CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP022478	Pseudomonas aeruginosa strain LW chromosome, complete genome	1 crisprs	RT,DEDDh,cas3,WYL,csa3,DinG	0	3	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP022478_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP022478_2

5865026-5865139

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP022478_2

>merge|CP022478|2|5865026-5865139|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>CP022478|2|1|5865026-5865139|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
CP022478.1\|AZZ15255.1\|5869711_5870215_-\|transcriptional-regulator	unknown	unknown	unknown
CP022478.1\|AZZ15259.1\|5872769_5873468_+\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|226274
CP022478.1\|AZZ15257.1\|5870929_5871949_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
CP022478.1\|AZZ15251.1\|5862990_5864145_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
CP022478.1\|AZZ15249.1\|5860316_5861420_+\|putrescine-binding-periplasmic-protein-SpuD	unknown	unknown	gnl\|CDD\|270377
CP022478.1\|AZZ15248.1\|5858830_5860201_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
CP022478.1\|AZZ15261.1\|5874309_5874804_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|224597
CP022478.1\|AZZ15256.1\|5870319_5870931_-\|thiol-disulfide-isomerase	unknown	unknown	gnl\|CDD\|239267
CP022478.1\|AZZ15244.1\|5853641_5854703_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377
CP022478.1\|AZZ15242.1\|5851874_5852753_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
CP022478.1\|AZZ15245.1\|5854958_5856335_-\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP022478.1\|AZZ15260.1\|5873489_5874044_-\|hypothetical-protein	unknown	unknown	unknown
CP022478.1\|AZZ15247.1\|5857406_5858765_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP022478.1\|AZZ16311.1\|5868566_5868716_-\|transcriptional-regulator	unknown	unknown	unknown
CP022478.1\|AZZ15253.1\|5866182_5868570_-\|penicillin-acylase-family-protein	unknown	unknown	gnl\|CDD\|225241
CP022478.1\|AZZ15254.1\|5868680_5869733_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
CP022478.1\|AZZ15258.1\|5871968_5872721_-\|hypothetical-protein	unknown	unknown	unknown
CP022478.1\|AZZ15250.1\|5861838_5862936_+\|spermidine-binding-periplasmic-protein-SpuE	unknown	unknown	gnl\|CDD\|270377
CP022478.1\|AZZ15243.1\|5852915_5853581_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP022478.1\|AZZ15246.1\|5856613_5857366_+\|glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|336781

Protein	Function_ID	Function_description	E-value
CP022478.1\|AZZ15259.1\|5872769_5873468_+\|2OG-Fe(II)-oxygenase	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	1.2156e-76
CP022478.1\|AZZ15261.1\|5874309_5874804_+\|DUF523-domain-containing-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	1.65548e-66
CP022478.1\|AZZ15257.1\|5870929_5871949_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	4.26652e-56
CP022478.1\|AZZ15251.1\|5862990_5864145_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
CP022478.1\|AZZ15249.1\|5860316_5861420_+\|putrescine-binding-periplasmic-protein-SpuD	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
CP022478.1\|AZZ15248.1\|5858830_5860201_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
CP022478.1\|AZZ15256.1\|5870319_5870931_-\|thiol-disulfide-isomerase	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.0013342
CP022478.1\|AZZ15244.1\|5853641_5854703_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.13028e-163
CP022478.1\|AZZ15242.1\|5851874_5852753_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
CP022478.1\|AZZ15245.1\|5854958_5856335_-\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.09186e-161
CP022478.1\|AZZ15247.1\|5857406_5858765_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
CP022478.1\|AZZ15253.1\|5866182_5868570_-\|penicillin-acylase-family-protein	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0
CP022478.1\|AZZ15254.1\|5868680_5869733_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	1.47872e-32
CP022478.1\|AZZ15250.1\|5861838_5862936_+\|spermidine-binding-periplasmic-protein-SpuE	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
CP022478.1\|AZZ15243.1\|5852915_5853581_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.42789e-08
CP022478.1\|AZZ15246.1\|5856613_5857366_+\|glutamine-amidotransferase	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108

>CP022478.1|AZZ15251.1|5862990_5864145_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>CP022478.1|AZZ15250.1|5861838_5862936_+|spermidine-binding-periplasmic-protein-SpuE
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>CP022478.1|AZZ15249.1|5860316_5861420_+|putrescine-binding-periplasmic-protein-SpuD
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>CP022478.1|AZZ15248.1|5858830_5860201_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>CP022478.1|AZZ15247.1|5857406_5858765_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>CP022478.1|AZZ15246.1|5856613_5857366_+|glutamine-amidotransferase
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>CP022478.1|AZZ15245.1|5854958_5856335_-|glutamine-synthetase
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
>CP022478.1|AZZ15244.1|5853641_5854703_-|polyamine-ABC-transporter-substrate-binding-protein
MPRLSVLLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTGIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDRQLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPASAQHPRQAHRFIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPVVDEIWKAFRGASH
>CP022478.1|AZZ15243.1|5852915_5853581_-|TetR/AcrR-family-transcriptional-regulator
MQPTSSIRKPRASSQARIAAILDAARGLLADEGIGGLTIYSVAERAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLSGFISDLNR
>CP022478.1|AZZ15242.1|5851874_5852753_-|N-carbamoylputrescine-amidase
MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQELFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYGPLKTLDGSLES
>CP022478.1|AZZ15253.1|5866182_5868570_-|penicillin-acylase-family-protein
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGALARISQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQGKWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWKGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAGDDDSPWWDDRRTERRETRADIVRTAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLKRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>CP022478.1|AZZ16311.1|5868566_5868716_-|transcriptional-regulator
MGQGAGRRVVLHGGSSRLTKDFQGPSIRSMPQAGGIRRMLGTTTRRKDR
>CP022478.1|AZZ15254.1|5868680_5869733_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHGVLTRHAEEQTRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGCAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>CP022478.1|AZZ15255.1|5869711_5870215_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASTLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>CP022478.1|AZZ15256.1|5870319_5870931_-|thiol-disulfide-isomerase
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGPIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRALAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG
>CP022478.1|AZZ15257.1|5870929_5871949_+|alpha/beta-hydrolase
MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFEGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>CP022478.1|AZZ15258.1|5871968_5872721_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAP
>CP022478.1|AZZ15259.1|5872769_5873468_+|2OG-Fe(II)-oxygenase
MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRIRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESVACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVMPASRDRLSLTGWFRRRNESLLQLS
>CP022478.1|AZZ15260.1|5873489_5874044_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>CP022478.1|AZZ15261.1|5874309_5874804_+|DUF523-domain-containing-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGSRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP022478_1	1.1\|4267073\|23\|CP022478\|CRT	4267073-4267095	23	NC_019202	Pseudomonas aeruginosa plasmid pKLC102, complete sequence	13811-13833	0	1.0
CP022478_1	1.1\|4267073\|23\|CP022478\|CRT	4267073-4267095	23	NC_016138	Pseudomonas aeruginosa plasmid pUM505, complete sequence	1066-1088	0	1.0
CP022478_1	1.3\|4267171\|23\|CP022478\|CRT	4267171-4267193	23	NC_019202	Pseudomonas aeruginosa plasmid pKLC102, complete sequence	13909-13931	0	1.0
CP022478_1	1.3\|4267171\|23\|CP022478\|CRT	4267171-4267193	23	NC_016138	Pseudomonas aeruginosa plasmid pUM505, complete sequence	968-990	0	1.0
CP022478_1	1.1\|4267073\|23\|CP022478\|CRT	4267073-4267095	23	NZ_CP030914	Pseudomonas aeruginosa strain Y89 plasmid pY89, complete sequence	25226-25248	1	0.957
CP022478_1	1.2\|4267117\|33\|CP022478\|CRT	4267117-4267149	33	NC_016138	Pseudomonas aeruginosa plasmid pUM505, complete sequence	1012-1044	2	0.939
CP022478_1	1.2\|4267117\|33\|CP022478\|CRT	4267117-4267149	33	NZ_CP030914	Pseudomonas aeruginosa strain Y89 plasmid pY89, complete sequence	25270-25302	2	0.939
CP022478_1	1.2\|4267117\|33\|CP022478\|CRT	4267117-4267149	33	NC_019202	Pseudomonas aeruginosa plasmid pKLC102, complete sequence	13855-13887	2	0.939
CP022478_1	1.3\|4267171\|23\|CP022478\|CRT	4267171-4267193	23	NZ_CP030914	Pseudomonas aeruginosa strain Y89 plasmid pY89, complete sequence	25324-25346	2	0.913
CP022478_1	1.3\|4267171\|23\|CP022478\|CRT	4267171-4267193	23	NZ_CP034999	Rhizobium acidisoli strain FH23 plasmid pRapFH23a, complete sequence	399737-399759	4	0.826

1. spacer 1.1|4267073|23|CP022478|CRT matches to NC_019202 (Pseudomonas aeruginosa plasmid pKLC102, complete sequence) position: , mismatch: 0, identity: 1.0

cccgatctacctcattcaacccc	CRISPR spacer
cccgatctacctcattcaacccc	Protospacer
***********************

2. spacer 1.1|4267073|23|CP022478|CRT matches to NC_016138 (Pseudomonas aeruginosa plasmid pUM505, complete sequence) position: , mismatch: 0, identity: 1.0

cccgatctacctcattcaacccc	CRISPR spacer
cccgatctacctcattcaacccc	Protospacer
***********************

3. spacer 1.3|4267171|23|CP022478|CRT matches to NC_019202 (Pseudomonas aeruginosa plasmid pKLC102, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatccgccgagtacgccct	CRISPR spacer
acagaatccgccgagtacgccct	Protospacer
***********************

4. spacer 1.3|4267171|23|CP022478|CRT matches to NC_016138 (Pseudomonas aeruginosa plasmid pUM505, complete sequence) position: , mismatch: 0, identity: 1.0

acagaatccgccgagtacgccct	CRISPR spacer
acagaatccgccgagtacgccct	Protospacer
***********************

5. spacer 1.1|4267073|23|CP022478|CRT matches to NZ_CP030914 (Pseudomonas aeruginosa strain Y89 plasmid pY89, complete sequence) position: , mismatch: 1, identity: 0.957

cccgatctacctcattcaacccc	CRISPR spacer
cccgatctaccccattcaacccc	Protospacer
***********.***********

6. spacer 1.2|4267117|33|CP022478|CRT matches to NC_016138 (Pseudomonas aeruginosa plasmid pUM505, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaatcagcaacaagcaatgcgctttaccgct	CRISPR spacer
tgaaatcagcggcaagcaatgcgctttaccgct	Protospacer
**********..*********************

7. spacer 1.2|4267117|33|CP022478|CRT matches to NZ_CP030914 (Pseudomonas aeruginosa strain Y89 plasmid pY89, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaatcagcaacaagcaatgcgctttaccgct	CRISPR spacer
tgaaatcagcggcaagcaatgcgctttaccgct	Protospacer
**********..*********************

8. spacer 1.2|4267117|33|CP022478|CRT matches to NC_019202 (Pseudomonas aeruginosa plasmid pKLC102, complete sequence) position: , mismatch: 2, identity: 0.939

tgaaatcagcaacaagcaatgcgctttaccgct	CRISPR spacer
tgaaatcagcggcaagcaatgcgctttaccgct	Protospacer
**********..*********************

9. spacer 1.3|4267171|23|CP022478|CRT matches to NZ_CP030914 (Pseudomonas aeruginosa strain Y89 plasmid pY89, complete sequence) position: , mismatch: 2, identity: 0.913

acagaatccgccgagtacgccct	CRISPR spacer
aaaaaatccgccgagtacgccct	Protospacer
* *.*******************

10. spacer 1.3|4267171|23|CP022478|CRT matches to NZ_CP034999 (Rhizobium acidisoli strain FH23 plasmid pRapFH23a, complete sequence) position: , mismatch: 4, identity: 0.826

acagaatccgccgagtacgccct	CRISPR spacer
ggtgaatccgccgagtacgccca	Protospacer
.  *******************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

283361 : 292390

Bacillus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZZ16123.1\|283361_283997_+	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3
AZZ10348.1\|284042_284936_+	peptigoglycan-binding protein LysM	A0A0S2SXL7	Bacillus_phage	3.0e-06	34.3
AZZ10349.1\|285040_286045_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	7.0e-36	37.3
AZZ10350.1\|286471_286795_-	Ferredoxin 1	NA	NA	NA	NA
AZZ10351.1\|286861_289429_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	2.4e-24	22.1
AZZ10352.1\|289408_289573_+	TolB-like translocation protein	NA	NA	NA	NA
AZZ10353.1\|289554_290562_-	TolB-like translocation protein	NA	NA	NA	NA
AZZ10354.1\|290709_291216_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
AZZ10355.1\|291349_292390_+	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

DBSCAN-SWA_2

1247907 : 1292559

Leptospira_phage(18.18%)

transposase,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZZ11248.1\|1247907_1249830_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	5.1e-128	38.5
AZZ11249.1\|1249847_1250381_+	translation initiation factor IF-3	A0A2I7S9Q1	Vibrio_phage	2.0e-13	38.1
AZZ11250.1\|1250442_1250637_+	50S ribosomal protein L35	NA	NA	NA	NA
AZZ11251.1\|1250660_1251017_+	50S ribosomal protein L20	NA	NA	NA	NA
AZZ11252.1\|1251114_1252131_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	7.9e-27	33.3
AZZ11253.1\|1252165_1254544_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
AZZ11254.1\|1254547_1254850_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.0e-11	38.9
AZZ11255.1\|1254830_1255187_+	MerR family transcriptional regulator	NA	NA	NA	NA
AZZ11256.1\|1255654_1256792_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.6e-44	37.2
AZZ11257.1\|1256893_1257952_+	hypothetical protein	NA	NA	NA	NA
AZZ11258.1\|1257945_1258821_-	WYL domain-containing protein	NA	NA	NA	NA
AZZ11259.1\|1259162_1262882_+	ATP-binding protein	NA	NA	NA	NA
AZZ11260.1\|1262878_1263541_+	hypothetical protein	NA	NA	NA	NA
AZZ11261.1\|1263537_1264782_+	hypothetical protein	NA	NA	NA	NA
AZZ11262.1\|1264785_1265616_+	hypothetical protein	NA	NA	NA	NA
AZZ11263.1\|1265918_1266734_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.3e-60	47.3
AZZ11264.1\|1266781_1267075_-\|transposase	IS3 family transposase	NA	NA	NA	NA
AZZ11265.1\|1267247_1268410_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.8e-83	52.9
AZZ11266.1\|1268566_1271299_+	restriction endonuclease subunit R	A0A097BY72	Enterococcus_phage	1.0e-12	26.2
AZZ11267.1\|1271319_1273773_+	SAM-dependent DNA methyltransferase	J7I0U9	Acinetobacter_phage	1.1e-21	30.5
AZZ11268.1\|1273769_1275707_+	restriction endonuclease subunit S	NA	NA	NA	NA
AZZ11269.1\|1275706_1277710_+	hypothetical protein	NA	NA	NA	NA
AZZ11270.1\|1278882_1280042_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.0e-46	38.3
AZZ11271.1\|1281180_1282035_-	DUF4357 domain-containing protein	NA	NA	NA	NA
AZZ11272.1\|1282378_1283728_-	hypothetical protein	NA	NA	NA	NA
AZZ11273.1\|1283724_1290021_-	histidine kinase	NA	NA	NA	NA
AZZ11274.1\|1290035_1290674_-	radical SAM protein	NA	NA	NA	NA
AZZ11275.1\|1290675_1292559_-\|protease	ATP-dependent Clp protease ATP-binding subunit	A0A2L0V0F4	Agrobacterium_phage	4.4e-39	28.3

DBSCAN-SWA_3

1431396 : 1438290

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZZ11405.1\|1431396_1432677_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
AZZ11406.1\|1432678_1434076_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
AZZ11407.1\|1434080_1435055_-	glutathione-dependent reductase	NA	NA	NA	NA
AZZ11408.1\|1435142_1436126_-	hypothetical protein	A0A2H4JBY5	uncultured_Caudovirales_phage	9.3e-142	74.3
AZZ11409.1\|1436122_1436458_-	sulfurtransferase TusE	A0A2H4J8B6	uncultured_Caudovirales_phage	9.5e-38	68.5
AZZ11410.1\|1436454_1436760_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
AZZ11411.1\|1436759_1437119_-	sulfurtransferase TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-34	61.7
AZZ11412.1\|1437115_1437511_-	sulfurtransferase TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
AZZ11413.1\|1437621_1438290_-	BAX inhibitor protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

DBSCAN-SWA_4

2541282 : 2554666

Pseudomonas_phage(87.5%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZZ12298.1\|2541282_2541795_+	hypothetical protein	A0A0U1VYP0	Pseudomonas_phage	3.6e-97	98.2
AZZ12299.1\|2541798_2542065_-	hypothetical protein	A0A0U1W088	Pseudomonas_phage	1.1e-44	98.9
AZZ12300.1\|2542102_2542732_-	DUF4124 domain-containing protein	A0A2K8IBL8	Pseudomonas_phage	5.5e-55	61.7
AZZ12301.1\|2542808_2543402_-	DUF1737 domain-containing protein	A0A0U1VYP2	Pseudomonas_phage	1.0e-74	98.0
AZZ12302.1\|2543412_2543931_-	hypothetical protein	A0A0U1UNS0	Pseudomonas_phage	1.1e-69	95.9
AZZ12303.1\|2543927_2544461_-	lysozyme	A0A0U1UNS2	Pseudomonas_phage	2.8e-100	97.7
AZZ12304.1\|2544444_2544702_-\|holin	holin	A0A0U1UNM6	Pseudomonas_phage	6.8e-36	98.8
AZZ12305.1\|2544796_2554666_-	PLxRFG domain-containing protein	L7TID4	Pseudomonas_virus	0.0e+00	97.1

DBSCAN-SWA_5

2558691 : 2610340

Pseudomonas_phage(76.92%)

integrase,terminase,tRNA

attL 2560189:2560205|attR 2610382:2610398

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZZ12308.1\|2558691_2560584_-	hypothetical protein	A0A0U1SZM6	Pseudomonas_phage	7.2e-183	99.3
2560189:2560205	attL	NA	NA	NA	NA
AZZ12309.1\|2560584_2561748_-	hypothetical protein	Q5QF56	Pseudomonas_virus	5.4e-88	81.1
AZZ12310.1\|2561740_2564338_-	hypothetical protein	A0A0U1W0G7	Pseudomonas_phage	0.0e+00	99.3
AZZ12311.1\|2564342_2564933_-	hypothetical protein	A0A0U1VYN6	Pseudomonas_phage	8.1e-101	99.0
AZZ12312.1\|2565000_2566191_-	hypothetical protein	A0A2K8HL79	Pseudomonas_phage	3.8e-222	97.7
AZZ12313.1\|2566190_2569154_-	hypothetical protein	A0A0U1W084	Pseudomonas_phage	0.0e+00	98.4
AZZ12314.1\|2569156_2570014_-	hypothetical protein	A0A0U1VYN7	Pseudomonas_phage	4.0e-157	100.0
AZZ12315.1\|2570013_2570439_-	hypothetical protein	A0A2K8HN63	Pseudomonas_phage	2.9e-84	99.3
AZZ12316.1\|2570462_2570870_-	hypothetical protein	A0A0U1UNR7	Pseudomonas_phage	8.7e-70	100.0
AZZ12317.1\|2570850_2571057_-	hypothetical protein	A0A0U1SXT5	Pseudomonas_phage	1.3e-29	100.0
AZZ12318.1\|2571053_2571731_-	hypothetical protein	A0A0U1UNR8	Pseudomonas_phage	2.5e-130	99.6
AZZ12319.1\|2571727_2572600_-	hypothetical protein	A0A0U1UNM5	Pseudomonas_phage	1.2e-164	99.3
AZZ12320.1\|2572664_2573144_-	hypothetical protein	A0A2K8HNV7	Pseudomonas_phage	2.1e-78	99.4
AZZ12321.1\|2573202_2574495_-	DUF4043 domain-containing protein	A0A2K8IBP1	Pseudomonas_phage	2.2e-252	100.0
AZZ12322.1\|2574507_2575533_-	hypothetical protein	Q5QF43	Pseudomonas_virus	3.7e-157	97.7
AZZ12323.1\|2575784_2578103_-	hypothetical protein	A0A2K8HKC3	Pseudomonas_phage	0.0e+00	99.7
AZZ12324.1\|2578112_2579396_-\|terminase	terminase	A0A2K8HZU7	Pseudomonas_phage	3.2e-259	99.5
AZZ12325.1\|2579392_2579959_-	hypothetical protein	A0A2K8HN72	Pseudomonas_phage	4.2e-94	94.7
AZZ12326.1\|2580111_2580336_+	hypothetical protein	A0A0U1UNS7	Pseudomonas_phage	3.2e-34	100.0
AZZ12327.1\|2580338_2580833_-	hypothetical protein	A0A0U1VYN2	Pseudomonas_phage	4.2e-82	99.4
AZZ12328.1\|2580911_2581526_-	ninG protein	L7TH85	Pseudomonas_virus	4.3e-113	100.0
AZZ12329.1\|2581525_2582077_-	hypothetical protein	A0A2K8I9A9	Pseudomonas_phage	4.9e-100	98.9
AZZ12330.1\|2582069_2582927_-	hypothetical protein	A0A0U1UNR3	Pseudomonas_phage	2.9e-147	99.3
AZZ16197.1\|2582913_2583930_-	phage replication protein	A0A0U1UNR4	Pseudomonas_phage	5.6e-150	100.0
AZZ12331.1\|2584032_2584233_-	hypothetical protein	A0A0U1UNM4	Pseudomonas_phage	2.8e-29	100.0
AZZ12332.1\|2584341_2585127_+	transcriptional regulator	A0A0U1SXS9	Pseudomonas_phage	4.1e-148	100.0
AZZ12333.1\|2585179_2585449_-	DUF1654 domain-containing protein	A0A0U1VYM6	Pseudomonas_phage	7.8e-43	100.0
AZZ12334.1\|2585868_2586075_+	hypothetical protein	A0A0U4IBH8	Pseudomonas_phage	3.1e-31	98.5
AZZ12335.1\|2586085_2586292_+	hypothetical protein	A0A0U4ISE6	Pseudomonas_phage	1.5e-33	100.0
AZZ12336.1\|2586309_2586534_+	hypothetical protein	A0A0U4B0L2	Pseudomonas_phage	6.3e-30	95.2
AZZ12337.1\|2586751_2586964_+	hypothetical protein	A0A0U1VYM8	Pseudomonas_phage	1.7e-32	97.1
AZZ12338.1\|2586998_2587370_+	carbon storage regulator	A0A0U1UNS3	Pseudomonas_phage	2.3e-61	99.2
AZZ12339.1\|2587624_2587846_+	hypothetical protein	A0A0U1SZL8	Pseudomonas_phage	9.3e-34	94.5
AZZ12340.1\|2587842_2588214_+	hypothetical protein	A0A2K8HNX4	Pseudomonas_phage	1.3e-59	98.4
AZZ12341.1\|2588475_2589231_+	hypothetical protein	A0A0U1UNQ9	Pseudomonas_phage	9.0e-145	99.6
AZZ12342.1\|2589235_2590252_+	hypothetical protein	A0A0U1UNR0	Pseudomonas_phage	5.5e-121	98.8
AZZ12343.1\|2590381_2590987_+	DNA polymerase III subunit epsilon	A0A0U1W072	Pseudomonas_phage	4.7e-112	99.5
AZZ12344.1\|2590990_2591488_+	single-stranded DNA-binding protein	L7TJL2	Pseudomonas_virus	9.9e-92	100.0
AZZ12345.1\|2591514_2592735_+	recombination-associated protein RdgC	L7TP07	Pseudomonas_virus	1.5e-162	98.0
AZZ12346.1\|2592840_2593155_-	hypothetical protein	NA	NA	NA	NA
AZZ12347.1\|2593423_2596054_+	DNA methylase N-4	H2BD45	Pseudomonas_phage	0.0e+00	99.4
AZZ12348.1\|2596050_2597859_+	DNA cytosine methyltransferase	A0A0U1T6D1	Pseudomonas_phage	3.9e-271	87.4
AZZ12349.1\|2597855_2598299_+	hypothetical protein	A0A2K8HVL6	Pseudomonas_phage	2.5e-78	98.0
AZZ12350.1\|2599158_2599458_+	hypothetical protein	H2BD42	Pseudomonas_phage	2.1e-49	91.3
AZZ12351.1\|2599454_2600213_+	hypothetical protein	Q5QF32	Pseudomonas_virus	5.1e-132	88.4
AZZ12352.1\|2600220_2600415_+	hypothetical protein	NA	NA	NA	NA
AZZ12353.1\|2600407_2600914_+	hypothetical protein	L7TI83	Pseudomonas_virus	2.4e-85	94.6
AZZ12354.1\|2603117_2603540_+	hypothetical protein	H2BD36	Pseudomonas_phage	1.3e-71	99.3
AZZ12355.1\|2603491_2603725_+	AlpA family phage regulatory protein	H2BDA4	Pseudomonas_phage	1.2e-39	97.4
AZZ12356.1\|2603725_2604961_-\|integrase	integrase	Q5QF66	Pseudomonas_virus	2.0e-234	99.8
AZZ12357.1\|2605745_2606600_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	3.0e-27	34.7
AZZ12358.1\|2606657_2608040_-\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	6.9e-42	31.6
AZZ12359.1\|2608049_2609720_-\|tRNA	glutamine--tRNA ligase	A0A222YZ70	Escherichia_phage	1.1e-198	60.1
AZZ12360.1\|2609842_2610340_+	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.4e-13	32.9
2610382:2610398	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3701507 : 3746262

Escherichia_phage(28.57%)

transposase,integrase,holin

attL 3698436:3698451|attR 3758460:3758475

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3698436:3698451	attL	NA	NA	NA	NA
AZZ13367.1\|3701507_3703700_+\|holin	phospholipase C, phosphocholine-specific	NA	NA	NA	NA
AZZ13368.1\|3703717_3704341_+	phospholipase C accessory protein PlcR	NA	NA	NA	NA
AZZ13369.1\|3704428_3705649_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
AZZ13370.1\|3705652_3706612_-	DegV domain-containing protein	NA	NA	NA	NA
AZZ13371.1\|3706802_3707915_-	oxidoreductase	NA	NA	NA	NA
AZZ13372.1\|3707955_3708546_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZZ13373.1\|3708698_3709181_-	glutathione peroxidase	NA	NA	NA	NA
AZZ13374.1\|3709386_3709872_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
AZZ16239.1\|3709840_3710179_+	DUF3565 domain-containing protein	NA	NA	NA	NA
AZZ13375.1\|3710178_3711363_+	propionate/acetate kinase	NA	NA	NA	NA
AZZ13376.1\|3711425_3713540_+	phosphate acetyltransferase	NA	NA	NA	NA
AZZ13377.1\|3713666_3714581_+	acyltransferase	NA	NA	NA	NA
AZZ13378.1\|3714650_3715364_-	OmpA family lipoprotein	NA	NA	NA	NA
AZZ13379.1\|3715469_3716111_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
AZZ13380.1\|3716212_3717232_-	ornithine utilization regulator	NA	NA	NA	NA
AZZ13381.1\|3717356_3718190_+	metal-dependent hydrolase	NA	NA	NA	NA
AZZ13382.1\|3718324_3719266_-	alpha/beta hydrolase	A0A1D8EUH4	Mycobacterium_phage	4.4e-08	33.3
AZZ13383.1\|3719374_3720058_-	TetR family transcriptional regulator	NA	NA	NA	NA
AZZ13384.1\|3720145_3721024_+	hypothetical protein	NA	NA	NA	NA
AZZ13385.1\|3721611_3722817_+\|integrase	integrase	B7SYF8	Stenotrophomonas_phage	3.4e-101	47.8
AZZ13386.1\|3723267_3723507_+	AlpA family phage regulatory protein	NA	NA	NA	NA
AZZ16240.1\|3723559_3724090_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AZZ13387.1\|3724401_3726747_+	hypothetical protein	NA	NA	NA	NA
AZZ13388.1\|3727321_3728401_+	hypothetical protein	NA	NA	NA	NA
AZZ13389.1\|3728397_3729105_+	DUF3800 domain-containing protein	Q71TB8	Escherichia_phage	4.1e-67	52.2
AZZ13390.1\|3729101_3729587_+	hypothetical protein	Q71TB7	Escherichia_phage	4.0e-21	36.1
AZZ13391.1\|3730578_3731562_+\|integrase	integrase	NA	NA	NA	NA
AZZ13392.1\|3732091_3732457_+	hypothetical protein	NA	NA	NA	NA
AZZ13393.1\|3732826_3733288_-	hypothetical protein	NA	NA	NA	NA
AZZ13394.1\|3733581_3734757_+	HNH endonuclease	NA	NA	NA	NA
AZZ13395.1\|3734756_3736007_+	nucleotidyltransferase	NA	NA	NA	NA
AZZ16241.1\|3735999_3737775_+	hypothetical protein	NA	NA	NA	NA
AZZ13396.1\|3737771_3738263_+	hypothetical protein	NA	NA	NA	NA
AZZ16242.1\|3738259_3738808_-	3'-5' exonuclease	NA	NA	NA	NA
AZZ16243.1\|3740011_3740686_-\|integrase	integrase	Q56VN7	Pseudomonas_phage	6.3e-57	50.5
AZZ13397.1\|3740926_3742064_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.0e-46	38.3
AZZ13398.1\|3742719_3743205_+	hypothetical protein	NA	NA	NA	NA
AZZ13399.1\|3743247_3743853_+	DUF2384 domain-containing protein	NA	NA	NA	NA
AZZ13400.1\|3744885_3746262_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.6e-41	32.6
3758460:3758475	attR	NA	NA	NA	NA

DBSCAN-SWA_7

4439949 : 4471566

Ralstonia_virus(12.5%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AZZ13999.1\|4439949_4440900_+\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	3.1e-94	58.3
AZZ14000.1\|4441119_4442091_+	glycerate dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	1.1e-20	31.7
AZZ14001.1\|4442200_4443199_+	16S rRNA methyltransferase	NA	NA	NA	NA
AZZ14002.1\|4443293_4444757_+	lysine-specific permease	NA	NA	NA	NA
AZZ14003.1\|4445109_4445688_+	hypothetical protein	NA	NA	NA	NA
AZZ14004.1\|4445804_4446248_+	hypothetical protein	NA	NA	NA	NA
AZZ14005.1\|4446257_4447283_-	epimerase	NA	NA	NA	NA
AZZ14006.1\|4447426_4448248_-	peptidase M48	NA	NA	NA	NA
AZZ14007.1\|4448410_4450549_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-20	37.1
AZZ14008.1\|4450551_4451166_-	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	5.5e-07	26.4
AZZ14009.1\|4451591_4452296_+	hypothetical protein	G3MA03	Bacillus_virus	9.0e-14	42.5
AZZ14010.1\|4452308_4452572_-	hypothetical protein	NA	NA	NA	NA
AZZ14011.1\|4452571_4452754_-	CPXCG motif-containing cysteine-rich protein	NA	NA	NA	NA
AZZ14012.1\|4452850_4454011_+	glycerol acyltransferase	NA	NA	NA	NA
AZZ14013.1\|4454110_4454389_-	hypothetical protein	NA	NA	NA	NA
AZZ14014.1\|4454936_4455524_-	hypothetical protein	NA	NA	NA	NA
AZZ14015.1\|4456365_4457889_+	malate dehydrogenase (quinone)	NA	NA	NA	NA
AZZ14016.1\|4458961_4460338_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.6e-41	32.6
AZZ14017.1\|4460721_4461135_-	VOC family protein	NA	NA	NA	NA
AZZ14018.1\|4461403_4461694_-	hypothetical protein	NA	NA	NA	NA
AZZ14019.1\|4461776_4462262_-	hypothetical protein	NA	NA	NA	NA
AZZ14020.1\|4462324_4462798_-	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
AZZ14021.1\|4462799_4463357_-	hypoxanthine-guanine phosphoribosyltransferase	A0A2K9L2A2	Tupanvirus	7.6e-08	29.2
AZZ14022.1\|4463524_4464163_+	uracil phosphoribosyltransferase	NA	NA	NA	NA
AZZ14023.1\|4464165_4465449_+	uracil permease	Q9KX94	Enterobacteria_phage	1.1e-60	39.1
AZZ14024.1\|4465768_4466317_+\|coat	spore coat protein U	NA	NA	NA	NA
AZZ14025.1\|4466347_4466881_+\|coat	spore coat protein U	NA	NA	NA	NA
AZZ14026.1\|4466880_4467423_+\|coat	spore coat protein U	NA	NA	NA	NA
AZZ14027.1\|4467441_4468230_+	molecular chaperone	NA	NA	NA	NA
AZZ14028.1\|4468246_4470622_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
AZZ14029.1\|4470618_4471566_+\|coat	spore coat protein U	NA	NA	NA	NA

DBSCAN-SWA_8

6149853 : 6248030

Pseudomonas_phage(29.55%)

plate,tRNA,tail,transposase,integrase,holin

attL 6146101:6146117|attR 6160632:6160648

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
6146101:6146117	attL	NA	NA	NA	NA
AZZ15529.1\|6149853_6149958_-\|integrase	integrase	NA	NA	NA	NA
AZZ15530.1\|6150749_6152126_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.6e-41	32.6
AZZ15531.1\|6153872_6154175_+	XRE family transcriptional regulator	NA	NA	NA	NA
AZZ15532.1\|6154202_6155510_-	FRG domain-containing protein	NA	NA	NA	NA
AZZ15533.1\|6155537_6158522_-	hypothetical protein	A0A1B1IUG5	uncultured_Mediterranean_phage	4.1e-07	32.3
AZZ15534.1\|6158807_6162545_-	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	4.8e-13	35.4
6160632:6160648	attR	NA	NA	NA	NA
AZZ15535.1\|6162651_6164505_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.2e-36	33.8
AZZ15536.1\|6164584_6166579_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.8e-73	40.7
AZZ15537.1\|6166661_6167111_-\|tRNA	glutamyl-tRNA amidotransferase	A0A292GL36	Xanthomonas_phage	2.9e-18	38.8
AZZ15538.1\|6167180_6167396_-	30S ribosomal protein S21	NA	NA	NA	NA
AZZ15539.1\|6167596_6168622_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.1e-108	57.8
AZZ15540.1\|6168700_6169270_-	glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
AZZ15541.1\|6169353_6169707_+	dihydroneopterin aldolase	NA	NA	NA	NA
AZZ15542.1\|6169697_6170240_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
AZZ15543.1\|6170212_6171445_-\|tRNA	multifunctional tRNA nucleotidyltransferase/2',3'-cyclic phosphodiesterase/2' nucleotidase/2'phosphatase	A0A076G5T8	Escherichia_phage	2.6e-77	43.1
AZZ15544.1\|6171488_6171995_-	DUF4136 domain-containing protein	NA	NA	NA	NA
AZZ15545.1\|6172089_6173643_-	SpoVR family protein	NA	NA	NA	NA
AZZ15546.1\|6173639_6174911_-	hypothetical protein	A0A140HLI1	Bacillus_phage	4.2e-09	37.2
AZZ15547.1\|6175011_6176934_-	PrkA family serine protein kinase	NA	NA	NA	NA
AZZ15548.1\|6177212_6177545_-	thiosulfate sulfurtransferase	NA	NA	NA	NA
AZZ15549.1\|6177588_6178440_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A2H4J0P0	uncultured_Caudovirales_phage	1.1e-08	33.3
AZZ15550.1\|6178439_6178820_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
AZZ15551.1\|6178856_6179663_-	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
AZZ15552.1\|6179778_6180765_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
AZZ15553.1\|6180761_6182054_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
AZZ15554.1\|6182034_6184818_-	LPS-assembly protein LptD	NA	NA	NA	NA
AZZ15555.1\|6184944_6185961_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
AZZ15556.1\|6185957_6186632_+	nucleotidyltransferase family protein	NA	NA	NA	NA
AZZ15557.1\|6186633_6187392_+	molecular chaperone DjlA	NA	NA	NA	NA
AZZ15558.1\|6187392_6188451_-	DUF3530 domain-containing protein	NA	NA	NA	NA
AZZ15559.1\|6188602_6190996_+	histidine kinase	NA	NA	NA	NA
AZZ15560.1\|6191041_6191674_+	DNA-binding response regulator	NA	NA	NA	NA
AZZ15561.1\|6191802_6192837_+	spermidine/putrescine ABC transporter substrate-binding protein	NA	NA	NA	NA
AZZ15562.1\|6193070_6194180_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.8e-28	34.4
AZZ15563.1\|6194235_6195282_+	ABC transporter	NA	NA	NA	NA
AZZ15564.1\|6195396_6196644_+	ABC transporter permease	NA	NA	NA	NA
AZZ15565.1\|6196749_6197580_+	polyamine ABC transporter permease	NA	NA	NA	NA
AZZ15566.1\|6197703_6198378_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
AZZ15567.1\|6198377_6199196_+	phosphoglycolate phosphatase	NA	NA	NA	NA
AZZ15568.1\|6199268_6200747_+	anthranilate synthase component I	NA	NA	NA	NA
AZZ15569.1\|6200933_6201248_-	transcription regulatory protein PrtN	NA	NA	NA	NA
AZZ15570.1\|6201347_6202118_-	transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	7.9e-72	59.0
AZZ15571.1\|6202575_6202776_+	repressor PtrB	W6ATC1	Enterobacter_phage	3.7e-05	58.3
AZZ15572.1\|6202823_6203183_+	hypothetical protein	NA	NA	NA	NA
AZZ15573.1\|6203545_6203995_+\|holin	holin	B5TK61	Pseudomonas_phage	6.5e-26	53.3
AZZ15574.1\|6204016_6204532_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	1.8e-32	43.4
AZZ15575.1\|6204528_6205086_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	7.8e-45	70.3
AZZ15576.1\|6205238_6205565_+	bacteriophage protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.4e-30	60.2
AZZ15577.1\|6205561_6206449_+	bacteriophage protein	S4TNY7	Salmonella_phage	5.3e-88	59.8
AZZ15578.1\|6206441_6206975_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	6.7e-62	64.0
AZZ15579.1\|6206976_6209082_+\|tail	phage tail protein	Q9ZXK6	Pseudomonas_virus	1.5e-221	52.6
AZZ15580.1\|6209089_6209530_+\|tail	phage tail protein	NA	NA	NA	NA
AZZ15581.1\|6209572_6210733_+	bacteriophage protein	Q38068	Phage_PS17	1.2e-188	83.4
AZZ15582.1\|6210745_6211249_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
AZZ15583.1\|6211263_6211608_+\|tail	phage tail assembly protein	NA	NA	NA	NA
AZZ15584.1\|6211777_6214015_+\|tail	phage tail tape measure protein	NA	NA	NA	NA
AZZ15585.1\|6214023_6214896_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	3.9e-75	51.7
AZZ15586.1\|6214870_6215077_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
AZZ15587.1\|6215134_6216124_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.4e-105	54.9
AZZ15588.1\|6216156_6216786_+	glycoside hydrolase family 19	A0A125RNP1	Pseudomonas_phage	3.2e-87	78.5
AZZ16317.1\|6216782_6217145_+	hypothetical protein	NA	NA	NA	NA
AZZ15589.1\|6217141_6217399_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	1.9e-17	63.4
AZZ15590.1\|6217413_6217644_+	hypothetical protein	NA	NA	NA	NA
AZZ15591.1\|6217714_6218209_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	1.4e-45	56.5
AZZ15592.1\|6218220_6218568_+	hypothetical protein	NA	NA	NA	NA
AZZ15593.1\|6218597_6218852_+	hypothetical protein	A0A2H4PI34	Pseudomonas_phage	6.3e-10	38.4
AZZ15594.1\|6218898_6220737_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	3.4e-28	35.8
AZZ15595.1\|6220729_6221071_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-17	40.0
AZZ15596.1\|6221078_6221774_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	1.5e-69	50.2
AZZ15597.1\|6221776_6222547_+	hydrolase Nlp/P60	A0A2D1GNP8	Pseudomonas_phage	5.5e-81	55.6
AZZ15598.1\|6222601_6223204_+\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	1.7e-53	57.8
AZZ15599.1\|6223262_6226922_+\|tail	phage tail protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	56.3
AZZ15600.1\|6227951_6229004_+\|tail	phage tail protein	A0A0H5AXZ9	Pseudomonas_phage	2.9e-64	50.9
AZZ15601.1\|6229003_6229306_+	hypothetical protein	A0A0H5B141	Pseudomonas_phage	4.4e-34	71.0
AZZ15602.1\|6229302_6229533_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	1.4e-24	71.6
AZZ15603.1\|6229950_6230556_+	glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	6.0e-75	65.8
AZZ15604.1\|6230557_6231607_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
AZZ15605.1\|6231603_6232440_+	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9
AZZ15606.1\|6232501_6233146_-	cyclic AMP receptor-like protein	NA	NA	NA	NA
AZZ15607.1\|6233417_6233840_+	peroxiredoxin	NA	NA	NA	NA
AZZ15608.1\|6234159_6234954_+	S-adenosylmethionine decarboxylase proenzyme	NA	NA	NA	NA
AZZ15609.1\|6235008_6235656_-	demethoxyubiquinone hydroxylase family protein	NA	NA	NA	NA
AZZ15610.1\|6235755_6236094_-	histidine triad nucleotide-binding protein	NA	NA	NA	NA
AZZ15611.1\|6236172_6237654_+	ATPase	U5XJW0	Phormidium_phage	3.9e-67	33.8
AZZ15612.1\|6237693_6238494_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AZZ15613.1\|6238554_6239631_-	DUF805 domain-containing protein	NA	NA	NA	NA
AZZ15614.1\|6239752_6240721_-	nitronate monooxygenase	NA	NA	NA	NA
AZZ15615.1\|6240737_6241160_-	TIGR00701 family protein	NA	NA	NA	NA
AZZ15616.1\|6241450_6242485_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
AZZ15617.1\|6242484_6243204_+	hypothetical protein	NA	NA	NA	NA
AZZ15618.1\|6243204_6243627_+	hypothetical protein	NA	NA	NA	NA
AZZ15619.1\|6243704_6244055_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	3.0e-26	53.2
AZZ15620.1\|6244108_6245200_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
AZZ16318.1\|6245202_6246546_-	peptidase M23	O03937	Lactobacillus_phage	3.0e-18	44.1
AZZ15621.1\|6246830_6248030_+\|tRNA	Tyrosine--tRNA ligase 2	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage