1\|440257_441043_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW84665.1\|441109_442081_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84666.1\|442091_443069_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW84667.1\|443194_444367_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW84668.1\|444393_445422_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW84669.1\|445487_446681_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
AZW84670.1\|448462_449413_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

621849 : 723362

111

Bacillus_phage(10.71%)

tail,transposase,terminase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84822.1\|621849_622800_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84823.1\|623498_623882_+	hypothetical protein	NA	NA	NA	NA
AZW84824.1\|623939_624542_+	DUF2946 domain-containing protein	NA	NA	NA	NA
AZW87699.1\|624559_624961_-	DoxX family protein	NA	NA	NA	NA
AZW87700.1\|625094_625988_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW84825.1\|625984_626566_+	NUDIX hydrolase	NA	NA	NA	NA
AZW84826.1\|627360_628095_+	arginyltransferase	NA	NA	NA	NA
AZW84827.1\|628135_629185_+	dihydroorotate dehydrogenase (quinone)	NA	NA	NA	NA
AZW84828.1\|629332_629911_-	Phasin (PHA-granule associated protein)	NA	NA	NA	NA
AZW84829.1\|630297_631275_+	tripartite tricarboxylate transporter substrate binding protein BugD	NA	NA	NA	NA
AZW84830.1\|631368_635763_-	dermonecrotic toxin	NA	NA	NA	NA
AZW84831.1\|635963_636812_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW84832.1\|636970_637783_-	competence/damage-inducible protein A	NA	NA	NA	NA
AZW84833.1\|637838_638789_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84834.1\|638887_639688_-	hypothetical protein	NA	NA	NA	NA
AZW84835.1\|639749_640133_+	thioredoxin	NA	NA	NA	NA
AZW84836.1\|640144_641578_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.5e-52	34.4
AZW84837.1\|641784_642114_-	AzlD domain-containing protein	NA	NA	NA	NA
AZW87701.1\|642116_642785_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW84838.1\|643048_643969_+	branched-chain amino acid transaminase	NA	NA	NA	NA
AZW84839.1\|644015_644228_+	zinc-finger domain-containing protein	NA	NA	NA	NA
AZW84840.1\|644250_644673_+	DUF4440 domain-containing protein	NA	NA	NA	NA
AZW84841.1\|644689_645790_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW84842.1\|645886_647404_-	peptidase	NA	NA	NA	NA
AZW84843.1\|647479_648319_+	UTP--glucose-1-phosphate uridylyltransferase	A0A127AW70	Bacillus_phage	1.1e-66	48.9
AZW84844.1\|648340_649222_-	cytochrome c oxidase assembly protein	NA	NA	NA	NA
AZW84845.1\|649303_650398_-	porin	NA	NA	NA	NA
AZW84846.1\|650691_651642_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87702.1\|651716_652658_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84847.1\|652741_653101_-	hypothetical protein	NA	NA	NA	NA
AZW84848.1\|653482_654520_-	hypothetical protein	NA	NA	NA	NA
AZW84849.1\|654836_656177_+	peptidase M24 family protein	NA	NA	NA	NA
AZW84850.1\|656186_656639_-	hypothetical protein	NA	NA	NA	NA
AZW84851.1\|656735_657917_+	monooxygenase	NA	NA	NA	NA
AZW84852.1\|657976_659008_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
AZW84853.1\|659048_659288_+	Fis family transcriptional regulator	NA	NA	NA	NA
AZW84854.1\|659357_660947_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase PurH	Q58MG4	Prochlorococcus_phage	8.7e-65	47.2
AZW84855.1\|660946_661495_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
AZW84856.1\|661575_662148_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AZW84857.1\|662166_663078_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
AZW84858.1\|663151_664120_-	threonine/serine dehydratase	NA	NA	NA	NA
AZW84859.1\|664242_665316_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	2.3e-08	25.7
AZW84860.1\|665320_667141_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	3.1e-74	35.3
AZW84861.1\|667217_668168_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84862.1\|668256_668592_+	ASCH domain-containing protein	NA	NA	NA	NA
AZW84863.1\|668725_669376_+	carbonic anhydrase	NA	NA	NA	NA
AZW84864.1\|669397_670816_-	amidase	NA	NA	NA	NA
AZW84865.1\|670885_671641_-	hypothetical protein	NA	NA	NA	NA
AZW87703.1\|671609_672368_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW84866.1\|672378_673260_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW84867.1\|673276_673984_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.2e-07	25.4
AZW84868.1\|673986_674745_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.4e-14	24.4
AZW84869.1\|674954_676697_+	sulfite reductase	NA	NA	NA	NA
AZW84870.1\|676689_677214_+	DUF934 domain-containing protein	NA	NA	NA	NA
AZW84871.1\|677253_678048_-	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW84872.1\|678215_679289_+	hypothetical protein	NA	NA	NA	NA
AZW84873.1\|679387_680338_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84874.1\|680589_680802_-	hypothetical protein	NA	NA	NA	NA
AZW87704.1\|680867_681479_-	LexA family transcriptional repressor	NA	NA	NA	NA
AZW84875.1\|681958_682279_-	hypothetical protein	NA	NA	NA	NA
AZW84876.1\|682271_682970_-	hypothetical protein	NA	NA	NA	NA
AZW84877.1\|682984_683206_-	hypothetical protein	NA	NA	NA	NA
AZW84878.1\|683223_684174_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87705.1\|684849_685299_+\|terminase	terminase	C7U0W1	Enterobacteria_phage	5.2e-39	61.5
AZW84879.1\|685285_686563_+\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	2.4e-150	64.7
AZW84880.1\|686565_687984_+	DUF4055 domain-containing protein	R9TF43	Synechococcus_phage	2.2e-99	42.1
AZW87706.1\|688012_689068_+	hypothetical protein	A0A0H5BBX3	Pseudomonas_phage	2.6e-97	50.6
AZW84881.1\|689073_689316_+	hypothetical protein	A0A0H5AUE5	Pseudomonas_phage	5.6e-16	53.2
AZW84882.1\|689438_690041_+	hypothetical protein	R9TF81	Synechococcus_phage	7.9e-27	43.6
AZW84883.1\|690469_691420_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84884.1\|691437_692085_+	hypothetical protein	R9TJ64	Synechococcus_phage	2.7e-65	71.1
AZW84885.1\|692094_692346_+	hypothetical protein	NA	NA	NA	NA
AZW84886.1\|692408_692891_+	hypothetical protein	A0A2H4JE38	uncultured_Caudovirales_phage	1.8e-13	37.1
AZW84887.1\|692892_693093_+	hypothetical protein	NA	NA	NA	NA
AZW84888.1\|693092_693488_+	hypothetical protein	A0A2D2W284	Stenotrophomonas_phage	7.8e-07	35.0
AZW84889.1\|693484_693883_+	hypothetical protein	I6PCW1	Cronobacter_phage	4.2e-16	38.0
AZW84890.1\|693879_694302_+	hypothetical protein	NA	NA	NA	NA
AZW84891.1\|694309_694810_+	HNH endonuclease	A0A1I9SEX5	Klebsiella_phage	4.4e-31	45.1
AZW84892.1\|695064_695583_+\|tail	phage tail protein	A0A1S5R1H0	Pseudomonas_phage	5.4e-24	38.3
AZW84893.1\|695592_695922_+	hypothetical protein	A0A2H4J121	uncultured_Caudovirales_phage	2.9e-15	44.0
AZW84894.1\|695939_696230_+	hypothetical protein	A0A2H4JBP7	uncultured_Caudovirales_phage	3.7e-14	45.2
AZW84895.1\|697815_698766_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84896.1\|699926_700286_+	hypothetical protein	NA	NA	NA	NA
AZW84897.1\|700353_700887_+	DUF1833 domain-containing protein	A5A3Q9	Burkholderia_phage	1.1e-40	46.9
AZW84898.1\|700883_701273_+	hypothetical protein	A0A0G3EYJ9	Achromobacter_phage	3.0e-35	50.0
AZW84899.1\|701265_705222_+	DUF1983 domain-containing protein	A0A0B5A1N2	Achromobacter_phage	3.9e-215	40.8
AZW84900.1\|705226_705643_+	hypothetical protein	NA	NA	NA	NA
AZW84901.1\|705861_706125_+	hypothetical protein	A0A1B0V3F2	Roseobacter_phage	7.2e-09	41.8
AZW84902.1\|706124_706937_+	hypothetical protein	NA	NA	NA	NA
AZW84903.1\|706941_707184_+	hypothetical protein	NA	NA	NA	NA
AZW84904.1\|707162_707714_+	lysozyme	NA	NA	NA	NA
AZW84905.1\|707695_708229_+	DUF2514 domain-containing protein	NA	NA	NA	NA
AZW84906.1\|708225_708507_-	hypothetical protein	NA	NA	NA	NA
AZW84907.1\|708849_709050_+	hypothetical protein	NA	NA	NA	NA
AZW84908.1\|709056_709728_-	SOS response-associated peptidase	Q5QF62	Pseudomonas_virus	4.7e-36	39.9
AZW84909.1\|710083_710770_-	DNA-binding response regulator	NA	NA	NA	NA
AZW84910.1\|710750_711323_-	RNA pyrophosphohydrolase	NA	NA	NA	NA
AZW84911.1\|711388_713119_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	4.6e-11	29.4
AZW84912.1\|713171_713600_+	tol-pal system-associated acyl-CoA thioesterase	NA	NA	NA	NA
AZW84913.1\|713602_714283_+	protein TolQ	NA	NA	NA	NA
AZW84914.1\|714282_714741_+	protein TolR	NA	NA	NA	NA
AZW84915.1\|714777_715752_+	cell envelope integrity protein TolA	NA	NA	NA	NA
AZW84916.1\|715768_717085_+	protein TolB	NA	NA	NA	NA
AZW84917.1\|717116_717614_+	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
AZW84918.1\|717700_718390_+	tol-pal system protein YbgF	NA	NA	NA	NA
AZW84919.1\|718389_719439_+	iron ABC transporter permease	NA	NA	NA	NA
AZW84920.1\|719435_720230_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-15	30.6
AZW84921.1\|720398_720749_+	hypothetical protein	NA	NA	NA	NA
AZW84922.1\|720724_721282_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW84923.1\|722206_722425_+	hypothetical protein	NA	NA	NA	NA
AZW84924.1\|722411_723362_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

738049 : 766367

Planktothrix_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW84934.1\|738049_739000_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84935.1\|739098_740049_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84936.1\|740208_741081_-	carboxyvinyl-carboxyphosphonate phosphorylmutase	NA	NA	NA	NA
AZW84937.1\|741421_741640_+	DUF1059 domain-containing protein	NA	NA	NA	NA
AZW84938.1\|741679_743059_-	aspartate aminotransferase family protein	NA	NA	NA	NA
AZW84939.1\|743100_744498_-	amidase	NA	NA	NA	NA
AZW84940.1\|744537_746190_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.0e-16	30.8
AZW84941.1\|746193_747078_-	ABC transporter permease	NA	NA	NA	NA
AZW84942.1\|747077_748019_-	ABC transporter permease	NA	NA	NA	NA
AZW84943.1\|748097_749717_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW84944.1\|749883_750699_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW84945.1\|750766_751336_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW84946.1\|751336_752287_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84947.1\|752941_754039_+	carboxynorspermidine decarboxylase	NA	NA	NA	NA
AZW84948.1\|754072_755338_+	saccharopine dehydrogenase	NA	NA	NA	NA
AZW84949.1\|755495_756446_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84950.1\|756689_757280_+	polyisoprenoid-binding protein	NA	NA	NA	NA
AZW87708.1\|757295_759740_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
AZW84951.1\|759859_760831_-	hypothetical protein	NA	NA	NA	NA
AZW84952.1\|760962_761487_+	RNA polymerase subunit sigma	NA	NA	NA	NA
AZW84953.1\|761446_762397_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW84954.1\|762618_764814_-	DNA methylase	NA	NA	NA	NA
AZW84955.1\|764886_765294_-	XRE family transcriptional regulator	NA	NA	NA	NA
AZW84956.1\|765416_766367_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

857245 : 906509

Vibrio_phage(33.33%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85029.1\|857245_858196_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87711.1\|858168_858768_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW85030.1\|858769_859204_+	PaaI family thioesterase	NA	NA	NA	NA
AZW85031.1\|859200_859635_+	hypothetical protein	NA	NA	NA	NA
AZW85032.1\|859618_860422_-	phosphatase PAP2 family protein	NA	NA	NA	NA
AZW85033.1\|860438_861254_-	DNA repair exonuclease	NA	NA	NA	NA
AZW85034.1\|861250_862066_-	diacylglycerol kinase	NA	NA	NA	NA
AZW85035.1\|862212_862914_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW85036.1\|862941_864900_-\|holin	choline transporter	A0A2I7QNT1	Vibrio_phage	8.0e-28	30.3
AZW85037.1\|864982_865933_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85038.1\|866153_866822_+	transcriptional regulator	NA	NA	NA	NA
AZW85039.1\|866945_868052_+	MexH family multidrug efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW85040.1\|868064_871178_+	MexW/MexI family multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.5e-57	21.5
AZW85041.1\|871174_872668_+	RND transporter	NA	NA	NA	NA
AZW85042.1\|872682_873354_+	transcriptional regulator	NA	NA	NA	NA
AZW85043.1\|873397_873892_-	azurin	NA	NA	NA	NA
AZW85044.1\|874032_874680_-	transcriptional regulator	NA	NA	NA	NA
AZW87712.1\|874783_876832_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
AZW85045.1\|876828_878841_+	hydantoin utilization protein B	NA	NA	NA	NA
AZW85046.1\|878866_880201_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW87713.1\|880309_881302_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85047.1\|881368_883453_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
AZW85048.1\|883477_884449_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85049.1\|884577_885579_-	peptidase M14	NA	NA	NA	NA
AZW85050.1\|885612_886854_-	cystathionine beta-lyase	NA	NA	NA	NA
AZW85051.1\|886934_887858_+	transcriptional regulator LrhA	NA	NA	NA	NA
AZW85052.1\|887935_888760_+	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW87714.1\|888956_889973_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW85053.1\|890169_891153_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85054.1\|892751_894140_-	MmgE/PrpD family protein	NA	NA	NA	NA
AZW85055.1\|894170_895160_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85056.1\|895270_896503_-	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW85057.1\|896784_897585_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW85058.1\|897607_899839_-\|holin	high-affinity choline transporter BetT	NA	NA	NA	NA
AZW85059.1\|900626_901073_-	preprotein translocase subunit SecG	NA	NA	NA	NA
AZW85060.1\|901094_901841_-	triose-phosphate isomerase	NA	NA	NA	NA
AZW85061.1\|901984_902962_-	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
AZW85062.1\|903595_904207_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	3.3e-12	32.5
AZW85063.1\|904200_905418_-	threonine ammonia-lyase	NA	NA	NA	NA
AZW85064.1\|905558_906509_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_9

916121 : 981061

Bacillus_phage(18.18%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85073.1\|916121_917072_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85074.1\|917068_918919_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.3e-27	26.4
AZW85075.1\|919299_919959_+	thiopurine S-methyltransferase	NA	NA	NA	NA
AZW85076.1\|920046_920199_+	hypothetical protein	NA	NA	NA	NA
AZW85077.1\|920307_920475_+	hypothetical protein	NA	NA	NA	NA
AZW85078.1\|920486_921167_-	DUF3313 domain-containing protein	NA	NA	NA	NA
AZW85079.1\|921448_922165_+	flagellar brake protein	NA	NA	NA	NA
AZW85080.1\|922179_923481_-	phospholipase	NA	NA	NA	NA
AZW85081.1\|925625_928514_+	metal-dependent phosphohydrolase	NA	NA	NA	NA
AZW85082.1\|928737_930090_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW85083.1\|930118_930640_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
AZW85084.1\|930636_932091_+	carboxylase	NA	NA	NA	NA
AZW85085.1\|932125_932374_+	hypothetical protein	NA	NA	NA	NA
AZW85086.1\|932479_933355_+	hypothetical protein	NA	NA	NA	NA
AZW85087.1\|933380_934436_+	hypothetical protein	NA	NA	NA	NA
AZW85088.1\|934448_935240_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW85089.1\|935272_936643_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
AZW85090.1\|937819_938770_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85091.1\|938822_939044_+	hypothetical protein	NA	NA	NA	NA
AZW85092.1\|939203_939416_+	hypothetical protein	NA	NA	NA	NA
AZW85093.1\|939535_940654_+	mannose-6-phosphate isomerase	NA	NA	NA	NA
AZW85094.1\|940750_940966_+	hypothetical protein	NA	NA	NA	NA
AZW85095.1\|941159_941411_+	hypothetical protein	NA	NA	NA	NA
AZW85096.1\|941523_942474_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85097.1\|942470_942854_-	ferredoxin	NA	NA	NA	NA
AZW85098.1\|942908_944726_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	5.7e-44	27.9
AZW87716.1\|944872_945700_+	oxidoreductase	A0A2H4PQR8	Staphylococcus_phage	1.7e-67	47.4
AZW85099.1\|945745_946726_+	aldo/keto reductase	NA	NA	NA	NA
AZW85100.1\|946722_946935_-	hypothetical protein	NA	NA	NA	NA
AZW85101.1\|946931_948113_-	PepSY domain-containing protein	NA	NA	NA	NA
AZW85102.1\|948276_949011_+	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	1.9e-62	49.2
AZW85103.1\|949012_951625_-	penicillin-binding protein	NA	NA	NA	NA
AZW85104.1\|951760_953674_-	S9 family peptidase	NA	NA	NA	NA
AZW85105.1\|954289_954700_-	PaaI family thioesterase	NA	NA	NA	NA
AZW85106.1\|954797_955883_+	DNA polymerase IV	NA	NA	NA	NA
AZW85107.1\|955981_956932_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85108.1\|956928_957903_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85109.1\|958027_958939_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.4e-05	27.6
AZW87717.1\|959215_959608_-	type II toxin-antitoxin system HicB family antitoxin	A0A0R6PJ17	Moraxella_phage	4.8e-25	45.0
AZW85110.1\|959737_960688_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85111.1\|960717_960900_-	addiction module toxin, HicA family	A0A1L2JY37	Aeribacillus_phage	3.7e-12	56.1
AZW85112.1\|960938_961196_-	hypothetical protein	NA	NA	NA	NA
AZW85113.1\|961672_962854_-	MFS transporter	NA	NA	NA	NA
AZW85114.1\|963069_963747_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW85115.1\|963743_964517_-	bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG	NA	NA	NA	NA
AZW85116.1\|964594_965176_-	OmpA family protein	NA	NA	NA	NA
AZW85117.1\|965546_968228_+	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.2e-104	33.5
AZW85118.1\|968227_969361_+	phosphoserine aminotransferase	M1Q1P2	Streptococcus_phage	6.4e-78	44.0
AZW85119.1\|969353_970439_+	prephenate dehydratase	NA	NA	NA	NA
AZW85120.1\|970525_971425_+	prephenate dehydrogenase/arogenate dehydrogenase family protein	NA	NA	NA	NA
AZW85121.1\|971421_972750_+	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
AZW85122.1\|972764_973436_+	cytidylate kinase	NA	NA	NA	NA
AZW85123.1\|973608_975339_+	30S ribosomal protein S1	NA	NA	NA	NA
AZW85124.1\|975340_975700_+	integration host factor subunit beta	NA	NA	NA	NA
AZW85125.1\|975891_976206_+	DUF1049 domain-containing protein	NA	NA	NA	NA
AZW85126.1\|976248_977469_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
AZW85127.1\|977465_978407_+	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.5e-16	28.1
AZW85128.1\|978403_979393_+	ADP-L-glycero-D-mannoheptose-6-epimerase	E3SJ87	Synechococcus_phage	2.2e-26	34.4
AZW85129.1\|979427_980012_+	DUF655 domain-containing protein	NA	NA	NA	NA
AZW85130.1\|980110_981061_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_10

1000466 : 1063617

Enterococcus_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85145.1\|1000466_1001417_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85146.1\|1001521_1002571_+	NADP(H)-dependent aldo-keto reductase	NA	NA	NA	NA
AZW87719.1\|1002708_1003725_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW85147.1\|1005233_1005806_-	chorismate--pyruvate lyase	NA	NA	NA	NA
AZW85148.1\|1005865_1006597_+	rRNA pseudouridine synthase	NA	NA	NA	NA
AZW87720.1\|1006648_1007566_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW85149.1\|1008373_1011553_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
AZW85150.1\|1011549_1012932_+	multidrug transporter	NA	NA	NA	NA
AZW85151.1\|1013001_1013253_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AZW85152.1\|1013398_1014049_-	SCO family protein	NA	NA	NA	NA
AZW85153.1\|1014199_1016314_-	M3 family peptidase	NA	NA	NA	NA
AZW85154.1\|1016389_1017241_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	2.1e-33	39.8
AZW85155.1\|1017237_1017864_-	DNA-binding response regulator	NA	NA	NA	NA
AZW85156.1\|1017860_1019615_-	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
AZW85157.1\|1019907_1022613_+	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
AZW85158.1\|1022625_1024287_+	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
AZW85159.1\|1024299_1026090_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	2.4e-39	25.2
AZW85160.1\|1026311_1027487_-	flagellin FliC	NA	NA	NA	NA
AZW85161.1\|1027529_1028480_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85162.1\|1028578_1029319_-	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AZW85163.1\|1029513_1031550_+	transketolase	NA	NA	NA	NA
AZW85164.1\|1031567_1032578_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
AZW85165.1\|1032695_1033889_+	phosphoglycerate kinase	NA	NA	NA	NA
AZW85166.1\|1033918_1034692_-	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW85167.1\|1034688_1035879_-	acetate kinase	NA	NA	NA	NA
AZW85168.1\|1035904_1036843_-	phosphate acetyltransferase	NA	NA	NA	NA
AZW87721.1\|1036839_1039188_-	DUF3141 domain-containing protein	NA	NA	NA	NA
AZW85169.1\|1039342_1040050_-	glutathione S-transferase	NA	NA	NA	NA
AZW85170.1\|1040087_1041221_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85171.1\|1041497_1042046_-	damage-inducible protein DinB	NA	NA	NA	NA
AZW85172.1\|1042064_1042550_-	N-acetyltransferase	NA	NA	NA	NA
AZW85173.1\|1042727_1043666_+	curved DNA-binding protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	5.6e-11	24.1
AZW85174.1\|1043668_1043986_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZW85175.1\|1044031_1044976_+	hypothetical protein	NA	NA	NA	NA
AZW85176.1\|1046656_1047307_+	molybdopterin adenylyltransferase	NA	NA	NA	NA
AZW85177.1\|1047360_1047696_+	hypothetical protein	NA	NA	NA	NA
AZW85178.1\|1047692_1048553_+	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	2.6e-15	36.1
AZW85179.1\|1048569_1048851_-	hypothetical protein	NA	NA	NA	NA
AZW85180.1\|1048924_1049188_-	translation initiation factor IF-1	NA	NA	NA	NA
AZW85181.1\|1049431_1050382_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85182.1\|1050680_1051418_-	RNA polymerase sigma factor FliA	NA	NA	NA	NA
AZW85183.1\|1051853_1052177_+	flagellar transcriptional activator FlhD	NA	NA	NA	NA
AZW85184.1\|1052211_1052772_+	flagellar transcriptional regulator FlhC	NA	NA	NA	NA
AZW85185.1\|1052892_1053768_+	flagellar motor stator protein MotA	NA	NA	NA	NA
AZW85186.1\|1053780_1054728_+	motility protein MotB	NA	NA	NA	NA
AZW85187.1\|1054829_1055123_+	response regulator	NA	NA	NA	NA
AZW85188.1\|1055149_1057207_+	chemotaxis protein CheA	NA	NA	NA	NA
AZW85189.1\|1057221_1057722_+	chemotaxis protein CheW	NA	NA	NA	NA
AZW85190.1\|1057795_1059502_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	41.7
AZW85191.1\|1060365_1061418_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
AZW85192.1\|1061470_1061860_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	5.7e-10	33.3
AZW85193.1\|1061868_1062501_+	protein phosphatase CheZ	NA	NA	NA	NA
AZW87722.1\|1062600_1063617_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

1069601 : 1137763

uncultured_Mediterranean_phage(25.0%)

transposase,holin,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85198.1\|1069601_1071029_-\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
AZW87724.1\|1071966_1072983_-\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW85199.1\|1073315_1074251_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.0e-41	35.5
AZW85200.1\|1074300_1076181_-	protein translocase subunit SecD	NA	NA	NA	NA
AZW85201.1\|1076247_1076592_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.0e-10	40.4
AZW85202.1\|1076736_1077873_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.9e-85	44.4
AZW85203.1\|1077869_1078943_-\|tRNA	S-adenosylmethionine:tRNA ribosyltransferase-isomerase	NA	NA	NA	NA
AZW85204.1\|1079100_1080537_+	D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase	NA	NA	NA	NA
AZW87725.1\|1080627_1081269_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZW87726.1\|1081604_1082621_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW87727.1\|1085767_1087189_-	siroheme synthase	NA	NA	NA	NA
AZW85205.1\|1087452_1088169_+	hypothetical protein	NA	NA	NA	NA
AZW85206.1\|1088253_1088571_+	DUF883 domain-containing protein	NA	NA	NA	NA
AZW85207.1\|1088611_1089025_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW85208.1\|1089026_1089386_+	hypothetical protein	NA	NA	NA	NA
AZW85209.1\|1089428_1090973_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
AZW85210.1\|1091056_1091887_+	transglycosylase	NA	NA	NA	NA
AZW85211.1\|1091921_1093076_-	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
AZW85212.1\|1093118_1093991_+	hypothetical protein	NA	NA	NA	NA
AZW85213.1\|1094107_1096396_+	NADP-dependent malic enzyme	NA	NA	NA	NA
AZW85214.1\|1097602_1098067_+	barstar family protein 2	NA	NA	NA	NA
AZW85215.1\|1098093_1099044_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87728.1\|1099411_1100188_-	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-17	28.7
AZW85216.1\|1100232_1101090_-	phosphate ABC transporter, permease protein PstA	NA	NA	NA	NA
AZW85217.1\|1101111_1102128_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
AZW85218.1\|1102262_1103303_-	phosphate ABC transporter substrate-binding protein PstS	M4QHS4	Cyanophage	2.1e-51	40.2
AZW85219.1\|1103497_1105579_-	polyphosphate kinase 1	NA	NA	NA	NA
AZW85220.1\|1105814_1107308_+	exopolyphosphatase	NA	NA	NA	NA
AZW85221.1\|1107538_1108333_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW85222.1\|1108553_1109912_-	phosphoglucosamine mutase	NA	NA	NA	NA
AZW85223.1\|1109908_1110751_-	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	3.2e-26	32.5
AZW85224.1\|1110769_1112656_-	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	1.4e-109	41.5
AZW85225.1\|1112893_1113526_-	ribosomal RNA large subunit methyltransferase E	NA	NA	NA	NA
AZW85226.1\|1113544_1114147_+	hypothetical protein	NA	NA	NA	NA
AZW85227.1\|1114298_1115249_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85228.1\|1116051_1116852_-	hypothetical protein	NA	NA	NA	NA
AZW85229.1\|1116895_1117882_-	homoserine kinase	NA	NA	NA	NA
AZW85230.1\|1118021_1119035_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AZW85231.1\|1119031_1119982_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85232.1\|1120094_1120553_-	CBS domain-containing protein	NA	NA	NA	NA
AZW85233.1\|1120589_1121903_-	hypothetical protein	NA	NA	NA	NA
AZW85234.1\|1121920_1122292_+	DUF2069 domain-containing protein	NA	NA	NA	NA
AZW85235.1\|1122288_1123752_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	1.7e-43	32.5
AZW85236.1\|1123844_1124621_+	DNA-binding response regulator	NA	NA	NA	NA
AZW85237.1\|1124602_1127482_-	diguanylate phosphodiesterase	NA	NA	NA	NA
AZW85238.1\|1127664_1128615_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85239.1\|1128782_1129607_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.0e-08	22.7
AZW85240.1\|1129606_1130485_+	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW85241.1\|1131389_1132505_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85242.1\|1132512_1133328_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.5e-12	23.7
AZW85243.1\|1133324_1135190_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	9.3e-50	23.3
AZW85244.1\|1135268_1135901_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW85245.1\|1135897_1136200_-	hypothetical protein	NA	NA	NA	NA
AZW85246.1\|1136242_1137763_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.2e-82	36.0

DBSCAN-SWA_12

1320052 : 1388539

Planktothrix_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85389.1\|1320052_1321003_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85390.1\|1321771_1322410_-	glutathione S-transferase	NA	NA	NA	NA
AZW87738.1\|1323299_1323746_+	glutamate racemase	NA	NA	NA	NA
AZW85391.1\|1323827_1324529_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-17	30.4
AZW85392.1\|1324529_1325297_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-14	26.4
AZW85393.1\|1325293_1326532_-	high-affinity branched-chain amino acid ABC transporter permease LivM	NA	NA	NA	NA
AZW85394.1\|1326531_1327458_-	high-affinity branched-chain amino acid ABC transporter permease LivH	NA	NA	NA	NA
AZW85395.1\|1327560_1328676_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85396.1\|1328691_1329642_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85397.1\|1329995_1330577_-	hypothetical protein	A0A2I7SAW6	Vibrio_phage	9.4e-17	37.3
AZW85398.1\|1330573_1331407_-	pyrroline-5-carboxylate reductase	NA	NA	NA	NA
AZW87739.1\|1331617_1332931_+	sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB	NA	NA	NA	NA
AZW85399.1\|1333107_1333989_+	sn-glycerol-3-phosphate ABC transporter permease UgpA	NA	NA	NA	NA
AZW85400.1\|1334008_1334860_+	sn-glycerol-3-phosphate ABC transporter permease UgpE	NA	NA	NA	NA
AZW85401.1\|1334912_1336001_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.2e-19	31.2
AZW85402.1\|1336111_1337239_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87740.1\|1337473_1338085_+	alpha/beta hydrolase	NA	NA	NA	NA
AZW85403.1\|1338183_1339134_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85404.1\|1339355_1339733_-	DUF423 domain-containing protein	NA	NA	NA	NA
AZW87741.1\|1339880_1340378_+	DUF2384 domain-containing protein	NA	NA	NA	NA
AZW85405.1\|1340374_1340902_+	RES domain-containing protein	NA	NA	NA	NA
AZW85406.1\|1341035_1341851_+	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85407.1\|1341863_1343045_-	alpha-hydroxy-acid oxidizing protein	NA	NA	NA	NA
AZW85408.1\|1343092_1343986_-	phosphatidylserine decarboxylase proenzyme	NA	NA	NA	NA
AZW87742.1\|1344112_1344583_-	hypothetical protein	NA	NA	NA	NA
AZW85409.1\|1344708_1345536_-	DUF3298 domain-containing protein	NA	NA	NA	NA
AZW85410.1\|1345564_1346341_-	lipoate--protein ligase family protein	NA	NA	NA	NA
AZW85411.1\|1346337_1346631_-	biotin--protein ligase	NA	NA	NA	NA
AZW85412.1\|1346627_1347092_-	N-acetyltransferase	NA	NA	NA	NA
AZW85413.1\|1347103_1347889_-	thiol:disulfide oxidoreductase	NA	NA	NA	NA
AZW85414.1\|1347914_1348415_-	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	38.4
AZW85415.1\|1348497_1349676_-	DUF1501 domain-containing protein	NA	NA	NA	NA
AZW85416.1\|1351303_1351639_+	tetratricopeptide repeat protein	NA	NA	NA	NA
AZW85417.1\|1351826_1353275_+	CoA transferase	NA	NA	NA	NA
AZW87743.1\|1353332_1353677_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	3.0e-31	58.4
AZW85418.1\|1353783_1354323_-	peroxiredoxin	NA	NA	NA	NA
AZW85419.1\|1354415_1355366_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85420.1\|1355352_1355835_-	hypothetical protein	NA	NA	NA	NA
AZW85421.1\|1356104_1356536_-	hypothetical protein	NA	NA	NA	NA
AZW85422.1\|1356717_1357122_-	DoxX family protein	NA	NA	NA	NA
AZW85423.1\|1358358_1358682_+	hypothetical protein	NA	NA	NA	NA
AZW85424.1\|1358684_1359572_-	aldo/keto reductase	NA	NA	NA	NA
AZW85425.1\|1359604_1360030_-	universal stress protein	NA	NA	NA	NA
AZW85426.1\|1360101_1360455_-	hypothetical protein	NA	NA	NA	NA
AZW85427.1\|1360694_1361201_-	hypothetical protein	NA	NA	NA	NA
AZW85428.1\|1361239_1362571_-	transcriptional regulator PtsJ	NA	NA	NA	NA
AZW85429.1\|1362630_1363446_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AZW85430.1\|1363442_1364297_+	pyridoxine/pyridoxal/pyridoxamine kinase	NA	NA	NA	NA
AZW87744.1\|1367359_1369903_-	malto-oligosyltrehalose synthase	NA	NA	NA	NA
AZW85431.1\|1371269_1373024_-	malto-oligosyltrehalose trehalohydrolase	NA	NA	NA	NA
AZW85432.1\|1373020_1375141_-	glycogen debranching enzyme GlgX	NA	NA	NA	NA
AZW85433.1\|1375145_1377341_-	1,4-alpha-glucan-branching protein	NA	NA	NA	NA
AZW87745.1\|1377337_1380679_-	maltose alpha-D-glucosyltransferase	NA	NA	NA	NA
AZW85434.1\|1383481_1384432_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85435.1\|1384497_1384677_-	hypothetical protein	NA	NA	NA	NA
AZW87746.1\|1384793_1385516_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW85436.1\|1385535_1386681_-	DUF3182 domain-containing protein	NA	NA	NA	NA
AZW85437.1\|1387588_1388539_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1449030 : 1504518

Mollivirus(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85483.1\|1449030_1449981_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85484.1\|1451182_1451629_-	flagellar export protein FliJ	NA	NA	NA	NA
AZW85485.1\|1451621_1453097_-	flagellar protein export ATPase FliI	NA	NA	NA	NA
AZW85486.1\|1453093_1453849_-	flagellar assembly protein FliH	NA	NA	NA	NA
AZW85487.1\|1453841_1454852_-	flagellar motor switch protein FliG	NA	NA	NA	NA
AZW85488.1\|1454841_1456518_-	flagellar basal body M-ring protein FliF	NA	NA	NA	NA
AZW85489.1\|1456830_1457163_+	flagellar hook-basal body complex protein FliE	NA	NA	NA	NA
AZW85490.1\|1457176_1457572_-	hypothetical protein	NA	NA	NA	NA
AZW85491.1\|1457581_1457908_-	flagellar biosynthesis protein FlhB	NA	NA	NA	NA
AZW85492.1\|1457904_1458231_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW85493.1\|1458157_1459180_-	flagellar hook-length control protein FliK	NA	NA	NA	NA
AZW85494.1\|1459176_1459557_-	flagellar protein FliT	NA	NA	NA	NA
AZW85495.1\|1459574_1460003_-	flagellar export chaperone FliS	NA	NA	NA	NA
AZW85496.1\|1460010_1461384_-	flagellar hook protein FliD	NA	NA	NA	NA
AZW87752.1\|1461524_1461902_-	flagellar protein	NA	NA	NA	NA
AZW85497.1\|1462164_1463472_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
AZW85498.1\|1463532_1464363_+	SPOR domain-containing protein	NA	NA	NA	NA
AZW85499.1\|1464359_1464848_+	colicin V synthesis protein	NA	NA	NA	NA
AZW85500.1\|1464889_1466410_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.8e-97	43.7
AZW87753.1\|1466453_1466930_-	disulfide bond formation protein B	NA	NA	NA	NA
AZW85501.1\|1467733_1470331_-	bifunctional uridylyltransferase/uridylyl-removing protein	NA	NA	NA	NA
AZW85502.1\|1470360_1471182_-	type I methionyl aminopeptidase	NA	NA	NA	NA
AZW85503.1\|1471908_1472658_+	30S ribosomal protein S2	NA	NA	NA	NA
AZW85504.1\|1472790_1473720_+	elongation factor Ts	NA	NA	NA	NA
AZW85505.1\|1473817_1474534_+	UMP kinase	NA	NA	NA	NA
AZW85506.1\|1474548_1475109_+	ribosome-recycling factor	NA	NA	NA	NA
AZW85507.1\|1475146_1476040_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.0e-18	36.1
AZW85508.1\|1476059_1476917_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AZW85509.1\|1476913_1478113_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
AZW85510.1\|1478152_1479487_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
AZW85511.1\|1479539_1481876_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
AZW87754.1\|1482001_1482565_+	outer membrane protein chaperone	NA	NA	NA	NA
AZW85512.1\|1482573_1483665_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
AZW85513.1\|1483736_1484192_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
AZW85514.1\|1484192_1484987_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
AZW85515.1\|1484983_1486165_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
AZW85516.1\|1486151_1486757_+	ribonuclease HII	G9E3X7	Emiliania_huxleyi_virus	8.8e-26	40.2
AZW85517.1\|1486753_1487527_+	RNA methyltransferase	NA	NA	NA	NA
AZW85518.1\|1487538_1488366_-	phosphoenolpyruvate synthase regulatory protein	NA	NA	NA	NA
AZW85519.1\|1488527_1490891_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.2e-165	35.9
AZW85520.1\|1490958_1491678_-	GMP synthase	NA	NA	NA	NA
AZW85521.1\|1491801_1492227_+	NfeD-like family protein 1	NA	NA	NA	NA
AZW85522.1\|1492261_1493212_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85523.1\|1493329_1494256_+	paraslipin	NA	NA	NA	NA
AZW85524.1\|1494321_1495479_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-14	36.2
AZW85525.1\|1495459_1495927_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	6.2e-27	45.1
AZW85526.1\|1496074_1497025_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85527.1\|1497041_1497476_+	ubiquinone-binding protein	NA	NA	NA	NA
AZW85528.1\|1497465_1497816_+	RnfH family protein	NA	NA	NA	NA
AZW85529.1\|1498012_1499167_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW85530.1\|1499163_1500336_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW85531.1\|1500383_1501277_+	3-hydroxyisobutyrate dehydrogenase	NA	NA	NA	NA
AZW85532.1\|1501322_1501760_+	PaaI family thioesterase	NA	NA	NA	NA
AZW85533.1\|1501819_1502509_+	VIT family protein	NA	NA	NA	NA
AZW85534.1\|1502518_1503469_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85535.1\|1503567_1504518_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_14

1543841 : 1601923

Planktothrix_phage(15.38%)

protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85568.1\|1543841_1544654_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AZW85569.1\|1544798_1545893_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85570.1\|1546104_1546734_+	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85571.1\|1546736_1548404_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW85572.1\|1548418_1549075_+	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
AZW85573.1\|1549554_1550505_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85574.1\|1550531_1551305_+	peroxide stress protein YaaA	NA	NA	NA	NA
AZW85575.1\|1551316_1552558_+	MFS transporter	NA	NA	NA	NA
AZW85576.1\|1554339_1555290_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85577.1\|1555321_1556419_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.5e-20	37.3
AZW85578.1\|1556415_1557366_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85579.1\|1557787_1558180_-	hypothetical protein	NA	NA	NA	NA
AZW85580.1\|1558185_1558962_-	DNA-binding response regulator	NA	NA	NA	NA
AZW85581.1\|1559349_1561299_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	4.1e-125	36.0
AZW85582.1\|1561319_1561865_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.1e-14	29.9
AZW85583.1\|1562001_1562958_+	glutathione synthetase	NA	NA	NA	NA
AZW85584.1\|1562968_1563367_+	PTS mannose transporter subunit IIA	NA	NA	NA	NA
AZW85585.1\|1563482_1563752_+	HPr family phosphocarrier protein	NA	NA	NA	NA
AZW85586.1\|1563873_1565568_+	phosphoenolpyruvate--protein phosphotransferase	NA	NA	NA	NA
AZW85587.1\|1565732_1565957_-	hypothetical protein	NA	NA	NA	NA
AZW85588.1\|1566555_1567506_+	ornithine cyclodeaminase	NA	NA	NA	NA
AZW85589.1\|1567547_1568708_+	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85590.1\|1568868_1569789_+	ectoine/hydroxyectoine ABC transporter substrate-binding protein EhuB	NA	NA	NA	NA
AZW85591.1\|1569801_1570443_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuC	NA	NA	NA	NA
AZW85592.1\|1570439_1571111_+	ectoine/hydroxyectoine ABC transporter permease subunit EhuD	NA	NA	NA	NA
AZW85593.1\|1571107_1571878_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-29	39.5
AZW85594.1\|1571976_1572927_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85595.1\|1573143_1573548_-	GFA family protein	NA	NA	NA	NA
AZW85596.1\|1573621_1574812_-	formate dehydrogenase	NA	NA	NA	NA
AZW85597.1\|1574845_1575172_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
AZW85598.1\|1575194_1575710_-	transporter	NA	NA	NA	NA
AZW85599.1\|1575768_1576995_-	acetamidase/formamidase family protein	A0A1V0S8X7	Catovirus	5.2e-134	58.8
AZW85600.1\|1577172_1578303_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
AZW85601.1\|1578537_1579119_+	MOSC domain-containing protein	NA	NA	NA	NA
AZW85602.1\|1579255_1580320_+	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
AZW85603.1\|1580404_1580851_-	GFA family protein	NA	NA	NA	NA
AZW85604.1\|1581075_1581957_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	1.8e-51	36.1
AZW85605.1\|1582011_1582263_+	type II toxin-antitoxin system MqsR family toxin	NA	NA	NA	NA
AZW85606.1\|1582265_1582667_+	type II toxin-antitoxin system MqsA family antitoxin	NA	NA	NA	NA
AZW85607.1\|1582686_1582923_+	hypothetical protein	NA	NA	NA	NA
AZW85608.1\|1582930_1583410_+	disulfide bond formation protein B	NA	NA	NA	NA
AZW85609.1\|1583595_1584075_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.5e-16	42.5
AZW85610.1\|1584077_1585268_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AZW85611.1\|1585272_1586325_+	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	4.8e-35	37.8
AZW85612.1\|1586461_1587484_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	1.6e-67	40.7
AZW85613.1\|1587575_1588412_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW85614.1\|1588604_1589510_+	agmatinase	NA	NA	NA	NA
AZW85615.1\|1589536_1590328_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85616.1\|1590350_1591043_+	amino acid ABC transporter permease	NA	NA	NA	NA
AZW85617.1\|1591064_1591817_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-29	39.7
AZW85618.1\|1591945_1593505_+	acetolactate synthase large subunit	NA	NA	NA	NA
AZW85619.1\|1593536_1594082_+	acyl dehydratase	NA	NA	NA	NA
AZW85620.1\|1594219_1595476_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW85621.1\|1595492_1597187_-	thiamine pyrophosphate-binding protein	E5ERI2	Ostreococcus_lucimarinus_virus	3.8e-26	24.5
AZW85622.1\|1597344_1598232_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.4e-18	28.7
AZW85623.1\|1598269_1599202_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	2.3e-25	29.5
AZW87756.1\|1599215_1599704_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
AZW85624.1\|1599821_1600400_+\|protease	protease	NA	NA	NA	NA
AZW85625.1\|1600472_1600874_+	aryl-sulfate sulfotransferase	NA	NA	NA	NA
AZW85626.1\|1600972_1601923_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_15

1657127 : 1728281

Ectocarpus_siliculosus_virus(10.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85673.1\|1657127_1658078_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85674.1\|1658099_1659320_+	oxygen-independent coproporphyrinogen III oxidase-like protein	NA	NA	NA	NA
AZW85675.1\|1659505_1660918_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
AZW85676.1\|1660981_1662049_+	PAS domain-containing sensor histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-05	23.5
AZW85677.1\|1662045_1663536_+	nitrogen regulation protein NR(I)	NA	NA	NA	NA
AZW87759.1\|1663545_1664490_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW85678.1\|1664649_1665348_+	pirin family protein	NA	NA	NA	NA
AZW85679.1\|1665425_1666331_+	pirin family protein	NA	NA	NA	NA
AZW85680.1\|1666350_1667301_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85681.1\|1667399_1668194_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.3e-16	29.4
AZW85682.1\|1668198_1669869_-	iron ABC transporter permease	NA	NA	NA	NA
AZW85683.1\|1669992_1671042_-	iron ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85684.1\|1671363_1672140_+	ferredoxin--NADP reductase	NA	NA	NA	NA
AZW85685.1\|1672204_1673107_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW85686.1\|1674400_1675204_+	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	2.0e-33	32.4
AZW85687.1\|1677897_1678284_+	reactive intermediate/imine deaminase	NA	NA	NA	NA
AZW85688.1\|1678299_1680390_+	DNA helicase RecG	NA	NA	NA	NA
AZW85689.1\|1680441_1681395_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.2e-14	26.5
AZW87760.1\|1681409_1682297_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW85690.1\|1682434_1683961_+	methylmalonate-semialdehyde dehydrogenase (CoA acylating)	NA	NA	NA	NA
AZW87761.1\|1684059_1684560_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	6.4e-14	35.5
AZW85691.1\|1684883_1686839_-	capsular biosynthesis protein	NA	NA	NA	NA
AZW85692.1\|1687006_1689091_-	hypothetical protein	NA	NA	NA	NA
AZW85693.1\|1689117_1689903_-	glycosyltransferase family 2 protein	A0A1V0SAH6	Catovirus	1.1e-12	32.0
AZW85694.1\|1690758_1691529_+	polyhydroxyalkanoate biosynthesis repressor PhaR	NA	NA	NA	NA
AZW85695.1\|1691528_1692269_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW85696.1\|1692310_1693480_+	capsule biosynthesis protein	NA	NA	NA	NA
AZW85697.1\|1693511_1695596_+	Vi polysaccharide biosynthesis protein TviE	NA	NA	NA	NA
AZW85698.1\|1695592_1696483_+	capsular biosynthesis protein	NA	NA	NA	NA
AZW85699.1\|1696479_1697577_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW85700.1\|1697599_1698889_+	nucleotide sugar dehydrogenase	NA	NA	NA	NA
AZW85701.1\|1698900_1699926_+	Vi polysaccharide biosynthesis UDP-N-acetylglucosaminuronic acid C-4 epimerase TviC	A0A2K9L4U8	Tupanvirus	4.7e-72	44.2
AZW85702.1\|1699922_1701980_+	capsular polysaccharide export protein	NA	NA	NA	NA
AZW85703.1\|1701993_1703169_+	capsule biosynthesis protein CapA	NA	NA	NA	NA
AZW85704.1\|1703250_1704201_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85705.1\|1704259_1705033_+	oxidoreductase	NA	NA	NA	NA
AZW85706.1\|1705025_1706582_+	LTA synthase family protein	NA	NA	NA	NA
AZW85707.1\|1706578_1707529_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85708.1\|1708855_1709458_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW85709.1\|1709697_1710399_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW85710.1\|1710392_1711175_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-09	25.8
AZW85711.1\|1711359_1712310_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85712.1\|1712408_1713146_-	hypothetical protein	A0A0S4KZH7	Pseudomonas_phage	4.1e-41	46.6
AZW85713.1\|1713335_1714094_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW85714.1\|1714140_1715130_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85715.1\|1715307_1716276_-	transporter	NA	NA	NA	NA
AZW85716.1\|1717815_1718784_+	AAA family ATPase	NA	NA	NA	NA
AZW85717.1\|1718792_1719734_+	DUF58 domain-containing protein	NA	NA	NA	NA
AZW85718.1\|1720207_1721218_+	hypothetical protein	NA	NA	NA	NA
AZW87762.1\|1721208_1722723_+	VWA domain-containing protein	NA	NA	NA	NA
AZW85719.1\|1722719_1724066_+	hypothetical protein	NA	NA	NA	NA
AZW87763.1\|1724068_1725103_+	haloacid dehalogenase-like hydrolase	NA	NA	NA	NA
AZW85720.1\|1725152_1726778_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-149	52.2
AZW85721.1\|1727330_1728281_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1749072 : 1810420

uncultured_Caudovirales_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW85735.1\|1749072_1750023_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87769.1\|1750316_1751039_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.3e-87	68.2
AZW85736.1\|1751477_1752665_-	MFS transporter	NA	NA	NA	NA
AZW85737.1\|1752668_1753049_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AZW85738.1\|1754768_1755740_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW85739.1\|1755753_1756467_+	NAD-dependent oxidoreductase	NA	NA	NA	NA
AZW85740.1\|1756471_1757389_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW85741.1\|1757495_1757792_+	hypothetical protein	NA	NA	NA	NA
AZW85742.1\|1757890_1758841_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85743.1\|1759999_1762933_+	monovalent cation/H+ antiporter subunit A	NA	NA	NA	NA
AZW85744.1\|1762932_1763277_+	Na+/H+ antiporter subunit C	NA	NA	NA	NA
AZW85745.1\|1763273_1764902_+	monovalent cation/H+ antiporter subunit D	NA	NA	NA	NA
AZW85746.1\|1764898_1765378_+	Na+/H+ antiporter subunit E	NA	NA	NA	NA
AZW85747.1\|1765374_1765659_+	K+/H+ antiporter subunit F	NA	NA	NA	NA
AZW85748.1\|1765655_1765982_+	cation:proton antiporter	NA	NA	NA	NA
AZW85749.1\|1766137_1767088_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85750.1\|1767131_1767674_+	hypothetical protein	NA	NA	NA	NA
AZW85751.1\|1767771_1768620_+	hydrolase	NA	NA	NA	NA
AZW85752.1\|1768612_1769119_+\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	3.4e-07	38.4
AZW85753.1\|1769115_1770117_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
AZW85754.1\|1770129_1770924_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW85755.1\|1770972_1772874_-	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW85756.1\|1772870_1773494_-	hypothetical protein	NA	NA	NA	NA
AZW85757.1\|1773620_1774745_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85758.1\|1775062_1776730_+	ABC-F family ATPase	A0A1V0SKJ1	Klosneuvirus	1.6e-53	28.9
AZW85759.1\|1776885_1777662_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-30	34.2
AZW85760.1\|1777746_1778745_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85761.1\|1778741_1779515_+	ABC transporter permease	NA	NA	NA	NA
AZW85762.1\|1780499_1781450_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85763.1\|1781473_1781938_-	GatB/YqeY domain-containing protein	A0A0K2FLI9	Brevibacillus_phage	3.9e-05	32.4
AZW85764.1\|1782084_1783293_+	flavohemoprotein	NA	NA	NA	NA
AZW85765.1\|1783303_1783774_+	DNA-binding protein	NA	NA	NA	NA
AZW85766.1\|1783892_1785182_+	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW85767.1\|1787922_1788873_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW85768.1\|1788971_1789988_-	folate-binding protein	NA	NA	NA	NA
AZW85769.1\|1790154_1791201_+	endolytic transglycosylase MltG	NA	NA	NA	NA
AZW85770.1\|1791197_1791824_+	thymidylate kinase	A0A1L2BX49	Bacteriophage	1.6e-22	35.1
AZW85771.1\|1791820_1792873_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
AZW85772.1\|1792922_1793693_+	TatD family deoxyribonuclease	NA	NA	NA	NA
AZW85773.1\|1793743_1794580_+	hypothetical protein	NA	NA	NA	NA
AZW85774.1\|1794775_1795516_+	IclR family transcriptional regulator	NA	NA	NA	NA
AZW85775.1\|1795590_1796334_+	glutamine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85776.1\|1796995_1797769_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.1e-31	37.7
AZW85777.1\|1798906_1800196_+	Glu/Leu/Phe/Val dehydrogenase	NA	NA	NA	NA
AZW85778.1\|1801806_1803054_-	Zn-dependent hydrolase	NA	NA	NA	NA
AZW85779.1\|1803063_1804773_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	5.9e-35	27.3
AZW85780.1\|1804769_1805708_-	CoA ester lyase	NA	NA	NA	NA
AZW85781.1\|1805704_1806988_-	TRAP transporter large permease	NA	NA	NA	NA
AZW85782.1\|1806991_1807474_-	TRAP transporter small permease	NA	NA	NA	NA
AZW85783.1\|1807474_1808461_-	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW85784.1\|1808633_1809353_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW85785.1\|1809469_1810420_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_17

2200777 : 2256013

Lake_Baikal_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86086.1\|2200777_2201728_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86087.1\|2201928_2202738_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW86088.1\|2202862_2203813_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86089.1\|2203809_2204703_-	methylglyoxal synthase	NA	NA	NA	NA
AZW86090.1\|2204827_2205022_-	Fe-S assembly protein IscX	NA	NA	NA	NA
AZW86091.1\|2205021_2205363_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
AZW86092.1\|2205372_2207235_-	chaperone protein HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-101	42.4
AZW86093.1\|2207364_2207877_-	co-chaperone protein HscB	NA	NA	NA	NA
AZW86094.1\|2207879_2208203_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	6.8e-25	52.8
AZW86095.1\|2208204_2208615_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	7.5e-53	79.0
AZW86096.1\|2208652_2209864_-	IscS subfamily cysteine desulfurase	NA	NA	NA	NA
AZW86097.1\|2209881_2210394_-	Fe-S cluster assembly transcriptional regulator IscR	NA	NA	NA	NA
AZW86098.1\|2210609_2211101_-	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
AZW86099.1\|2211353_2213390_-	UvrABC system protein B	NA	NA	NA	NA
AZW86100.1\|2213467_2214670_+	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AZW86101.1\|2214720_2215449_+	transcriptional repressor LexA	A0A2H4JG58	uncultured_Caudovirales_phage	2.8e-10	50.7
AZW86102.1\|2217006_2217957_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86103.1\|2218527_2218740_-	hypothetical protein	NA	NA	NA	NA
AZW86104.1\|2218757_2219489_-	hypothetical protein	NA	NA	NA	NA
AZW86105.1\|2219523_2220165_-	CoA transferase subunit B	NA	NA	NA	NA
AZW86106.1\|2220157_2220874_-	3-oxoadipate CoA-transferase	NA	NA	NA	NA
AZW86107.1\|2223038_2223815_-	3-oxoacyl-ACP reductase	NA	NA	NA	NA
AZW86108.1\|2223836_2224994_-	thiolase	NA	NA	NA	NA
AZW86109.1\|2224990_2225422_-	hypothetical protein	NA	NA	NA	NA
AZW86110.1\|2225418_2226222_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW86111.1\|2226235_2226691_-	MaoC family dehydratase	NA	NA	NA	NA
AZW86112.1\|2226703_2227675_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW86113.1\|2227740_2228964_-	CoA transferase	NA	NA	NA	NA
AZW86114.1\|2229191_2230142_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW86115.1\|2230265_2232719_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	52.0
AZW86116.1\|2232907_2234212_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.2e-129	53.8
AZW86117.1\|2234316_2234970_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	6.8e-56	57.5
AZW86118.1\|2234972_2236283_-	trigger factor	NA	NA	NA	NA
AZW86119.1\|2236461_2237040_+	TIGR00645 family protein	K4K6D8	Caulobacter_phage	1.0e-23	33.7
AZW86120.1\|2237151_2237352_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	7.4e-14	64.4
AZW86121.1\|2237697_2238264_-	DUF924 domain-containing protein	NA	NA	NA	NA
AZW86122.1\|2238347_2238551_-	cold-shock protein CspA	A0A2H4N7Y6	Lake_Baikal_phage	1.6e-16	62.1
AZW86123.1\|2238857_2239178_-	hypothetical protein	NA	NA	NA	NA
AZW86124.1\|2239219_2239501_-	hypothetical protein	NA	NA	NA	NA
AZW86125.1\|2239575_2240832_-	autotransporter Phg	NA	NA	NA	NA
AZW86126.1\|2241214_2241544_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW86127.1\|2243114_2243936_+	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
AZW86128.1\|2243935_2245075_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
AZW86129.1\|2245081_2245978_+	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AZW86130.1\|2245974_2247900_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	1.1e-66	31.8
AZW86131.1\|2248259_2250872_+	TonB-dependent receptor	NA	NA	NA	NA
AZW86132.1\|2250924_2253225_-	DNA helicase II	A7KV33	Bacillus_phage	9.9e-110	35.9
AZW86133.1\|2253221_2254430_-	acyl-CoA desaturase	NA	NA	NA	NA
AZW86134.1\|2254691_2255066_+	hypothetical protein	NA	NA	NA	NA
AZW86135.1\|2255062_2256013_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

2259120 : 2313390

Klosneuvirus(14.29%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86137.1\|2259120_2261982_+\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	1.0e-71	25.5
AZW86138.1\|2261984_2262491_+	lipoprotein signal peptidase	NA	NA	NA	NA
AZW86139.1\|2262595_2263804_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	3.8e-36	30.0
AZW86140.1\|2263805_2264744_-	hypothetical protein	NA	NA	NA	NA
AZW86141.1\|2264905_2265379_+	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW86142.1\|2265375_2266326_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86143.1\|2266312_2266492_-	hypothetical protein	NA	NA	NA	NA
AZW86144.1\|2266436_2266877_-	DUF937 domain-containing protein	NA	NA	NA	NA
AZW86145.1\|2267005_2268235_-	lytic murein transglycosylase	NA	NA	NA	NA
AZW86146.1\|2268273_2269095_-	DUF455 domain-containing protein	NA	NA	NA	NA
AZW86147.1\|2269148_2270300_+	N-acetyltransferase	NA	NA	NA	NA
AZW86148.1\|2270391_2270880_-	DUF1854 domain-containing protein	NA	NA	NA	NA
AZW86149.1\|2273406_2275980_+	cyanophycin synthetase	NA	NA	NA	NA
AZW86150.1\|2276050_2278624_+	cyanophycin synthetase	NA	NA	NA	NA
AZW86151.1\|2278889_2279090_+	CsbD family protein	NA	NA	NA	NA
AZW86152.1\|2279121_2279283_+	DUF1328 domain-containing protein	NA	NA	NA	NA
AZW86153.1\|2279340_2279679_+	phospholipid-binding protein	NA	NA	NA	NA
AZW86154.1\|2279827_2280778_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86155.1\|2280876_2281827_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86156.1\|2281925_2282645_-	ABC transporter	G9BWD6	Planktothrix_phage	1.4e-22	36.6
AZW87790.1\|2282721_2283270_+	arylesterase	NA	NA	NA	NA
AZW86157.1\|2283251_2285267_-	peptidylprolyl isomerase	NA	NA	NA	NA
AZW86158.1\|2285449_2286199_+	glycerophosphodiester phosphodiesterase	A0A2H4PGQ5	Escherichia_phage	1.5e-14	27.8
AZW86159.1\|2286211_2287075_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
AZW86160.1\|2287078_2288494_-	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
AZW86161.1\|2288627_2289356_-	glutaredoxin	A0A1D8KSL1	Synechococcus_phage	9.6e-43	56.8
AZW86162.1\|2289494_2289695_-	copper chaperone	NA	NA	NA	NA
AZW86163.1\|2289870_2290269_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
AZW86164.1\|2290292_2291693_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	7.3e-31	26.5
AZW87791.1\|2291811_2292564_-	hypothetical protein	NA	NA	NA	NA
AZW86165.1\|2292852_2293530_-	hypothetical protein	NA	NA	NA	NA
AZW86166.1\|2293556_2294336_-	3'-5' exonuclease	NA	NA	NA	NA
AZW86167.1\|2294332_2295217_-	peptidase	A0A292GJG6	Xanthomonas_phage	4.6e-15	49.5
AZW87792.1\|2295234_2295924_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	4.2e-32	46.9
AZW86168.1\|2295998_2296757_-	5'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.4e-68	51.2
AZW86169.1\|2296882_2297530_+	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZW87793.1\|2297797_2298814_+\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW86170.1\|2298911_2299952_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.1e-91	51.3
AZW86171.1\|2300086_2301379_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	1.7e-66	36.0
AZW86172.1\|2302738_2303122_+	thioredoxin	V9SJ74	Achromobacter_phage	8.1e-09	25.8
AZW86173.1\|2303139_2303727_-	DUF1949 domain-containing protein	A0A1X9I5T8	Streptococcus_phage	4.7e-16	35.8
AZW86174.1\|2303764_2304715_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86175.1\|2304813_2305374_-	diaminobutyrate acetyltransferase	NA	NA	NA	NA
AZW86176.1\|2305370_2305916_-	MarR family transcriptional regulator	NA	NA	NA	NA
AZW86177.1\|2306111_2307140_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
AZW86178.1\|2307180_2308521_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	8.8e-18	22.8
AZW86179.1\|2308629_2309634_+	C4-dicarboxylate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86180.1\|2309740_2312341_+	DUF3394 domain-containing protein	NA	NA	NA	NA
AZW86181.1\|2312439_2313390_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_19

2352503 : 2416081

uncultured_Caudovirales_phage(11.11%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86220.1\|2352503_2353454_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86221.1\|2353755_2354232_-	transcription elongation factor GreA	NA	NA	NA	NA
AZW86222.1\|2354855_2356493_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-12	30.2
AZW86223.1\|2356523_2357837_-	pyrimidine utilization transport protein G	Q9KX94	Enterobacteria_phage	2.1e-149	67.1
AZW86224.1\|2357970_2358288_+	hypothetical protein	NA	NA	NA	NA
AZW86225.1\|2358388_2359711_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86226.1\|2359707_2360658_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86227.1\|2360756_2361707_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86228.1\|2362236_2363259_-	putative 2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86229.1\|2363287_2364118_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
AZW87798.1\|2364134_2365832_-	putative 2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
AZW86230.1\|2365896_2366973_-	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-28	35.8
AZW86231.1\|2367132_2367996_+	transcriptional regulator	NA	NA	NA	NA
AZW86232.1\|2368026_2368596_+	phosphohydrolase	NA	NA	NA	NA
AZW86233.1\|2368612_2369464_-	sulfurtransferase	NA	NA	NA	NA
AZW86234.1\|2370521_2371403_+\|protease	protease HtpX	NA	NA	NA	NA
AZW86235.1\|2371477_2372467_-	quinone oxidoreductase	NA	NA	NA	NA
AZW86236.1\|2372529_2373480_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW86237.1\|2373542_2374400_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW86238.1\|2374459_2374948_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZW86239.1\|2376496_2377711_+	EmrA/EmrK family multidrug efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
AZW86240.1\|2377707_2379294_+	multidrug resistance protein	NA	NA	NA	NA
AZW86241.1\|2379312_2380380_-	tartrate dehydrogenase	NA	NA	NA	NA
AZW86242.1\|2380484_2382029_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	3.1e-14	25.4
AZW86243.1\|2382448_2384023_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86244.1\|2384130_2385147_+	ABC transporter permease	NA	NA	NA	NA
AZW86245.1\|2385143_2385983_+	ABC transporter permease	NA	NA	NA	NA
AZW86246.1\|2385987_2387625_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-21	30.6
AZW86247.1\|2387621_2388572_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86248.1\|2388714_2389989_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.6e-24	27.9
AZW86249.1\|2389985_2390309_+	cupin domain-containing protein	NA	NA	NA	NA
AZW87799.1\|2390381_2391395_+	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	1.7e-42	35.2
AZW86250.1\|2391414_2392677_+	Zn-dependent hydrolase	NA	NA	NA	NA
AZW86251.1\|2392679_2393603_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW86252.1\|2393599_2395093_+	aldehyde dehydrogenase	NA	NA	NA	NA
AZW86253.1\|2395103_2396036_-	glyoxylate/hydroxypyruvate reductase A	NA	NA	NA	NA
AZW86254.1\|2396217_2397543_+	aspartate aminotransferase family protein	A0A1C9EHH3	Mycobacterium_phage	1.8e-07	22.5
AZW86255.1\|2397577_2398933_-	sodium:alanine symporter family protein	NA	NA	NA	NA
AZW86256.1\|2398993_2400592_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	1.8e-78	44.9
AZW86257.1\|2400668_2401400_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW86258.1\|2401434_2402808_+	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
AZW86259.1\|2402823_2403735_+	coproporphyrinogen III oxidase	NA	NA	NA	NA
AZW86260.1\|2403725_2404319_+	nicotinate-nicotinamide nucleotide adenylyltransferase	NA	NA	NA	NA
AZW86261.1\|2404380_2404767_+	ribosome silencing factor	NA	NA	NA	NA
AZW86262.1\|2404778_2405249_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
AZW86263.1\|2405260_2405884_+	septum formation inhibitor Maf	NA	NA	NA	NA
AZW86264.1\|2405904_2408652_-	autotransporter Vag8	NA	NA	NA	NA
AZW86265.1\|2414928_2415144_+	hypothetical protein	NA	NA	NA	NA
AZW86266.1\|2415130_2416081_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_20

2688067 : 2728735

Salmonella_phage(33.33%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86496.1\|2688067_2689018_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86497.1\|2689128_2689311_+	hypothetical protein	NA	NA	NA	NA
AZW86498.1\|2689410_2690007_-	lipoprotein	NA	NA	NA	NA
AZW86499.1\|2690190_2691282_+	hypothetical protein	NA	NA	NA	NA
AZW86500.1\|2691781_2692192_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW86501.1\|2692250_2692592_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.8e-13	42.2
AZW86502.1\|2692597_2695015_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZW86503.1\|2695027_2696050_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	1.0e-26	38.6
AZW86504.1\|2696124_2696484_-	50S ribosomal protein L20	NA	NA	NA	NA
AZW86505.1\|2696499_2696697_-	50S ribosomal protein L35	NA	NA	NA	NA
AZW86506.1\|2697032_2697983_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86507.1\|2697969_2698158_-	hypothetical protein	NA	NA	NA	NA
AZW86508.1\|2698177_2698627_+	dUTP diphosphatase	S4TNT3	Salmonella_phage	3.7e-45	67.2
AZW86509.1\|2698623_2699574_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86510.1\|2699684_2701133_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW86511.1\|2701247_2701529_-	hypothetical protein	NA	NA	NA	NA
AZW86512.1\|2701632_2702583_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86513.1\|2702827_2703541_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW86514.1\|2703663_2703891_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
AZW86515.1\|2704185_2704824_-	DedA family protein	NA	NA	NA	NA
AZW86516.1\|2704896_2705967_+	metal-dependent hydrolase	NA	NA	NA	NA
AZW86517.1\|2705963_2706914_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86518.1\|2707329_2707854_-	DNA-binding protein	J9Q7G7	Salmonella_phage	6.5e-09	32.9
AZW86519.1\|2707857_2708127_-	hypothetical protein	NA	NA	NA	NA
AZW86520.1\|2708325_2709387_-	LacI family transcriptional regulator	NA	NA	NA	NA
AZW86521.1\|2709470_2711105_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-15	31.1
AZW86522.1\|2711106_2711910_-	ABC transporter permease	NA	NA	NA	NA
AZW86523.1\|2711938_2712898_-	ABC transporter permease	NA	NA	NA	NA
AZW86524.1\|2712901_2714416_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86525.1\|2714452_2715457_-	peptidase M20	NA	NA	NA	NA
AZW86526.1\|2715464_2715713_-	hypothetical protein	NA	NA	NA	NA
AZW86527.1\|2715887_2716358_-	DUF1801 domain-containing protein	NA	NA	NA	NA
AZW86528.1\|2716393_2717005_-	LysE family translocator	NA	NA	NA	NA
AZW86529.1\|2717035_2717659_-	FMN-binding negative transcriptional regulator	NA	NA	NA	NA
AZW86530.1\|2717739_2719272_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
AZW86531.1\|2719306_2720548_-	MFS transporter	NA	NA	NA	NA
AZW86532.1\|2720591_2721623_-	alcohol dehydrogenase	A0A2K9L339	Tupanvirus	1.8e-26	27.8
AZW86533.1\|2721619_2722789_-	amine oxidase	NA	NA	NA	NA
AZW86534.1\|2722782_2723463_-	anti-sigma factor	NA	NA	NA	NA
AZW86535.1\|2723624_2724467_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW86536.1\|2724629_2725601_-	AraC family transcriptional regulator	NA	NA	NA	NA
AZW86537.1\|2725772_2726651_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZW86538.1\|2726673_2727744_-	FUSC family protein	NA	NA	NA	NA
AZW86539.1\|2727784_2728735_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_21

2784199 : 2857069

Moraxella_phage(16.67%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86582.1\|2784199_2784616_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
AZW86583.1\|2784726_2785359_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
AZW86584.1\|2785387_2785831_+	6-carboxytetrahydropterin synthase QueD	NA	NA	NA	NA
AZW86585.1\|2785852_2786944_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86586.1\|2786998_2787799_-	aldolase	NA	NA	NA	NA
AZW86587.1\|2787934_2788555_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZW86588.1\|2788694_2789168_+	MarR family transcriptional regulator	NA	NA	NA	NA
AZW86589.1\|2790307_2791258_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86590.1\|2791254_2798916_-	adhesin	A0A0R6PJK4	Moraxella_phage	7.3e-24	30.9
AZW86591.1\|2799156_2803203_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	6.3e-160	67.4
AZW86592.1\|2803515_2804097_+	TRAP transporter small permease	NA	NA	NA	NA
AZW86593.1\|2804093_2805392_+	TRAP transporter large permease	NA	NA	NA	NA
AZW86594.1\|2805471_2806500_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
AZW86595.1\|2806423_2806774_+	hypothetical protein	NA	NA	NA	NA
AZW86596.1\|2806760_2807711_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86597.1\|2807707_2808658_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86598.1\|2808974_2809580_+	fimbrial protein FimX	NA	NA	NA	NA
AZW86599.1\|2809633_2810947_-	phenylacetate--CoA ligase	NA	NA	NA	NA
AZW86600.1\|2811021_2811492_-	phenylacetic acid degradation protein PaaD	NA	NA	NA	NA
AZW86601.1\|2811491_2812280_-	2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase	NA	NA	NA	NA
AZW86602.1\|2812290_2813943_-	phenylacetic acid degradation protein PaaN	NA	NA	NA	NA
AZW86603.1\|2814030_2814981_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87815.1\|2816142_2816649_-	phenylacetate-CoA oxygenase subunit PaaJ	NA	NA	NA	NA
AZW86604.1\|2816645_2817410_-	phenylacetate-CoA oxygenase subunit PaaI	NA	NA	NA	NA
AZW86605.1\|2817425_2817710_-	1,2-phenylacetyl-CoA epoxidase subunit B	NA	NA	NA	NA
AZW86606.1\|2817774_2818764_-	1,2-phenylacetyl-CoA epoxidase subunit A	NA	NA	NA	NA
AZW86607.1\|2818935_2819865_+	phenylacetic acid degradation operon negative regulatory protein PaaX	NA	NA	NA	NA
AZW86608.1\|2819836_2820523_-	NAD(P)H-hydrate epimerase	NA	NA	NA	NA
AZW86609.1\|2820556_2821102_-	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-26	37.7
AZW86610.1\|2821146_2822412_+	peptidase M48	NA	NA	NA	NA
AZW86611.1\|2822408_2823311_+	ribosome biogenesis GTPase	NA	NA	NA	NA
AZW86612.1\|2824492_2825437_-	ABC transporter permease	NA	NA	NA	NA
AZW86613.1\|2825531_2827049_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86614.1\|2827090_2828719_-	gamma-glutamyltransferase	NA	NA	NA	NA
AZW86615.1\|2828826_2829708_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW86616.1\|2832820_2833195_+	endonuclease	F4YXR7	Roseobacter_phage	2.1e-25	54.4
AZW86617.1\|2833219_2833558_-	P-II family nitrogen regulator	NA	NA	NA	NA
AZW86618.1\|2833601_2835236_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	8.3e-87	36.6
AZW86619.1\|2835274_2836621_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AZW87816.1\|2836728_2838150_+	argininosuccinate lyase	NA	NA	NA	NA
AZW86620.1\|2838219_2838804_-	nitroreductase	NA	NA	NA	NA
AZW86621.1\|2838906_2839857_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86622.1\|2839991_2841098_+	LysR family transcriptional regulator	NA	NA	NA	NA
AZW86623.1\|2841108_2842206_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
AZW86624.1\|2842350_2843556_-	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
AZW86625.1\|2843562_2844084_-	molybdenum cofactor biosynthesis protein B	NA	NA	NA	NA
AZW86626.1\|2844080_2844572_-	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
AZW86627.1\|2844568_2844820_-	MoaD/ThiS family protein	NA	NA	NA	NA
AZW86628.1\|2844800_2845286_-	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
AZW86629.1\|2845421_2848883_+	hypothetical protein	NA	NA	NA	NA
AZW86630.1\|2848879_2849785_+	dienelactone hydrolase family protein	NA	NA	NA	NA
AZW86631.1\|2849794_2850226_-	lipoprotein	NA	NA	NA	NA
AZW87817.1\|2850472_2850976_+	peroxiredoxin	M1I839	Pelagibacter_phage	1.8e-24	44.1
AZW86632.1\|2850987_2852454_+	MFS transporter	NA	NA	NA	NA
AZW86633.1\|2852528_2853404_-	hypothetical protein	NA	NA	NA	NA
AZW87818.1\|2853400_2854408_-	biotin synthase	NA	NA	NA	NA
AZW86634.1\|2854875_2855181_+	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW86635.1\|2855271_2855862_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW87819.1\|2856052_2857069_-\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_22

2860212 : 2927023

uncultured_Mediterranean_phage(28.57%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86638.1\|2860212_2861163_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86639.1\|2861261_2862212_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86640.1\|2862208_2863003_-	N-formylglutamate deformylase	NA	NA	NA	NA
AZW86641.1\|2863034_2863739_-	oxidoreductase	NA	NA	NA	NA
AZW86642.1\|2863813_2864614_-	SURF1 family protein	NA	NA	NA	NA
AZW86643.1\|2864610_2865018_-	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
AZW86644.1\|2865014_2865656_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
AZW86645.1\|2865648_2867670_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
AZW86646.1\|2868909_2870241_+	MFS transporter	NA	NA	NA	NA
AZW86647.1\|2870237_2871188_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86648.1\|2872894_2873200_-	hypothetical protein	NA	NA	NA	NA
AZW86649.1\|2873868_2874207_+	transcriptional regulator	NA	NA	NA	NA
AZW86650.1\|2878760_2879363_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW86651.1\|2879459_2880749_+	MFS transporter	NA	NA	NA	NA
AZW86652.1\|2880806_2881538_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-12	31.0
AZW86653.1\|2881534_2882338_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.9e-14	23.5
AZW86654.1\|2882334_2883423_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
AZW86655.1\|2883419_2884349_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW86656.1\|2884497_2885643_-	branched-chain amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86657.1\|2885664_2886615_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86658.1\|2886945_2890767_-	trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase	NA	NA	NA	NA
AZW86659.1\|2890923_2891592_-	lipoprotein	NA	NA	NA	NA
AZW86660.1\|2891596_2893270_-	MCE family protein	NA	NA	NA	NA
AZW86661.1\|2893288_2894608_-	paraquat-inducible membrane protein A	NA	NA	NA	NA
AZW86662.1\|2894612_2896964_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	4.2e-164	41.9
AZW87820.1\|2896983_2899152_-	penicillin-binding protein 1C	NA	NA	NA	NA
AZW86663.1\|2899148_2904338_-	alpha-2-macroglobulin family protein	NA	NA	NA	NA
AZW86664.1\|2904427_2904742_-\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.2e-10	43.8
AZW86665.1\|2904969_2905215_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-20	76.6
AZW86666.1\|2905309_2905828_+	hypothetical protein	A0A1B1IUW8	uncultured_Mediterranean_phage	5.1e-14	42.2
AZW86667.1\|2905927_2907133_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AZW86668.1\|2907248_2908646_-	chloride channel protein EriC	NA	NA	NA	NA
AZW86669.1\|2908762_2909341_-	superoxide dismutase [Fe]	NA	NA	NA	NA
AZW86670.1\|2909413_2910805_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	1.4e-29	32.0
AZW86671.1\|2910972_2911923_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86672.1\|2912203_2912824_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
AZW86673.1\|2912820_2913234_+	biopolymer transporter ExbD	NA	NA	NA	NA
AZW86674.1\|2913230_2914274_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AZW86675.1\|2914329_2914518_+	hypothetical protein	NA	NA	NA	NA
AZW86676.1\|2914527_2915292_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AZW86677.1\|2915382_2916039_+	adenylate kinase	NA	NA	NA	NA
AZW86678.1\|2916130_2916889_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW86679.1\|2916914_2918516_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
AZW86680.1\|2918716_2919721_+	DUF4880 domain-containing protein	NA	NA	NA	NA
AZW86681.1\|2919821_2920085_+	30S ribosomal protein S20	NA	NA	NA	NA
AZW86682.1\|2920202_2920979_-	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
AZW86683.1\|2921569_2922520_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86684.1\|2924903_2926016_-	malate dehydrogenase	NA	NA	NA	NA
AZW86685.1\|2926072_2927023_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_23

2957409 : 2996598

Planktothrix_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86714.1\|2957409_2958360_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86715.1\|2958346_2958592_-	hypothetical protein	NA	NA	NA	NA
AZW86716.1\|2958480_2959377_-	inositol monophosphatase	NA	NA	NA	NA
AZW86717.1\|2961654_2963880_+	glycosyl hydrolase	NA	NA	NA	NA
AZW86718.1\|2964044_2965133_+	methionine import ATP-binding protein MetN	G9BWD6	Planktothrix_phage	8.7e-32	36.4
AZW86719.1\|2965089_2965743_+	ABC transporter permease	NA	NA	NA	NA
AZW86720.1\|2965790_2966588_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86721.1\|2967119_2968070_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86722.1\|2968150_2969299_+	alcohol dehydrogenase	NA	NA	NA	NA
AZW86723.1\|2969355_2970306_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86724.1\|2970292_2970511_-	hypothetical protein	NA	NA	NA	NA
AZW86725.1\|2970404_2970710_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AZW86726.1\|2970738_2971173_-	DUF126 domain-containing protein	NA	NA	NA	NA
AZW86727.1\|2971174_2972419_-	DUF521 domain-containing protein	NA	NA	NA	NA
AZW86728.1\|2972415_2973126_-	FadR family transcriptional regulator	NA	NA	NA	NA
AZW87822.1\|2973140_2974052_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW86729.1\|2974414_2974819_+	hypothetical protein	NA	NA	NA	NA
AZW86730.1\|2974815_2975274_+	hypothetical protein	NA	NA	NA	NA
AZW86731.1\|2975280_2976189_+	hypothetical protein	NA	NA	NA	NA
AZW87823.1\|2976185_2977052_+	sugar ABC transporter permease	NA	NA	NA	NA
AZW86732.1\|2977038_2977866_+	carbohydrate ABC transporter permease	NA	NA	NA	NA
AZW86733.1\|2977876_2979004_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-23	32.3
AZW86734.1\|2980081_2981320_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86735.1\|2981361_2982624_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86736.1\|2982630_2983383_+	DNA-binding protein	NA	NA	NA	NA
AZW86737.1\|2983434_2983620_-	hypothetical protein	NA	NA	NA	NA
AZW86738.1\|2983895_2984360_+	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
AZW86739.1\|2984391_2985051_+	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
AZW86740.1\|2985195_2987304_+	AsmA family protein	NA	NA	NA	NA
AZW86741.1\|2987300_2988251_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86742.1\|2988354_2988975_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW87824.1\|2989078_2989819_+	oxidoreductase	NA	NA	NA	NA
AZW86743.1\|2990953_2992078_-	hypothetical protein	NA	NA	NA	NA
AZW86744.1\|2992123_2992492_-	hypothetical protein	NA	NA	NA	NA
AZW86745.1\|2992733_2993684_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86746.1\|2994719_2995262_-	hypothetical protein	NA	NA	NA	NA
AZW86747.1\|2995466_2995661_+	hypothetical protein	NA	NA	NA	NA
AZW86748.1\|2995647_2996598_+\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_24

3185518 : 3246547

Xanthomonas_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86899.1\|3185518_3186469_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86900.1\|3186477_3187026_+	phospholipid:lipid A palmitoyltransferase	NA	NA	NA	NA
AZW86901.1\|3187022_3187631_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW86902.1\|3187813_3188284_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW86903.1\|3188290_3189550_-	D-amino acid dehydrogenase	NA	NA	NA	NA
AZW86904.1\|3189602_3190415_-	oxidoreductase	NA	NA	NA	NA
AZW86905.1\|3190529_3191084_+	cysteine dioxygenase	NA	NA	NA	NA
AZW86906.1\|3191093_3192083_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW86907.1\|3192262_3192982_-	VOC family protein	NA	NA	NA	NA
AZW86908.1\|3192998_3195734_-	protein translocase subunit SecA	NA	NA	NA	NA
AZW86909.1\|3195913_3196900_-	M23 family peptidase	A0A292GJG6	Xanthomonas_phage	3.4e-27	51.8
AZW86910.1\|3196941_3197436_+	DUF721 domain-containing protein	NA	NA	NA	NA
AZW86911.1\|3197547_3198471_-	UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase	NA	NA	NA	NA
AZW86912.1\|3198699_3199884_-	cell division protein FtsZ	NA	NA	NA	NA
AZW86913.1\|3200072_3201299_-	cell division protein FtsA	NA	NA	NA	NA
AZW86914.1\|3201303_3202125_-	cell division protein FtsQ	NA	NA	NA	NA
AZW86915.1\|3202137_3203088_-	D-alanine--D-alanine ligase	NA	NA	NA	NA
AZW86916.1\|3203084_3204491_-	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
AZW86917.1\|3204487_3205561_-	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase	NA	NA	NA	NA
AZW86918.1\|3205557_3206751_-	putative lipid II flippase FtsW	NA	NA	NA	NA
AZW86919.1\|3206747_3208280_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
AZW86920.1\|3208276_3209446_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
AZW86921.1\|3209435_3212273_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
AZW87840.1\|3212269_3213970_-	penicillin-binding protein 2	NA	NA	NA	NA
AZW86922.1\|3213996_3214275_-	cell division protein FtsL	NA	NA	NA	NA
AZW86923.1\|3214274_3215369_-	ribosomal RNA small subunit methyltransferase H	NA	NA	NA	NA
AZW86924.1\|3215377_3215869_-	transcriptional regulator MraZ	NA	NA	NA	NA
AZW86925.1\|3216608_3218417_+	ABC transporter ATP-binding protein	A0A1B0RXA0	Streptococcus_phage	1.6e-43	28.6
AZW86926.1\|3218456_3219536_-	dihydroorotase	NA	NA	NA	NA
AZW86927.1\|3219532_3220726_-	amidohydrolase	NA	NA	NA	NA
AZW86928.1\|3220875_3221154_+	DNA topoisomerase III	NA	NA	NA	NA
AZW86929.1\|3221482_3221875_-	hypothetical protein	NA	NA	NA	NA
AZW87841.1\|3228599_3229076_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW86930.1\|3229228_3230341_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
AZW86931.1\|3230408_3230969_-	peptide-methionine (S)-S-oxide reductase	NA	NA	NA	NA
AZW86932.1\|3230992_3231325_-	cytochrome C	NA	NA	NA	NA
AZW86933.1\|3231308_3232997_-	dihydroxy-acid dehydratase	NA	NA	NA	NA
AZW86934.1\|3233116_3233905_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
AZW86935.1\|3234612_3235563_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86936.1\|3236007_3236319_-	cell division protein ZapA	NA	NA	NA	NA
AZW86937.1\|3236318_3236849_-	hypothetical protein	NA	NA	NA	NA
AZW86938.1\|3237011_3237962_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86939.1\|3238060_3239011_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86940.1\|3239300_3239765_+	tripartite tricarboxylate transporter TctB family protein	NA	NA	NA	NA
AZW86941.1\|3239779_3241285_+	tripartite tricarboxylate transporter permease	NA	NA	NA	NA
AZW86942.1\|3241538_3243146_+	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW86943.1\|3243201_3244107_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZW86944.1\|3244547_3245498_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86945.1\|3245596_3246547_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_25

3268272 : 3306687

Tupanvirus(16.67%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW86967.1\|3268272_3268608_+\|holin	phage holin family protein	NA	NA	NA	NA
AZW86968.1\|3268607_3269450_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
AZW86969.1\|3269548_3270499_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86970.1\|3270563_3271535_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW86971.1\|3271598_3272618_-	histone deacetylase family protein	A0A2K9L473	Tupanvirus	3.4e-22	31.7
AZW87844.1\|3272619_3273993_-	MFS transporter	NA	NA	NA	NA
AZW86972.1\|3274270_3274951_-	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
AZW86973.1\|3274963_3277090_+	lytic transglycosylase	A0A0S2SXL7	Bacillus_phage	5.5e-14	36.6
AZW86974.1\|3277086_3278181_+	CCA-adding enzyme	A0A0F6YPT7	Sinorhizobium_phage	2.4e-50	50.5
AZW86975.1\|3278195_3279455_-	SAM-dependent methyltransferase	NA	NA	NA	NA
AZW86976.1\|3279474_3281199_-	ATP-dependent helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.5e-49	32.9
AZW86977.1\|3281437_3282190_-	uracil-DNA glycosylase	A0A1Y0B680	Bovine_alphaherpesvirus	2.5e-46	47.5
AZW86978.1\|3282328_3283279_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87845.1\|3283591_3285070_+	phospholipase D family protein	NA	NA	NA	NA
AZW86979.1\|3285076_3286186_-	molybdenum import ATP-binding protein ModC	G9BWD6	Planktothrix_phage	7.5e-23	34.5
AZW86980.1\|3286197_3286878_-	molybdate ABC transporter permease subunit	NA	NA	NA	NA
AZW86981.1\|3286899_3287655_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87846.1\|3287790_3288675_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW86982.1\|3288762_3289344_+	hypothetical protein	NA	NA	NA	NA
AZW86983.1\|3289436_3289559_-	hypothetical protein	NA	NA	NA	NA
AZW86984.1\|3289604_3289904_-	DUF4148 domain-containing protein	NA	NA	NA	NA
AZW87847.1\|3290055_3290481_-	hypothetical protein	NA	NA	NA	NA
AZW86985.1\|3292687_3293191_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
AZW86986.1\|3293206_3294157_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86987.1\|3294143_3294341_-	hypothetical protein	NA	NA	NA	NA
AZW86988.1\|3294684_3295458_-	molybdate ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW86989.1\|3295590_3296601_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW86990.1\|3296752_3298408_-	gamma-glutamyltransferase family protein	NA	NA	NA	NA
AZW86991.1\|3298462_3298804_-	cupin domain-containing protein	NA	NA	NA	NA
AZW86992.1\|3298817_3300257_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW86993.1\|3300389_3301205_-	MerR family transcriptional regulator	NA	NA	NA	NA
AZW86994.1\|3301223_3301412_+	hypothetical protein	NA	NA	NA	NA
AZW86995.1\|3301398_3302349_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW86996.1\|3303736_3304684_+	hypothetical protein	NA	NA	NA	NA
AZW86997.1\|3304910_3305651_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW86998.1\|3305736_3306687_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_26

3382094 : 3435835

Staphylococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW87050.1\|3382094_3383045_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87051.1\|3383449_3384094_-	urease accessory protein UreG	NA	NA	NA	NA
AZW87052.1\|3384118_3384703_-	urease accessory protein UreF	NA	NA	NA	NA
AZW87053.1\|3384803_3385421_-	urease accessory protein UreE	NA	NA	NA	NA
AZW87054.1\|3385423_3387139_-	urease subunit alpha	NA	NA	NA	NA
AZW87055.1\|3387135_3387444_-	urease subunit beta	NA	NA	NA	NA
AZW87056.1\|3387460_3388096_-	urease accessory protein UreJ	NA	NA	NA	NA
AZW87057.1\|3388122_3388425_-	urease subunit gamma	NA	NA	NA	NA
AZW87058.1\|3388525_3389380_-	urease accessory protein UreD	NA	NA	NA	NA
AZW87059.1\|3389961_3390234_+	MerR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AZW87060.1\|3390651_3391059_-	GFA family protein	NA	NA	NA	NA
AZW87061.1\|3391428_3392223_-	GntR family transcriptional regulator	NA	NA	NA	NA
AZW87062.1\|3392323_3393559_+	methylaspartate ammonia-lyase	NA	NA	NA	NA
AZW87063.1\|3393627_3394644_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW87064.1\|3394640_3396032_+	MmgE/PrpD family protein	NA	NA	NA	NA
AZW87065.1\|3396028_3397225_+	MFS transporter	NA	NA	NA	NA
AZW87066.1\|3397221_3398760_-	SpoVR family protein	NA	NA	NA	NA
AZW87067.1\|3398756_3400016_-	hypothetical protein	NA	NA	NA	NA
AZW87068.1\|3401956_3402907_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87069.1\|3403673_3404768_-	CoA transferase	NA	NA	NA	NA
AZW87070.1\|3404760_3406095_-	CoA ligase	NA	NA	NA	NA
AZW87071.1\|3406048_3406732_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW87072.1\|3406757_3407921_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW87073.1\|3407917_3408919_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW87074.1\|3408918_3409791_-	branched-chain amino acid ABC transporter permease	NA	NA	NA	NA
AZW87075.1\|3409787_3410537_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-09	27.8
AZW87076.1\|3410533_3411325_-	ABC transporter ATP-binding protein	A0A1M7XV31	Cedratvirus	1.7e-08	29.4
AZW87077.1\|3411321_3412461_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87078.1\|3412769_3413522_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
AZW87079.1\|3413555_3414338_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW87080.1\|3414341_3414731_+	DNA-binding protein	NA	NA	NA	NA
AZW87081.1\|3415870_3416734_+	3-alpha,7-alpha, 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase	NA	NA	NA	NA
AZW87082.1\|3416769_3417858_+	hypothetical protein	NA	NA	NA	NA
AZW87083.1\|3417854_3418805_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87084.1\|3418791_3419160_-	hypothetical protein	NA	NA	NA	NA
AZW87085.1\|3419158_3422137_+	hypothetical protein	NA	NA	NA	NA
AZW87086.1\|3423063_3423942_+	fatty acid desaturase	NA	NA	NA	NA
AZW87087.1\|3425890_3426841_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87088.1\|3426837_3427305_-	ribonuclease HI	J9Q745	Salmonella_phage	5.6e-36	50.7
AZW87089.1\|3427347_3428118_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
AZW87090.1\|3428138_3428939_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
AZW87091.1\|3428949_3430359_+	lytic transglycosylase	NA	NA	NA	NA
AZW87092.1\|3430453_3431239_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
AZW87851.1\|3431478_3432495_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW87093.1\|3432602_3432995_-	OsmC family peroxiredoxin	NA	NA	NA	NA
AZW87094.1\|3433132_3433813_+	DUF533 domain-containing protein	NA	NA	NA	NA
AZW87095.1\|3433817_3434816_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW87096.1\|3434884_3435835_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_27

3441990 : 3501290

Acinetobacter_phage(27.27%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW87100.1\|3441990_3443754_+\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	5.0e-162	50.0
AZW87101.1\|3443865_3444744_+	septum site-determining protein MinC	NA	NA	NA	NA
AZW87102.1\|3444856_3445672_+	septum site-determining protein MinD	NA	NA	NA	NA
AZW87103.1\|3445675_3445927_+	cell division topological specificity factor	NA	NA	NA	NA
AZW87852.1\|3446011_3447028_-\|transposase	IS110 family transposase IS1663	NA	NA	NA	NA
AZW87104.1\|3447358_3447580_-	hypothetical protein	NA	NA	NA	NA
AZW87105.1\|3449940_3450858_-	EamA/RhaT family transporter	NA	NA	NA	NA
AZW87106.1\|3451355_3452564_-	ABC transporter permease	NA	NA	NA	NA
AZW87107.1\|3452643_3454215_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
AZW87108.1\|3454332_3455268_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
AZW87109.1\|3455456_3456401_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	8.4e-07	23.2
AZW87110.1\|3456469_3456685_-	hypothetical protein	NA	NA	NA	NA
AZW87111.1\|3456968_3462686_+	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.0e-195	39.5
AZW87112.1\|3462691_3463819_+	aminodeoxychorismate synthase, component I	S4VT78	Pandoravirus	3.8e-38	37.8
AZW87113.1\|3463874_3464501_+	aminotransferase	NA	NA	NA	NA
AZW87853.1\|3464772_3465789_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AZW87114.1\|3465884_3466595_-	oxidoreductase	NA	NA	NA	NA
AZW87854.1\|3466591_3467581_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
AZW87115.1\|3467712_3469308_+	acyl-CoA synthetase	NA	NA	NA	NA
AZW87116.1\|3469310_3470048_+	GntR family transcriptional regulator	NA	NA	NA	NA
AZW87117.1\|3470203_3471076_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
AZW87118.1\|3471344_3472565_+	MFS transporter	NA	NA	NA	NA
AZW87119.1\|3472561_3473221_+	gamma-glutamylcyclotransferase	NA	NA	NA	NA
AZW87120.1\|3473292_3473925_+	pyridoxine/pyridoxamine 5'-phosphate oxidase	NA	NA	NA	NA
AZW87121.1\|3473954_3474473_+	flavin reductase	NA	NA	NA	NA
AZW87122.1\|3474483_3475593_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
AZW87123.1\|3475639_3476494_+	formyltetrahydrofolate deformylase	NA	NA	NA	NA
AZW87124.1\|3476495_3477398_-	LysR family transcriptional regulator	NA	NA	NA	NA
AZW87125.1\|3478620_3479571_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87126.1\|3481327_3482317_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87127.1\|3482492_3483281_-	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	5.1e-66	53.0
AZW87128.1\|3483277_3484309_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	7.4e-73	42.7
AZW87129.1\|3484327_3484891_-	type 1 glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	1.1e-65	62.1
AZW87130.1\|3484946_3486467_-	anthranilate synthase component I	S4VT78	Pandoravirus	9.0e-43	32.1
AZW87131.1\|3486730_3487435_-	phosphoglycolate phosphatase	NA	NA	NA	NA
AZW87132.1\|3487442_3488180_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZW87133.1\|3488285_3488660_+	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZW87134.1\|3488702_3489992_+	hypothetical protein	NA	NA	NA	NA
AZW87135.1\|3489988_3491158_+	ubiquinone biosynthesis protein UbiH	NA	NA	NA	NA
AZW87136.1\|3491154_3491994_+	thiol:disulfide interchange protein DsbC	NA	NA	NA	NA
AZW87137.1\|3492053_3492989_+	hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	6.4e-15	27.7
AZW87138.1\|3493001_3493952_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87139.1\|3494050_3495013_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	4.6e-93	64.5
AZW87140.1\|3495044_3495404_-	dihydroneopterin aldolase	NA	NA	NA	NA
AZW87141.1\|3495528_3496431_+	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.9e-08	24.0
AZW87142.1\|3496432_3498205_-	PDZ domain-containing protein	NA	NA	NA	NA
AZW87143.1\|3498239_3499016_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW87144.1\|3500339_3501290_-\|transposase	IS481 family transposase	NA	NA	NA	NA

DBSCAN-SWA_28

3516228 : 3574301

Planktothrix_phage(12.5%)

transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZW87156.1\|3516228_3517179_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87157.1\|3517307_3518441_-	peptidase	NA	NA	NA	NA
AZW87158.1\|3518484_3519390_-	alpha/beta hydrolase	NA	NA	NA	NA
AZW87159.1\|3519392_3521093_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-15	32.7
AZW87160.1\|3521089_3522010_-	ABC transporter permease	NA	NA	NA	NA
AZW87161.1\|3522017_3522995_-	ABC transporter permease	NA	NA	NA	NA
AZW87162.1\|3523053_3524088_-	succinylglutamate desuccinylase	NA	NA	NA	NA
AZW87163.1\|3526062_3526299_-	hypothetical protein	NA	NA	NA	NA
AZW87164.1\|3526425_3527289_-	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
AZW87165.1\|3527377_3528199_+	enoyl-CoA hydratase	NA	NA	NA	NA
AZW87166.1\|3528278_3529016_-	enoyl-CoA hydratase	NA	NA	NA	NA
AZW87167.1\|3529012_3530005_-	nitronate monooxygenase	NA	NA	NA	NA
AZW87168.1\|3530118_3530781_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
AZW87169.1\|3530825_3531974_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
AZW87170.1\|3534297_3535248_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87171.1\|3535588_3536539_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87172.1\|3536637_3537588_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87173.1\|3537884_3538382_+	hypothetical protein	NA	NA	NA	NA
AZW87174.1\|3538424_3540200_+	copper resistance system multicopper oxidase	NA	NA	NA	NA
AZW87857.1\|3540246_3541074_+	copper resistance protein B	NA	NA	NA	NA
AZW87175.1\|3541080_3541815_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
AZW87176.1\|3542984_3543779_-	IclR family transcriptional regulator	NA	NA	NA	NA
AZW87177.1\|3544068_3544659_+	cysteine dioxygenase	NA	NA	NA	NA
AZW87178.1\|3544692_3546021_-	amidase	NA	NA	NA	NA
AZW87179.1\|3546095_3547241_-	transporter	NA	NA	NA	NA
AZW87180.1\|3547352_3548351_+\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87181.1\|3548313_3548748_+	carbon monoxide dehydrogenase	NA	NA	NA	NA
AZW87182.1\|3550264_3551149_+	EamA/RhaT family transporter	NA	NA	NA	NA
AZW87183.1\|3551145_3552351_-	cardiolipin synthase ClsB	NA	NA	NA	NA
AZW87184.1\|3552347_3553208_-	endonuclease	NA	NA	NA	NA
AZW87185.1\|3553320_3555111_-\|tRNA	aspartate--tRNA ligase	A0A1V0SAC0	Catovirus	6.5e-08	25.5
AZW87186.1\|3555151_3555817_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	6.7e-11	28.4
AZW87187.1\|3555817_3556126_-	FmdB family transcriptional regulator	NA	NA	NA	NA
AZW87858.1\|3556291_3557578_-	hypothetical protein	NA	NA	NA	NA
AZW87188.1\|3559011_3559962_-\|transposase	IS481 family transposase	NA	NA	NA	NA
AZW87189.1\|3561913_3563128_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AZW87190.1\|3563233_3564223_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	4.3e-38	37.7
AZW87191.1\|3564219_3564828_+	hydrolase	E3T535	Cafeteria_roenbergensis_virus	5.2e-10	26.1
AZW87192.1\|3564840_3565470_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AZW87193.1\|3565466_3566087_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
AZW87194.1\|3566118_3566910_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.5e-20	27.4
AZW87195.1\|3567752_3568217_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
AZW87196.1\|3568235_3569162_+	HPr kinase/phosphorylase	NA	NA	NA	NA
AZW87197.1\|3569215_3570502_-	cytochrome c	NA	NA	NA	NA
AZW87198.1\|3571432_3572305_+	RNase adaptor protein RapZ	A0A1P8D5W0	Corynebacterium_phage	2.4e-08	34.5
AZW87199.1\|3572301_3573252_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	6.9e-17	47.2
AZW87200.1\|3573350_3574301_+\|transposase	IS481 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP025348

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection