CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP028137	Rathayibacter festucae DSM 15932 chromosome, complete genome	11 crisprs	PD-DExK,DEDDh,csa3,WYL,cas3,RT	2	4	0	0

Cas Category Instructions

Results visualization

1. CP028137

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP028137_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_1

413365-413486

Orphan

Consensus_repeat	Method
TGGTCGAGTAGCCCCGCAGGGGCGTATCGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_1

>merge|CP028137|1|413365-413486|CRISPRCasFinder
TGGTCGAGTAGCCCCGCAGGGGCGTATCGAGCGGCGAAGCCGCTTCGCGTCTTGGTGGCGGGTGAAAAGACGCGGCTGCGCCCCGTCATGTTGGTCGAGTAGCCCCGAAGGGGCGTATCGAG

>CP028137|1|1|413365-413486|CRISPRCasFinder
TGGTCGAGTAGCCCCGCAGGGGCGTATCGAG	CGGCGAAGCCGCTTCGCGTCTTGGTGGCGGGTGAAAAGACGCGGCTGCGCCCCGTCATGT
TGGTCGAGTAGCCCCGAAGGGGCGTATCGAG

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ54110.1\|403150_405001_-\|phosphoenolpyruvate-carboxykinase-(GTP)	unknown	unknown	gnl\|CDD\|235256
CP028137.1\|AZZ50951.1\|414350_415085_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ50950.1\|413637_414354_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ50949.1\|411759_413274_+\|glycerol-kinase	unknown	unknown	gnl\|CDD\|234594
CP028137.1\|AZZ50958.1\|422024_423149_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ50956.1\|419521_420802_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224371
CP028137.1\|AZZ50944.1\|405241_406714_+\|XRE-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
CP028137.1\|AZZ50953.1\|415822_416674_-\|aminoglycoside-phosphotransferase	unknown	unknown	gnl\|CDD\|270690
CP028137.1\|AZZ50954.1\|416670_418263_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|100079
CP028137.1\|AZZ50946.1\|407820_408819_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225263
CP028137.1\|AZZ50942.1\|401306_401750_-\|type-II-3-dehydroquinate-dehydratase	unknown	unknown	gnl\|CDD\|235443
CP028137.1\|AZZ50945.1\|406858_407737_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380141
CP028137.1\|AZZ50955.1\|418259_419087_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379312
CP028137.1\|AZZ50947.1\|408857_410729_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223651
CP028137.1\|AZZ50952.1\|415081_415798_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213235
CP028137.1\|AZZ50941.1\|400453_401269_-\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|369777
CP028137.1\|AZZ50948.1\|410930_411689_+\|aquaporin-family-protein	unknown	unknown	gnl\|CDD\|223653
CP028137.1\|AZZ50957.1\|420798_422028_-\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223239
CP028137.1\|AZZ50943.1\|401784_402741_-\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|224523
CP028137.1\|AZZ50959.1\|423330_423585_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226406

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54110.1\|403150_405001_-\|phosphoenolpyruvate-carboxykinase-(GTP)	gnl\|CDD\|235256	PRK04210, PRK04210, phosphoenolpyruvate carboxykinase (GTP).	0
CP028137.1\|AZZ50957.1\|420798_422028_-\|aspartate-aminotransferase-family-protein	gnl\|CDD\|223239	COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism].	1.1799e-54
CP028137.1\|AZZ50949.1\|411759_413274_+\|glycerol-kinase	gnl\|CDD\|234594	PRK00047, glpK, glycerol kinase GlpK.	0
CP028137.1\|AZZ50956.1\|419521_420802_-\|hypothetical-protein	gnl\|CDD\|224371	COG1454, EutG, Alcohol dehydrogenase, class IV [Energy production and conversion].	4.3965e-13
CP028137.1\|AZZ50944.1\|405241_406714_+\|XRE-family-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.15755e-14
CP028137.1\|AZZ50953.1\|415822_416674_-\|aminoglycoside-phosphotransferase	gnl\|CDD\|270690	cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase and Choline Kinase family. This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.80111e-05
CP028137.1\|AZZ50954.1\|416670_418263_-\|hypothetical-protein	gnl\|CDD\|100079	cd06158, S2P-M50_like_1, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.	1.18244e-05
CP028137.1\|AZZ50946.1\|407820_408819_-\|transcriptional-regulator	gnl\|CDD\|225263	COG2390, DeoR, Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription].	3.64322e-80
CP028137.1\|AZZ50942.1\|401306_401750_-\|type-II-3-dehydroquinate-dehydratase	gnl\|CDD\|235443	PRK05395, PRK05395, type II 3-dehydroquinate dehydratase.	6.5421e-81
CP028137.1\|AZZ50945.1\|406858_407737_+\|hypothetical-protein	gnl\|CDD\|380141	pfam18741, MTES_1575, REase_MTES_1575. Vsr REase Fold. Fused to HEPN (SWT1/Abi2 family), along with Transglutaminase and wHTH.	2.97233e-05
CP028137.1\|AZZ50955.1\|418259_419087_-\|hypothetical-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.72422e-11
CP028137.1\|AZZ50947.1\|408857_410729_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|223651	COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion].	2.06991e-134
CP028137.1\|AZZ50952.1\|415081_415798_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213235	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter. The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.	1.68818e-81
CP028137.1\|AZZ50941.1\|400453_401269_-\|SAM-dependent-methyltransferase	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.62162e-20
CP028137.1\|AZZ50948.1\|410930_411689_+\|aquaporin-family-protein	gnl\|CDD\|223653	COG0580, GlpF, Glycerol uptake facilitator and related permeases (Major Intrinsic Protein Family) [Carbohydrate transport and metabolism].	5.41421e-63
CP028137.1\|AZZ50943.1\|401784_402741_-\|acyl-CoA-thioesterase	gnl\|CDD\|224523	COG1607, COG1607, Acyl-CoA hydrolase [Lipid metabolism].	9.13932e-42
CP028137.1\|AZZ50959.1\|423330_423585_+\|hypothetical-protein	gnl\|CDD\|226406	COG3889, COG3889, Predicted solute binding protein [General function prediction only].	0.00169792

>CP028137.1|AZZ50949.1|411759_413274_+|glycerol-kinase
MADYVIAIDQGTTSSRAIIFDKKGSIVSTGQKEHEQIFPRAGWVEHDPIEIWNNVREVIGQALSRADLTRHDIASVGITNQRETAVVWDKTTGKPVYNAIVWQDTRTQSIVDRLAGDEGADRFKSIVGLPLATYFSGTKIVWILENVEGAREKAEAGDLIFGTTDTWVLWNLTGGVDGGVHKTDVTNASRTLFLDLETLEWRDDILEAFGVPKSMLPEVCSSSEVYGQVESSSLLREVPISGILGDQQAATFGQAAFDPGEAKNTYGTGNFLIFNTGTEIVHSKNGLLTTIGYKLGDGEVHYALEGSIAVSGSLIQWLRDNLGLIGSAPEVEALAATVEDNGGAYFVPAFSGLFAPYWRADARGALVGLTRYVNKGHIARAALEATAFQTREVLDAVNADSGVPLQELKVDGGMIANNLLMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWENLDDLRQNWQEDSRWTPQMDQDEAARQYRLWKKAVTKTFDWVDEDVQ
>CP028137.1|AZZ50948.1|410930_411689_+|aquaporin-family-protein
MDNLGVVFLAEVVGTAMLVLLGCGVVANVALVKSKGLNGGTLMVNFGWGFAVFAGVIVSYNSGAHLNPAVTLGLAASGATEFGSGVPVNIVSILMYILAQMIGAILGAVFCWLAYKQHFDQEPDPANKLGVFSTGPAIRSYGWNFVTEVIGTFVLVFVVIGFGGGRQGDGGLAALGALPVAILVIAIGASLGGPTGYAINPARDLGPRIAHALLPIKGKGSSDWSYAWVPVAGPIVGGVLAGLASTALLPIL
>CP028137.1|AZZ50947.1|408857_410729_+|FAD-dependent-oxidoreductase
MCCRVKDGCIPSRYQPSIWGGHTRTRHSTQHLRHEGEYEVAQSVGTPGSSSLRESVSALRDTPRATVLVIGGGINGIGTFRELALNGVDVALVERGDYVSGASSASSHMIHGGIRYLENGEFRLVNEGVHERNGLLKIAPHYVKPLQTTIPIYSTFSGILAAPLRFLTHKSGKPQERGALLIKVGLTLYDFFSRDGGVVPRHQFHGRKRSLNELPKLDPKIKYTATYFDASVHEPERLALDVLRDALVGGKKARAANYVEAVGTSEGGVLLRDRESGEEFAFQADVVVNVSGPWTDFTNTALGTTTKFMGGTKGSHIVLDNPELVEACEGREMFFEHSDGRIVLIYPLKGRVMVGTTDIEADPNEPAVCTEEEIDYFFDLVNHVFPSIPVTREQIVFKFSGIRPLPRHDDETPGFVSRDYRIEPSTLPGGKTPVLSLVGGKWTTFRALSEHLSNEVFKRIGVTRRVSTVKTAIGGGKGFPRTDASRAQWISQHRSGLSSARTGQLLERYGTRAQEVIEALADGHDEALDFDKDFTTGEIRYLAQRESVVHLIDLVMRRTNHAFTGGLSRELLEELAQHTGEVLGWDEAERAQEVDATIEHLKKYNGVDVGGTSVQAPTAVAAS
>CP028137.1|AZZ50946.1|407820_408819_-|transcriptional-regulator
MTPVRPVVELDETTHATHPDKTRDALRAAQLYYMQDLTMDAIAHELHTSRSSVSRLLSHARATGLVDIQIRSPLDRASALSAEVRAHFDITAHIVPVPDHTSEIDRLERVALSAARILGPFIDSNMIVGIAWGSTMSAMSRHLIAKETHNTQIVQLNGAGNTETTGINYSSEILRRFGDAYAAKVQQFPVPAFFDDPMTKKAVWRERSTKRVLELQQRMDVALFGLGSPFAAVPSKVYIGGYLEPSDFTSLSASGVVGDVATVFYRADGTWDDIPMNERASGPDLSTVRRASRRICVVSGASKLPGLRGALAAGLLTDLILDEGTARALISG
>CP028137.1|AZZ50945.1|406858_407737_+|hypothetical-protein
MQDDTETRIVNASTSELARHRLVAEYPVGVFRGARAAIEPVTYGERITAFAAVMRPGEFFSHVTAAHLLQLPDRRATETTPLHVAVTPPMRAARRVGVKSHHLWDEAVTVVDAGQPVTDPASTFCHLADSRSLDELVVLGDALVRPDEELGRRGLRVDLEVLAARAARYRGRGGRRAREAVGFVRVGSESPKETLLRLLLIRAGLPEPELNVELYDADGVFVARVDLLYRNQWVVVEYDGDQHRTDTRQYERDIARSEAIQALGYRHIRVRLSGLVDHPEATAARVRRALGL
>CP028137.1|AZZ50944.1|405241_406714_+|XRE-family-transcriptional-regulator
MTDTTAPAALPAAGTDAALLGQRIRHFRTRRGLTLGQLAERVGVSGSQLSLIETGRREPRLSLMQALATALGVELAALLSDEPPSERAALEIELARVQKGSLYRSLGLPEFKVNKSLTTPVLEAFLGVYRELARRKSEASATPEEARRANTAQRLQLREHNAYLPEIEAVAGEMLRTVGHRGGALTHSSVSKMARHLGFEIIHVGDLPHSARSVIDLANGRIYLPPASIPGGHGLRALALQAMAHRLLGHERPVTYADFLRQRLEINYFAAACLMPLEPAVAFLEEAKRERDITVEDFRDGFGVTHEAAALRFTNLLTSHLDIRMHFLRVLGDGSIQKAYENDGLPLPTDVTGAVEGQIVCRYWSARSAFSRTNRTTEYYQYVDTPAGTFWSASQTGTTATEEFSITVGVPFAEARFFRGRDTDRREQSRCPDESCCRRAPAELAQRWDGNAWPSARLHAHVLAPLPSGTFPGIDDAEVYAFLDTHARES
>CP028137.1|AZZ54110.1|403150_405001_-|phosphoenolpyruvate-carboxykinase-(GTP)
MTAPTPVAAPVVPPAPLALRRWVRETAAILQPDAIEWCDGSPAEWYRLTARMVEEGKLIALNPEWRPGSFLARTDPDDVARVEDRTFLCTTDEADAGPTNNWREPSAMKAELAPYFAGSMRGRTMYVVPFSMGPVGGPLSQLGVQLTDSAYAVLNMRIMARVGAEPLAAFTEETAFVRGVHSVGFPLRDADGTTREDVAWPCNATKYITQFPETREIWSFGSGYGGNALLAKKCFALRIASAMGREEGWLAEHMLLIRIVSPEGRSYHVAAAFPSACGKTNLAMLQPTIPGWRVETLGDDITWMKKSEDGRLWAMNPETGFFGVAPGTGQSSNPNAVHTLWGNTIFTNVALREDGDVWWEGLTDEVPERLTDWRGEPWTPASGTPAAHPNARFTAPAEQCPTLSREWDAFEGVPLDAIVFGGRRASNVPLVTQATSWQHGVFLGATIASEKTAAAEGTVGELRRDPFAMLPFCGYNMADYFAHWLAIGADLGEKAPAIFQVNWFRKAADGSFLWPGFGDNARVLQWLVRRIEGLAESRPSAIGDLPLSINTHGLNLSAAAKEELFSVPVEAWLDECALTEAFFARFGDRLPPELTAELRALRLRLLAEELPAAHAA
>CP028137.1|AZZ50943.1|401784_402741_-|acyl-CoA-thioesterase
MDDRITLRFLAAPQDATADGRSAQAGRVLEWIDKAGYACAVGWSGGYCVTAYVGNVHFTRPIAVGNLIEATAQVIHTGRTSMHVLVRVAQADPRTGRYEAATHCLLIFVAVDEEKRPRPVPEWTPRTIEDLALAEGAAARIDGRRALHEVMRAQEYTEAGTGPRIVFRFLAAPGDVNWGGNAHGGIVMRWIDEAANAVAQGWSGRDAVAVYSGGIHFYRPVRIGHLVEVEARLIHTGPRSMHLAIHVRSGDPRTGELELTTQCMSVFVVRGDDGAAEAVPALEPRSDEDRRLDEHARELIRLRAELPALPVGIAATLA
>CP028137.1|AZZ50942.1|401306_401750_-|type-II-3-dehydroquinate-dehydratase
MKILVVNGPNLNLLGTREPAVYGSDTLADAEALATRAAERLGLGIEFFQSNSEGAIIDRLHEARGTAAGLLLNVGAYTHTSIAIRDAVLATELPLVEVHVSNVHRREEFRRHSYLSDIAVAVIVGAGIAGYGYAVDVLARTLGATDA
>CP028137.1|AZZ50941.1|400453_401269_-|SAM-dependent-methyltransferase
MTPSDATPSASPAELGRSFGSAVDAYDRGRPGYPDDAVDWLVGHAPARVAGAFVPERARAAGADASDRVRAVDLGAGTGKFTASLVARGLDVTAVEPDTAMLERLTAQLPSVRALAGTAEAIPLPDASVELVTAAQSWHWVDPERASAEVARVLVPGGVLALVWNIRDESVPWVRRLGEVAGSSAAERFETVQPPLGSALERVAYAQFEWAYDLDRPALLDMFASRSYVIAMSEEERAAVLAAVGEVVDALPGDRVAMPYATRVTIARRAS
>CP028137.1|AZZ50950.1|413637_414354_-|hypothetical-protein
MTDASAEGPLTRAVAAEFRRVVASRTPLWGLVFGLLPVLPLLLAVMQVDLGALPPGEAASLEHAITAALLQGGVVGAAAFGALRTASAFEKGILARDVLSSGLRPALAARFLVASGAGAVLATAAVAIGVASVAIVSAGRVTPDVGVETLVPMTGIGGAIWGALVGTIVRAPLFVLFAALAPLSVATFTSGTALEDVAPLAALSASAPPTVAAVLAGPAWLLALALVAVASGRRRPLL
>CP028137.1|AZZ50951.1|414350_415085_-|hypothetical-protein
MSGAGALARAEILRSRSGSSFPVLLAYAILIPVFALNMPGTTDRLGGLDDAPASRFVFGFAACAALGACFYGSYAYTRETYYHSLDRTLLLGSRDAILVAKALAGAVSGAVFGVVAVVGWWPISAVVLATVGRRLTPDITLLSASLGVVLACALSGVLGVGVGCAVRNYYACIPIVLVLPAALAVPLLGVARDAGRLLPIGAVAGATGAPVDGMLPAPLALAVLAVWALLAIGGARILEQRRAR
>CP028137.1|AZZ50952.1|415081_415798_-|ABC-transporter-ATP-binding-protein
MSSALDFQHFTKTFRGRRVVDDLSFSVRQGTVVGLLGPNGAGKSTALRGLVGLLRPDSGEARIGGHRFAELRAPARVVGVHLDGLGFENGITGRRHLAIVCRAVGAPLSQVDELLQTVGLTDAARRPVRGYSTGMRQRLGLATALAGDPEILVLDEPANGLDPEGIRWLRRLIRAEAERGRTVLVSSHQLAELEHTVDEVVVLRRRMLFHGPLEDLTRSGGRSLEDGYFDLVDGEAGR
>CP028137.1|AZZ50953.1|415822_416674_-|aminoglycoside-phosphotransferase
MTGGNALERAFEQALRVLAVARDGDTVPGWRGRTLSGPVRRDRERLWLRLVSSPSALAHGTWWTGTADSAVLPALPKPVVLAVEEWDPPHVEGFRLRAELMTRLPGRALSPTAELAPETEVDPAVWVELGGVLDALAAVPTLRESTVPATVDRLLHSFFGDRFPRGTPCWTTAHGDLHPGNLLVAPLGLADWEAWGRGPEHLDVATLYVHSLAAPDARRSLVEVLGERLHSDAALPALAFAAAKVLARSVSGDYPTLVTPVHRLLDDLTARPLGAGGTTARRR
>CP028137.1|AZZ50954.1|416670_418263_-|hypothetical-protein
MSDPAPRLADTVTIDEPIAPGAPWILSVRGVPRARVGPAVATFAAGLRPSAHETDETDGTGSTSLTDEETAALLREFATAGLLAGSERREPRSHRLQFRPPASLQLTLLDATRPALVLARLLRRRPIRLLAVAAVVAVLLLGTASAIAHSAEIAAVLSEPLPLPSLLAVSVAFLLAGAVHEAGHAVSLAAFGGRPRRAGVMIFYLAPAFFCDVTDGWRLGDRRSRAAVALAGPAVHLVLAASAATALLWAPTGRSALACFVVAAALSAVTNLIPLVHLDGYLALVAVLDRPFLRRAAIGAVGDAVLRLLGGTAPRASPWLVLFGVGCRGFALLLIGWAYVRSVPVLVLTEPGAVIALVFAAALLGALVVSLVRFARAAREARVGALRVAVASAVLAAALAGVGALPLEERIEAGYVVRNDEAFLVRTSADPRIVPGTPVRLTSNGIAVRSPRSTAVVSGPAEPLLAPIAALAPLTGLDDVPAVGYPLALPDSASTPPVGGASVSLGGGTIGGAVLDLVAGDALRRLGVGR
>CP028137.1|AZZ50955.1|418259_419087_-|hypothetical-protein
MQHPSDPPPLTAASAALLGALSPATVAPEDLYGPDGSVVYEHFTAEDRSEISPLLAAVRRTEGPILELACGGGRLTVPLLGLGRPVVGLDLSPTMVDILRSRIAALPAARIADGSRALVGDMTCFHLPERFGAVVLGATSIALLDRAGRHAFLRAAREHLGADGVLLITASSPDHAYVAGSRSSRIRAVPGPSGGPGAAVVTSAVTPDGLHRDVEVVQLGLDPEGRAAARFFRSRVNVVDADQVAVEAERAGLWLVARTALVETEDSTLLQLVRA
>CP028137.1|AZZ50956.1|419521_420802_-|hypothetical-protein
MRVRSTDLRSGLASDAATTGSRRTLFVLDSALVRSGAVEPERLHGPVVVLDVAIEQGLLLDTVDRALRAVRPDRLVGIGGGRLHDVAALARLFAADRALRSRIDGLMSRHGGLLAPDLPASTEVPRLVLVPTTIGPGSETSAAACREIGGLRSVVVGEALRADAAVLDAELTATLTRSSVLEGAAEAALRLIGSRSGSPADRSADDRSRRLLEALAEAGGRVAGSAGLVRRADRATLAAASADSHGVLRSATADPFAATHWYLANEVSSRAGLRKVPATMPLLPVLWSRDSPERRARRRAVWQWFAAPLGLDPDPVVGSAQWSERWGITAPAVADRALRDAALAIVARWDSSALPGLAVDDALRLLRAAFPPARALRPNEGGEHMNTTNELEFHELEQAVAPDWESATSGFTTGLLVAGVFVGLLT
>CP028137.1|AZZ50957.1|420798_422028_-|aspartate-aminotransferase-family-protein
MTASPVLVPLVSPTAAARTVAAVSATGTCIRFADGVEAIDLTSGLWNAPFGCGRPEFTAAIAAALAEASYLSLFRRSHPWAERAAAALLAVVGDALPQSSFRRVLLTTSGGSANDAVMKLLRQRAALLGRPERRLVVGLSGSYHGLTYGAHALSGDELGQDVYGVDRSGVRHVAHDDPDALESLLHREGRRICGIVVEPVLGSGALPLSDALLAVLERASREGVPVVADEVATGFGRTGPFLASSRWPFAPDAVVLSKALTNGTLAAAAVVVGERLLAEIDAADAPFVHAETQAGTPAVCAAVLQSLALLPELLGADGFPRVSTCLDRAVTALSAHPRVLGSSGVGSFRALRIAGVAHADEVLGLVEDVRRRGAVVHPAPGGIQFLPAAVSSDRDLADIPRIISAALDA
>CP028137.1|AZZ50958.1|422024_423149_-|hypothetical-protein
MATNPGPIRSDGDATRSLDRGDRGSRTALSTPTGLADADTRATAVDRRGVARAVLQWVTGDRVDARRVVRLADRRWRGAVEPLLGPEDVLLLPSESVTDDDETREAPTCDCAAVLDYRGGLDEPGDVAWFGELRVQTEDYASIAFLPVTGATTARLRDANGWQAYLEDADAARASGRLVPQLLGAAVAVSGLPLTDDPAAGPVAAVDVGRDGVATLGPDGLVLGDARDPDGLAAALDRSYRPLDRLAALGGGVADDIARRPWLALYRAGLAFAAADDTGPAWSVVGLGTSLRPDGEVTTLTRSDLILLHRGDERVLVEPRTLRRFALAPATAVVVERLLSDGPDDEPRTPADEAFVSRLVERFEHEGVHLRRGA
>CP028137.1|AZZ50959.1|423330_423585_+|hypothetical-protein
MAVVRSRFDLVVLVVFGLYGLVRSVLDAPAVIAAPSAVGIASLCASALLLVVAIAALALELRRRRRKRAAASTAAARTGREADW

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_3

881491-881582

Orphan

Consensus_repeat	Method
GTAGGGCGCGGAGCGGCCGTATCGAGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_3

>merge|CP028137|3|881491-881582|CRISPRCasFinder
GTAGGGCGCGGAGCGGCCGTATCGAGACCGACGTGTCCGGCGGGGTGGGAAGCCCTGCTGGCCGAGTAGGGCGCGGAGCGGGCGTATCGAGA

>CP028137|3|3|881491-881582|CRISPRCasFinder
GTAGGGCGCGGAGCGGCCGTATCGAGA	CCGACGTGTCCGGCGGGGTGGGAAGCCCTGCTGGCCGA
GTAGGGCGCGGAGCGGGCGTATCGAGA

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ51303.1\|876407_877466_+\|aminotransferase	unknown	unknown	gnl\|CDD\|223594
CP028137.1\|AZZ51307.1\|880045_881299_+\|deoxyguanosinetriphosphate-triphosphohydrolase	unknown	unknown	gnl\|CDD\|235098
CP028137.1\|AZZ51311.1\|886740_887796_+\|peptide-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
CP028137.1\|AZZ51310.1\|885657_886737_+\|peptide-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
CP028137.1\|AZZ51299.1\|871698_872964_-\|pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
CP028137.1\|AZZ51302.1\|875305_876343_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|183212
CP028137.1\|AZZ51316.1\|893734_894301_-\|peptide-deformylase	unknown	unknown	gnl\|CDD\|234668
CP028137.1\|AZZ51301.1\|874505_875309_+\|isoprenyl-transferase	unknown	unknown	gnl\|CDD\|237826
CP028137.1\|AZZ51305.1\|878276_878819_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|239824
CP028137.1\|AZZ54159.1\|889558_890413_+\|oligopeptide-transporter	unknown	unknown	gnl\|CDD\|213224
CP028137.1\|AZZ51314.1\|891613_892729_+\|SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|368316
CP028137.1\|AZZ54158.1\|873036_873630_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225415
CP028137.1\|AZZ51309.1\|883954_885592_+\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173884
CP028137.1\|AZZ51313.1\|890409_891333_+\|hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240636
CP028137.1\|AZZ51300.1\|873786_874509_+\|DNA-repair-protein-RecO	unknown	unknown	gnl\|CDD\|234622
CP028137.1\|AZZ51308.1\|881802_883656_+\|DNA-primase	unknown	unknown	gnl\|CDD\|235551
CP028137.1\|AZZ51304.1\|877493_878174_+\|disulfide-bond-formation-protein-DsbA	unknown	unknown	gnl\|CDD\|239322
CP028137.1\|AZZ51312.1\|887792_889532_+\|glutathione-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
CP028137.1\|AZZ51306.1\|878895_880053_+\|tRNA-dihydrouridine-synthase-DusB	unknown	unknown	gnl\|CDD\|129820
CP028137.1\|AZZ51315.1\|892855_893683_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226951

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ51303.1\|876407_877466_+\|aminotransferase	gnl\|CDD\|223594	COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones].	1.51265e-35
CP028137.1\|AZZ51307.1\|880045_881299_+\|deoxyguanosinetriphosphate-triphosphohydrolase	gnl\|CDD\|235098	PRK03007, PRK03007, deoxyguanosinetriphosphate triphosphohydrolase-like protein; Provisional.	0
CP028137.1\|AZZ51311.1\|886740_887796_+\|peptide-ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	7.57882e-78
CP028137.1\|AZZ51310.1\|885657_886737_+\|peptide-ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.37854e-102
CP028137.1\|AZZ51299.1\|871698_872964_-\|pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	4.22445e-26
CP028137.1\|AZZ51302.1\|875305_876343_+\|oxidoreductase	gnl\|CDD\|183212	PRK11579, PRK11579, putative oxidoreductase; Provisional.	3.44454e-66
CP028137.1\|AZZ51316.1\|893734_894301_-\|peptide-deformylase	gnl\|CDD\|234668	PRK00150, def, peptide deformylase; Reviewed.	3.23935e-75
CP028137.1\|AZZ51301.1\|874505_875309_+\|isoprenyl-transferase	gnl\|CDD\|237826	PRK14829, PRK14829, undecaprenyl pyrophosphate synthase; Provisional.	3.86808e-145
CP028137.1\|AZZ51305.1\|878276_878819_-\|hypothetical-protein	gnl\|CDD\|239824	cd04332, YbaK_like, YbaK-like. The YbaK family of deacylase domains includes the INS amino acid-editing domain of the bacterial class II prolyl tRNA synthetase (ProRS), and it's trans-acting homologs, YbaK, ProX, and PrdX. The primary function of INS is to hydrolyze mischarged cysteinyl-tRNA(Pro)'s, thus helping ensure the fidelity of translation. Organisms whose ProRS lacks the INS domain express an INS homolog in trans (e.g. YbaK, ProX, or PrdX).	3.30941e-27
CP028137.1\|AZZ54159.1\|889558_890413_+\|oligopeptide-transporter	gnl\|CDD\|213224	cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters. The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE). The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.	1.69344e-71
CP028137.1\|AZZ51314.1\|891613_892729_+\|SAM-dependent-methyltransferase	gnl\|CDD\|368316	pfam05175, MTS, Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases.	1.13735e-52
CP028137.1\|AZZ54158.1\|873036_873630_-\|hypothetical-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	3.94878e-32
CP028137.1\|AZZ51309.1\|883954_885592_+\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173884	cd08519, PBP2_NikA_DppA_OppA_like_20, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.72956e-178
CP028137.1\|AZZ51313.1\|890409_891333_+\|hydroxyacid-dehydrogenase	gnl\|CDD\|240636	cd12159, 2-Hacid_dh_2, Putative D-isomer specific 2-hydroxyacid dehydrogenases. 2-Hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	2.46832e-121
CP028137.1\|AZZ51300.1\|873786_874509_+\|DNA-repair-protein-RecO	gnl\|CDD\|234622	PRK00085, recO, DNA repair protein RecO; Reviewed.	4.87672e-84
CP028137.1\|AZZ51308.1\|881802_883656_+\|DNA-primase	gnl\|CDD\|235551	PRK05667, dnaG, DNA primase; Validated.	0
CP028137.1\|AZZ51304.1\|877493_878174_+\|disulfide-bond-formation-protein-DsbA	gnl\|CDD\|239322	cd03024, DsbA_FrnE, DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	1.89247e-76
CP028137.1\|AZZ51312.1\|887792_889532_+\|glutathione-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	0
CP028137.1\|AZZ51306.1\|878895_880053_+\|tRNA-dihydrouridine-synthase-DusB	gnl\|CDD\|129820	TIGR00737, Probable_tRNA-dihydrouridine_synthase, putative TIM-barrel protein, nifR3 family. This model represents one branch of COG0042 (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family). This branch includes NifR3 itself, from Rhodobacter capsulatus. It excludes a broadly distributed but more sparsely populated subfamily that contains sll0926 from Synechocystis PCC6803, HI0634 from Haemophilus influenzae, and BB0225 from Borrelia burgdorferi. It also excludes a shorter and more distant archaeal subfamily.The function of nifR3, a member of this family, is unknown, but it is found in an operon with nitrogen-sensing two component regulators in Rhodobacter capsulatus.Members of this family show a distant relationship to alpha/beta (TIM) barrel enzymes such as dihydroorotate dehydrogenase and glycolate oxidase. [Unknown function, General].	6.15817e-130
CP028137.1\|AZZ51315.1\|892855_893683_+\|hypothetical-protein	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	8.62114e-05

>CP028137.1|AZZ51307.1|880045_881299_+|deoxyguanosinetriphosphate-triphosphohydrolase
MDDRALWGYSLVDVERFLPEDHSTRRSDFARDRARLFHSSSLRRLAAKTQVLSPTAGVDFARNRLTHSLEVAQIGRELATSLDLDPDVVDTACLAHDIGHPPFGHNGERALNTWAESIGGFEGNAQTFRLLTRLEAKVFGEDDRPYGLNLTRSSLDASCKYPWPDTRSVADPSGRAKYGFYADDEPAFTWMREGAPEGVRCIEAEVMDLSDDIAYSVHDFEDAVFSGYIDVAALGSRVDHDDLVESMHSWVGGEIGHDELVAAFDRLDSLDVWVDSWDGSRRDQARLKNLTSQLIGRFAASATEATREAYSHPDLVRFGGHVVVPREQQAEIAVLKGIVATFVMSRNTRQPIYAQQREVLTRLADTLLERGAGALDAGFAEDWNAAGTDDARRRVVVDQVANLTDQSALSWFERLCS
>CP028137.1|AZZ51306.1|878895_880053_+|tRNA-dihydrouridine-synthase-DusB
MAAPPARTAPALRIGPLELDAPVVLAPMAGITNTAFRRLCREFGNGLYVSEMITSRALVERTPESMRLIRHHPSEKVRSIQLYGVDPKTVAEAVTMLVAEDRADHIDLNFGCPVAKVTRKGGGAALPWKLPLFRQIVEGAVRAAGDVPLTVKMRKGIDSDHLTYLEAGRAAEGAGVASIALHARTASEFYSGQADWSAITTLKQAISSVPVLGNGDIWSAEDALRMMSETGCDGVVVGRGCLGRPWLFGDLAAAFAGSDERFTPTLGQVATAFRRHAQLICEFFESEERGCRDIRKHVAWYFKGYPVGGDLRAKMASVVTLAELDELLATLDPDVPYPGEAAEGQRGRAGSPKTPSLPDRWLESRELNADQRDAVSAAEIHHSGG
>CP028137.1|AZZ51305.1|878276_878819_-|hypothetical-protein
MDGNGTVEDDTVEDGSVEDGTVEDGPARFEADARERGLDVEIVDRPEAGSLAEAAELLGIEPGSIVKSLVVKRHDGGFLFALVPGGRQISWPLLRAVVGVNKLRLPDESVALEATGYRRGTITPIGSTTAWPVVADERIVGRRIAMGAGTSGRSAFVDADALIAAYGATVADITIEEPAR
>CP028137.1|AZZ51304.1|877493_878174_+|disulfide-bond-formation-protein-DsbA
MSEAQTPITVDIWSDIACPWCYIGKRKFERGLAAFCAAHPDAPEVAVEYRSFELSPETPEDYRGGTAEFLAQHKGVPLEQAQQMLDSVTAIAAGVDLDYHFESVVHVKTVRAHQALHHAKANGLQLELKERLLRAYFVEGRDLADTDVLAALSAEVGLDADEARRALDEQRHLADVQSDIAQAREYGINGVPFFVLDGRFGVSGAQEPTAFTEVLEHVLSQRAVVA
>CP028137.1|AZZ51303.1|876407_877466_+|aminotransferase
MSTASPAPADLRALFPGARGYHNACTLGLPPRSTAEALRADLDEWSAGGGTAAGYGAVAERARASFAQIAGVPVDRVAIGSQTSAMAAVLAASLPDGAHVLCVDGDFSSIVFPFLAQAHRGVVVRSVPLEALAESVEDADDLVVFSAVQSSSGALADLDAVVEAAARHGVRTACDLTQAAGVLPVDASRFDATLTHAYKWLCSPRGVAFLTVSPEYAAELLPVQAGWYSGEDVWSSCYGPAMHLAENARRFDVSPAWQAFVGAEASLELFRSLDLAQVWARASGLGDQLCERLDRAPQHRAIVSWPDEDGADLARLQAAGLRVSGRGGRLRVAFHLWNDESDVDELVRVLRE
>CP028137.1|AZZ51302.1|875305_876343_+|oxidoreductase
MTRGRTVRVGLVGYGLAGRVFHAPFVEADSDFDLVAISTSDPERAAAAASAHPGARIVGGLDAVLAERPDMVVLATPPSVHREQAEQVLAAGVAVVIDKPFAPSTADVDAILAASEAGGAPVFVFQNRRWDADFLTLRRLLDEGALGDVIRFESTFERWSAPKTGRWQTAIGPAQGGGILFDLGSHLVDQALVLFGPAVVTAAETRVVHAGGASEDDAFVSLRHESGVRSHLTMSRVARASAPRFRVLGTRAAFSVDGLDPQEGALRGGSATPLDDDFGVVPAGAEGALTDEHGTTVVPSERGHYAAFLAGVARALLDGAPSPVDVRDARAVVALIEQAHALATR
>CP028137.1|AZZ51301.1|874505_875309_+|isoprenyl-transferase
MKPFTHRDAVPFRPLDWTGVHPPELPRKAVPEHVAIVMDGNGRWANSRGLTRVEGHKRGEASLLDVVAGAIQIGVKHLSVYAFSTENWKRSPDEVRFLMGFNRDVLHRRRDQLNEWGVRVRWAGRKPRLWASVINELQYAEKLTEGNDVLTLTMCVNYGGRTEIADAVQRIAAEVAAGRLKPSGITEKTIGKALYLPDMPDVDLFVRSSGEQRTSNFLLWQSAYAEMVFLDRLWPDFTREDLWGAIEHYAGRTRRFGGAVDVPGASS
>CP028137.1|AZZ51300.1|873786_874509_+|DNA-repair-protein-RecO
MPTYRDEAVVLRTHKLGEADRIVTLLSRSHGKIRAVAKGVRKTGSKFGSRLEPFMVADLQLYEGRSLDIVTQAESLGAYGAIIAADYDSYTAASAMVETADRLTDADASLQQYLLLVGALRSLSKHEHEPVLTLDSYLLRALSIAGWAPSFEDCARCGAPGPHGAVVVQLGGVVCEDCTPPGAPRVAPEVVVLLGALLTGDWEHAETMEPSTRSRASGVVAAYTQWHLERGLRSLEHVTR
>CP028137.1|AZZ54158.1|873036_873630_-|hypothetical-protein
MFAGEFRDRRIDLLGVTIIGTATGLGGGVLRDLLLQTPLVALHTNAYLLVAVTASLFGMLLQHVLNRVDGTITALDALTIGLFGAIGTTKALSLGVPEVPAVFVGTVSAVGGSVIRDILLNRPIALMHVGSLYAIAATAGTVVLVVALRFGMVIDYAAPIAVLVTAVIRLLAVRYGWSLPEQRALSRVPRLGWRKRG
>CP028137.1|AZZ51299.1|871698_872964_-|pyridine-nucleotide-disulfide-oxidoreductase
MTAAGTTTDRHDVLIIGGGNAGLSVAGRLRRYGVADVAVIEPRETHLYQPMFSHVAGGTAPASKATRPQGSVTPKGVTWIRDRVEAIDPAAKTVVLASGRRVGYGDLVVCPGIQKDWDAVPGLTEAMASPVGVSNYEFDYARKASSVLRGVRSGTVVFTQPSGPGTCSGASQKPMYLACDYWRETGVLADIRVVLVVPTPTMFGMPLIDAELERKVAEYGIDVRYSRELVEVDAEKRTVVIAGEDGRRAQLGVDHDGGHVGSEQRETLSYDVLHAVPPQSAPDWLAGTGLVAEGSTGGFVEVDPLTLRHPRHPEVWALGDAAATTNSKSGGALRQQTKTLAKNLVAARKGKPLPQVYNGYSVCPFVVSRSTVVFAEFDDRYRPKPTVPFWKGLAKERRLTFLADRYLLPWVYWNLILQGRA
>CP028137.1|AZZ51308.1|881802_883656_+|DNA-primase
MPRIRQTDVEEVKARVNIADVVGEYVTLKSAGVGSLKGLCPFHDERSPSFHVRPQAGFYHCFGCQESGDVYSFVMKMDHTSFSETVERLAGRIGFPLQYEEGGGQAPETGGRARLIAANNAAEEFFREQLATPGADVGRRFLGERGFDRAAADRFGVGFAPDGWDGLTTALKRRGFSEEELTTAGLVSSSNRGGVYDRFRGRLVWPIRDVTGQTVGFGARRLLEEDKGPKYLNTPESPVYHKSQVLYGLDLAKRDISRGHRVVVVEGYTDVMACHLAGVTTAVATCGTSFGVDHIKVLRRVLGDDSGVGEVVFTFDPDAAGQKAAMRAFQEEHRFAAQTFVAVAPEGLDPCDLRLNRGDDAVRRLIDDKKPMFEFVIRQLLSRYDLDTVEGRIAALRAAAPVVAEIRDPALRPGYSRELARMLGLDMSEVNSAVRSAGSRARNAPGGRDERPQEDAPEAPAGARIADLPVDVVTRIEREALMAMLQLPQVMGESLLARAAHAAVTNETLRVVRDAVVANLERAQDRDWVEHVAADVPGPFASLVHQLAVAPIPAADEAGLARYSKDVAISLIERDLLREIAELRGALQRASTDPVLSRAVQVRLVELEREKRALRTE
>CP028137.1|AZZ51309.1|883954_885592_+|peptide-ABC-transporter-substrate-binding-protein
MTSGFTRGSRALGTAAGFAAVALVLAGCSAGGGDSTGGAAGGTLTIGTTDKITTLDPAGSYDNGSFAVMNQVFPFLMNTPYGSPDVEPDIAESAEFTAPTEYTVTLKDGLKWANGHDLTSSDVKFSFDRQVAIAAENGPSSLLANLDSVAAPDDTTVVFTLKSENDQTFPQILSSPAGPIVDEEVFSADELTADADIVSGDAFAGQYTIANYDVNNLIQYKAYDDYQGVLGAAKTGTVNVKYYADSSNLKLDIQEGNIDVAYRSLSATDVEDLRGNDAVKVVDGPGGEIRYIVFNFDTQPFGATTAEADAAKALAVRQAAADLIDRQEIADQVYKGTYTPLYSYVPQGLTGATESLKGLYGDGQGGVDADKAAATLQAAGVTTPVTLNLQYSNDHYGPSSGDEYALIKDQLESTGLFTVNLQTTEWVQYSKDRSSDVYPAYQLGWFPDYSDADNYLSPFFIKENFLANHFDDADVQSLIAEQVSTTDADARTALIEEIQDKVAAQLSTLPYLQGSQVAIVGSTVSGAEDTLDASFKFRYAALSKG
>CP028137.1|AZZ51310.1|885657_886737_+|peptide-ABC-transporter-permease
MTTATTAAATAPTRRPRGSGGGLGRYLLVRFLLIIPTVFILVTMVFLLMRSTGDPITAALGGRLTADQLAERVAAAGYDRPLIVQYLEYLGNLLRGDFGTTLSDNRPVTEVLVTYGAATVELAFYALIVAFLVGIPLGMLAAYHRDRTPDAVLRIFAILCYATPVFFAGLLLKLVFSVWLKWFPVAGRATTNTELSLQFLENKTGIYLIDAIQTGDPAAVADVLSHAVLPAIALGLLTAGIFLRLVRTNVIGTLGTDYVDAARSRGVSEFRLVRTHAYRPALIPIITVIGLQIALLLGGAVLTETTFEWKGLGFQLAEYLQARDFVAVQGIVALLAVIVALTNFIVDVIAALIDPRVRY
>CP028137.1|AZZ51311.1|886740_887796_+|peptide-ABC-transporter-permease
MSTTTPARPRRRLVDRLPVVHQLRQSVGLQRGMLVTGLVITGAFLLVAALAPLIAPYGYSQLRTGTESFGAQQPPSAEHLLGTTVGGYDVLSRVIWGAQTAFLVIVVAVVLSIFLGVFLGLVSGYLGGWLDRVLVVICDAIYAFPTLLLAIVMSIVISGGQSNLWSGIFAAAVSITVVYIPQYFRVIRAETVRIKGDAFVESAKVIGASTPRIMFKHVLRNATRTLPLIFTLNSSEAILTLAGLGFLGFGIEPTSAAEWGYDLNKALSDVTSGIWWTSVFPGLAIVLVVLGITLVGESLNDLADPRLRGRRAVAAGSGDVAATSVVPGGALPADGLETPGHDPVAGVEKTR
>CP028137.1|AZZ51312.1|887792_889532_+|glutathione-ABC-transporter-ATP-binding-protein
MSVQRPADSRPADAGSRPIVDIQDLEVAFASDRGAVRAVAGVSLRVERGEVLAIVGESGSGKTVTAKSILGLLPETATASGVILLSKKDGSSSTDVVSVPKGRLRELRGTDVAMVFQEPGTALNPVFTVGWQIAEGLRAHASVSRKDARKRAIDVLRTVGIPEPEKRVDYYPHQFSGGQKQRVVIAMALVLDPGLIVADEPTTALDVTVQAEILDLLRRCRDDFGTSIVLITHNMGVVADLADRVAVMYQGELVEEAPVAELFAAPKAEYTRKLLAAVPHVGQGVARAKERAIERAGAPEAETLVLAEDLRIQYPGRLGRPGFVAVDGVSFRIRAGEVLGLVGESGSGKTTIGRAIAGLTTVTGGSLRVLGKEMRGIRERAFRPVRGDIGFVFQDPASSFNPLLTIAECVAEPLIVHGRARDAGAARKRVDELLEAVQLPRSYGDRYPHELSGGQRQRASLARSLALEPKLLIADEPTSALDVSVQARVLELFAELQREFGFASLFISHDLAVVDLLADRIAVLYRGELVEEGTGEEVLSAPKHPYTQRLLASLPVPDPGEQAERRELLRSIVEAERKA
>CP028137.1|AZZ54159.1|889558_890413_+|oligopeptide-transporter
MVVDDLSVEYPPRGISGRWTALRGVSLRVEPGEVLGILGGSGSGKSTLARVLGGEGLDGPAGAGARTRPVIIGGEATVSGHRLRGMPAREIKRFTFDVAHLAQDAGAVLRPELTVSELIAEPIFLRDRHYDPKSAAVRVATLLDSVHLPLFLLDRFPYELSSGQRQRVAIARALVLGPKVLIADEPTSGIDATVRESIVDLLTDLRRQEGFAAVVVSHDIDVLSRATDRIAVLVEGEVVAYGPLLEVLNDSRHPYVRELGAAFAEFERFDASRAARTAPAEEAG
>CP028137.1|AZZ51313.1|890409_891333_+|hydroxyacid-dehydrogenase
MSAPRVAVLPRPKQIFTDAIEAGGGTVVGVEDAGALLWLSYGRTDELAAVLAEHPAIRWVQLPWAGVDVFAPVLRGTEREGLRWTSAKGAYAEPVAEHALALTLALLRSLPERARADSWGAKRARTLHRARVVVVGAGGIAVELLRLLSVFDAHVTVVRRTAAEVPGADRTVPAEQLPDVVADADVLVLAAAATDGTARLVDAALLRRLPAEAVLVNVARGSLVDTDALVTALAEGRLAGAALDVTDPEPLPDGHPLWSEPRCLITPHSADTPEMTTPLLAERVRANVAAFAAGRELLGVVDPALGY
>CP028137.1|AZZ51314.1|891613_892729_+|SAM-dependent-methyltransferase
MRDDVLDLLRRRPDVEAPDLVAVDASDRLLLDLAAGHSRVAVIGDAFGALTLALAADGVAVSSAQDSIVAERALAANAEAVRAAGIELAPFTIADSIAEAVEGAEIVLLRLPRSLDALAAVAAEVALANPAAQLMAAGRIKHMSLGMNEVLARRYDRIDVSLARQKSRALLASEAKAEQPAAPGAERRRLAEHRLDVVALPGVFAGAKLDLGTRALLAALDPAALPGGVAVDLGCGSGVLAASLALARPDLDVIATDSSRAAVESAGLTAEANGLGDRIRLLRDDNASTLADGSVDVVLCNPPFHSDGAVTDLVARRMIAAAGRILRPGGELWTVFNSHLAHPAELRRSVGPTKIIERSAKFTVARSRREG
>CP028137.1|AZZ51315.1|892855_893683_+|hypothetical-protein
MLEVVLVLALIVAAGAIVLWRRSAAAERRALDSRAEEAARAVALELSVREQEARLRIVGELEQLAVRAASKVVEEAESVRLTIDRDPAAASRSAGRAVSAAEASLAQLRRIATVAAVDPRELPATGGTDALIESARERGLVVQEETFGEPFPLQDGADVAVMRVLEYAFDEALESGGTGTELRITSRWTATGLRVEVDDDRERHAGAESDASAVDADLRALTDRIDSPALSELRERAGLFGGDVVEKRTPGVGRSVTASFPTVRHHNGVHGVDLA
>CP028137.1|AZZ51316.1|893734_894301_-|peptide-deformylase
MAVLPIRIAGDPVLHSPAAPVTEFDDALRTLVADMFETMDTAPGVGLAGPQVGVPLRLFVYDYEADDGTPRRGVAINPELFVTPTPLGEADEDTESEGCLSFPGERFPLRRSERAILRAVDLDGTPFEIEAEGWFARVFQHEFDHLDGVLYTDRLEHEYAKPVAKITRKRGWGVPGVSWTPGVEHLED

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_4

1416401-1416496

Orphan

Consensus_repeat	Method
TGCTGGTCGAGTAGCCGCCTCCGGCGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_4

>merge|CP028137|4|1416401-1416496|CRISPRCasFinder
TGCCGGTCGAGCAGCCACCGACACGGCCACTCCTGCTGTCCCGAAGAGCCACCGAGGCAGCCCGTCGTGCTGGTCGAGCAACTGCCTCCAACGGTG

>CP028137|4|4|1416401-1416496|CRISPRCasFinder
TGCCGGTCGAGCAGCCACCGACACGGCC	ACTCCTGCTGTCCCGAAGAGCCACCGAGGCAGCCCGTCG
TGCTGGTCGAGCAACTGCCTCCAACGGTG

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ54200.1\|1424895_1425924_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
CP028137.1\|AZZ54199.1\|1423936_1424800_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP028137.1\|AZZ51748.1\|1416863_1418165_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367155
CP028137.1\|AZZ51749.1\|1418714_1422047_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236548
CP028137.1\|AZZ51740.1\|1401120_1401861_-\|3-ketoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|187620
CP028137.1\|AZZ51750.1\|1422178_1423864_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270299
CP028137.1\|AZZ51743.1\|1406565_1409958_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350139
CP028137.1\|AZZ51739.1\|1400554_1401013_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP028137.1\|AZZ51746.1\|1415019_1415655_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ51751.1\|1426340_1427360_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380511
CP028137.1\|AZZ51741.1\|1401857_1402814_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|187632
CP028137.1\|AZZ54201.1\|1427356_1428259_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP028137.1\|AZZ54202.1\|1428267_1429149_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP028137.1\|AZZ51744.1\|1410422_1411535_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379501
CP028137.1\|AZZ51752.1\|1429198_1430539_-\|sugar-binding-protein	unknown	unknown	gnl\|CDD\|270452
CP028137.1\|AZZ51753.1\|1430631_1432101_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|350109
CP028137.1\|AZZ51738.1\|1400068_1400479_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223329
CP028137.1\|AZZ51742.1\|1403067_1406442_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350140
CP028137.1\|AZZ51747.1\|1415925_1416285_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ51745.1\|1411752_1414932_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350097

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54200.1\|1424895_1425924_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	1.34859e-118
CP028137.1\|AZZ54199.1\|1423936_1424800_-\|sugar-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.90221e-59
CP028137.1\|AZZ51748.1\|1416863_1418165_+\|hypothetical-protein	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	2.97437e-17
CP028137.1\|AZZ51749.1\|1418714_1422047_-\|hypothetical-protein	gnl\|CDD\|236548	PRK09525, lacZ, beta-galactosidase.	0
CP028137.1\|AZZ51740.1\|1401120_1401861_-\|3-ketoacyl-ACP-reductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.24945e-97
CP028137.1\|AZZ51750.1\|1422178_1423864_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270299	cd13581, PBP2_AlgQ_like_2, Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.	3.74185e-129
CP028137.1\|AZZ51743.1\|1406565_1409958_+\|hypothetical-protein	gnl\|CDD\|350139	cd18818, GH43_GbtXyl43B-like, Glycosyl hydrolase family 43 such as Geobacillus thermoleovorans IT-08 beta-xylosidase/exo-xylanase (GbtXyl43B). This glycosyl hydrolase family 43 (GH43) subgroup includes the characterized enzymes Geobacillus thermoleovorans IT-08 beta-xylosidase (EC 3.2.1.37) / exo-xylanase (GbtXyl43B), and Paenibacillus sp. strain E18 alpha-L-arabinofuranosidase (EC 3.2.1.55) Abf43B. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	2.57032e-132
CP028137.1\|AZZ51739.1\|1400554_1401013_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	5.00201e-27
CP028137.1\|AZZ51751.1\|1426340_1427360_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|380511	cd06288, PBP1_sucrose_transcription_regulator, ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	3.72057e-113
CP028137.1\|AZZ51742.1\|1403067_1406442_+\|hypothetical-protein	gnl\|CDD\|350140	cd18819, GH43_LbAraf43-like, Glycosyl hydrolase family 43 proteins similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities, similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	1.15719e-44
CP028137.1\|AZZ54201.1\|1427356_1428259_-\|sugar-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.59055e-67
CP028137.1\|AZZ54202.1\|1428267_1429149_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	5.14386e-73
CP028137.1\|AZZ51744.1\|1410422_1411535_-\|hypothetical-protein	gnl\|CDD\|379501	pfam14200, RicinB_lectin_2, Ricin-type beta-trefoil lectin domain-like.	6.56851e-28
CP028137.1\|AZZ51752.1\|1429198_1430539_-\|sugar-binding-protein	gnl\|CDD\|270452	cd14749, PBP2_XBP1_like, The periplasmic-binding component of ABC transport systems specific for xylo-oligosaccharides; possesses type 2 periplasmic binding fold. This group represents the periplasmic component of an ABC transport system XBP1 that shows preference for xylo-oligosaccharides in the order of xylotriose > xylobiose > xylotetraose. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.00673e-37
CP028137.1\|AZZ51753.1\|1430631_1432101_-\|glycoside-hydrolase	gnl\|CDD\|350109	cd08995, GH32_EcAec43-like, Glycosyl hydrolase family 32, such as the putative glycoside hydrolase Escherichia coli Aec43 (FosGH2). This glycosyl hydrolase family 32 (GH32) subgroup includes Escherichia coli strain BEN2908 putative glycoside hydrolase Aec43 (FosGH2). GH32 enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). GH32 family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize.	1.28192e-133
CP028137.1\|AZZ51738.1\|1400068_1400479_-\|hypothetical-protein	gnl\|CDD\|223329	COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis].	4.66689e-18
CP028137.1\|AZZ51741.1\|1401857_1402814_-\|oxidoreductase	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.28744e-73
CP028137.1\|AZZ51745.1\|1411752_1414932_+\|hypothetical-protein	gnl\|CDD\|350097	cd08983, GH43_Bt3655-like, Glycosyl hydrolase family 43 protein such as Bacteroides thetaiotaomicron VPI-5482 arabinofuranosidase Bt3655. This glycosyl hydrolase family 43 (GH43)-like family includes the characterized arabinofuranosidases (EC 3.2.1.55): Bacteroides thetaiotaomicron VPI-5482 (Bt3655;BT_3655) and Penicillium chrysogenum 31B Abf43B, as well as Bifidobacterium adolescentis ATCC 15703 beta-xylosidase (EC 3.2.1.37) BAD_1527. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	2.60408e-94

>CP028137.1|AZZ51747.1|1415925_1416285_+|hypothetical-protein
MAAFRPDAVPSTCRSCAAGRSLDALILIELARGVNCDESRLLSALAVRVDHRIGLVQLRSRLRELANRGLVLLEGHRRTMLLRIAQFSITRAGRDSLAAHARALDLLAEEIHVALLTRR
>CP028137.1|AZZ51746.1|1415019_1415655_+|hypothetical-protein
MQNHTSTARSFLLRGTAGLAGGLLLLGVAGTAFADEQQGADDVDVNVQIAPLTGGGALSMTVASDSTALTENGSNSVARQFTGTLPTVTVTDTRDAADIPAGAGWYVLGTASDFVSSTGDTIGAENLGWAPNLIDGGDSGLVAEGDVVDTALDGGPDGVGLVDQELLAITNDSAGVAAEGSWTANAALTLKTPTTVEAGDYSSTLTLSLFE
>CP028137.1|AZZ51745.1|1411752_1414932_+|hypothetical-protein
MSVRYAFRMPTSVRYSRNGYSTCYREQSLATVKPPPPGRHSSVRGRPMVRSRAREDASLMTSRLPRPGRPSAESARGRRRRAGWSTLAIAALLLSGAMTPLGAAGAATTVPEPILRYSFDESGTSSAVGSAIPDGAIVADGASSPHPGTVVGSGARSVAGPSGSASDRALSLPGGASGSTAASLRIAPGLIPAGTVDVTMSAWLLWSGSPECTWPFTLGSGVSAHLLATTQCGASAYGALTNGTEVRASAPAPVPAARWVHMAVVVDGGDSVSTYLDGSLVGRGVTTSTAVAAIGSSTFSGYLGKSFYGADAFWAGALDDVRVWSSALSAEQVQQSAADVHSALATKDAAVSLGGTSAVTADLSLPAGGANGSTLTWSSSAPRTVSSTGAVTRPAAGSSDAVVQLTPTATHGAATVIGSPTTVTVKAFAAGDSAQAELARAVADAVRSDPALQGPVRGSLSLPDSGAELDAVASRAGAADAVIEWSSSVPTVVSAVDEGAEPDVVRKGSVTRGSTDTAVTLTATVRVTGTTPVTVSLPVTVLAASPLDPADLDAYLFVYFTGDSVEGEKLRFATSDGDNALQWKTLNDAQPVLTSTKGTQGLRDPYILRSAEGDRFFLIATDLSVGRSGWGEATSNGSRHLEVWESTDLVNWGEQRHIEVSVPNAGMTWAPEATYDPAIDAYVVYWTSSMYLDDARTRPDGNGPQIVTSITRDFRTFTEPEPWFASADVAGLNKGNGLIDATVLREGDQYYRFTKATQSSGCPSPDIIGQRSSDLRATTASGAWSLIDTCIGRTAGTPEVEGPEIFRANPGDTSGYRYFLWVDNYGGVGYIPLATNSLEGDIQWTYPAAFSLPSSPRHGSVVSITAKERDALAAKWNPALLVTSVKPVAATAPVGATTVALPATVSAGFRDGHSETVGVTWRTADLSGLKKAGDSVQVTGRLQNSSATLAVATITATAPPAAPAIAATATASTRCVQGKVVLSVVATNPNAFPVKMVVTSTSGSKTFAEVAAGKSVTHSFTTRTAALPAGSATATATAFVAGKPAAATATAPYAAASCG
>CP028137.1|AZZ51744.1|1410422_1411535_-|hypothetical-protein
MIFSPYPRWTGSVRRPPARAAEEPERHCMSRTVKSTIKTRLLGTMTAALIASLTTLGVAAPAEAATAPVGVGAAQEIRNQHSSMCLDDFDFVTQPGAEVRQWSCSESSNQRWQIRDLGTGYAEIKNVFSNLCLDDYNFGSTPGAEVRQWTCTGATNQQWQITDVGGGSSQILNRHSNLCLDDRDFAQTDGAAIQQWTCTGSKVQRWSITDPTVQKMTYALVRSANPSADELDAYARITDAMDRAVARYNRLSNIDRFYTVYYVPGVPTADANPNGTIRFGADRGYMQEGTALHELSHTVGVGYDAFVDRCQNNGWTSALPLLRTWDGPTATINCGGGHMWPYGLNYNPEYNELGFERHVKLVQAMLSDGM
>CP028137.1|AZZ51743.1|1406565_1409958_+|hypothetical-protein
MKPTTRWRAALVGALASVVVAAGVALPAVPATAADDLLVRYDFSQLSGTTVPDASGGGRTAILRGSGAQVSGSELVLPGGASGSAAAYLELPRGLIDGRDTLTIQTWLRNDTGAGNYAAVFFGTAESPPSQYWLLNPRDPGGHFKSVITASRNAQAPWTTEAGIPASGPTGPGTDASWGLYTTVLQPGKLTGYYNGRLIAETVTNRSVSDLGTDLVGYIGRSSYADPFYKGRVRDFQIRTSALSAQQVADSYWSGVDAGVRTAALASDAAAIDLGPSRVSSDLALPTTGAQGSSIRWTSSDPARISSTGAVTRPSGSTDAAVTLTATLTLGGASTTRDVPLTVAAQNAQADLDALAESIVLRPTLADGELLPTAPAGATLTWRTTTAGVSIAAGAVRTSGTAAVSATVTGELRSGTATTTKTFSVRVLPAGQARYLLAYERTALGSQEYGGNVAYSMHLGLGTTRTSTEALNDNTGVLFADAQPTGVLDVVQTRTLRDPYVFQLATGGYGVLATRTLTNGDVDPERRGTPLFFTTQDLVSYEPRGFVDLGVTAASEPRAVWDSAAKQYRVTWKDAAGADFSRSFTDLADAGTRGDLRRGAISLPDAAVSTSITGAVPSNLLVVPADTASSLEKRLGRIRNTTVAVDAATVPQGAAVPALGAATLGYSDGSTKKLPVDWSAADLAAVDTTTPGTYQVSGTVRQRDYAAPFLRAEADPDILRWKDRYLFISTDDRGDDQPGMFLRSSPTIDGLRTAADSMVVAQGTAGIAGCYWAPELHDLAGELYIYYSPCIGAIDWQRVTSYVQKLKTGGDPTRLADWETPRPVLKQDGTALQRDAQHPGISLDMTVFQDGGRTYVSWSQRYVTGGVVGDAELWIATIDPANPWRLTSEPRKLVTASYGWETNLTNVAEGATAITHNGKVYLTYSGSGTDRTYAVGLLTAPSGADLTDQTVWAKSDAPLLKSDPAANLWGPGHNSFTVDEDGNEVLVFHARSNGSSNRDTYLRRIHWAADGGPVLDMSAAEEVLTSNRTVRATITVQASAVTVTATATTRCISGRAVVTITTRNAGAGTADVAWVTPWGARSQQIGAQKTGTLAITTRAASLSAGTLEGTATVNGVATPVTATYPAARCS
>CP028137.1|AZZ51742.1|1403067_1406442_+|hypothetical-protein
MSTSPHLKSPDARRPDSRRPDSRRPDPKAMRALVTAAAASVALLASCAVPVTAAAAADAVPSPEQSLLADFTFDAAPSNGAFVDRSTRASVQGAANLVPGNTGQGTAARLSSASWLDLTATDGTALLAGRQNVTISYDSKPDASANTGWAVFAARSATRQEYAQEHYLGVLDRTSGITVERYDNTNGRNTAGNLATTATNAEWKHVDLVVTETTTRLFVDRKPVAVNGSGIPLSRILGSSGGVLQVGKANWGGGEYFSGLIDNLRIYDRALSGTELGAENPAVTSDAGAALAVPATVLGDLPSRVLGKQVTWSATGAGAGRVQSNGAIDTSGLGTGTAAVTLTATVEGSSQTFRWDSRIAAPGGRIATYVKTVTTTAGTKDDPLAYNDDRRADALFAAALPAGGSSWEPLNRSQAILYVANDGDQASKPNAQVGSPSLFRFSNGGLGAVSSQNNATDSVYVWTSPEGSTFSQQRAVRIAPGSVVTDPRIVFDATAQTYKVFWTDLLTGEGRVTVLADLTAATPLGVTSKADTRVLGVQGAGLPSWAAQSQASDLALTTAEFDVFYKNYVDLQNTGVERIDATVAQGAGAGGVAAALPKQATLTYNDGSKKSLDVDWQDDLSGVDTTKPGSYQVSGTVQQDPEEMVSDARADPHVFFNPDDGYYYLTGSHYGQSSLGPIEESSSYRKIGLKRATTLAGLQDAPEQIVIDPDKGTPGKEGQYPNTFYGWGGFIWAQEFHKINGTWWIVAGMNKGYAPVGGFCDNTVLIPYTGTDASIAAGGFFDQTKWGEPVVLDGAAFDVSYFERTEAGKQQGYWIMPSGGQILIGKAVSGPKGTVPLVDGQLTRVYGESQPWEIGKLAPTPSDTIEGRDQGVVEAPFMVQQGDTISITYSGGTVDKYYSLGLLSTTATADLQDPASWKQTAFPVLDTNDTFTGRLGADETSYYTKQQAGTGHNSFAKDESGNLVLAYHARPYQDPHLATDPVNAGGLFDSDRNTWFKGVNVRANGTLDLSLTKNQEVAPGNRTVTATVVVRGTTPTVTATATSRCVAGKAVVTVVTRNAGTAAAVVTWATPWGERTQSIGAQKTASLAITTRAAAITAGTLTGTSVAGGASTPVTAAYPAARCG
>CP028137.1|AZZ51741.1|1401857_1402814_-|oxidoreductase
MSRVVIVSGASSGFGAMTVRELALAGHRVYAGMRAMDGRNAPAAEDARAFAREQGVDLRPVELDVSDQASVDAAVARIAEESERIDVVVHNAGHMVLGPTEAFTVEQLAEVYDVNVLSTQRLNHAVLPILRSQEDGLLVWVGSSSSRGGTPPYLGPYFAAKAAEDALAVGYAVEVARFGIDTVIVVPGSYTTGTNHFAHAGRAARAEIAAAYEDRYPGLMDDVSARLAELAPADADPREIAVEITRVVGLPRGERPFRVVIDPADDGATRVFALGDAVRREFYERIRMQDLLDPADTGADTADDSAAHATTADQGETR
>CP028137.1|AZZ51740.1|1401120_1401861_-|3-ketoacyl-ACP-reductase
MTAQDQPRTVLVTGGSGGIGRAVVERLARDGLSVAVHCSGNRERAEDVAAAARAHGVEAVVVVGDVADEAAMAAAFTEAEGALGGLDVVVNTAGIMILGPVATFDLADLDRMHRTNIRGPFVIAQLAATRLRPGGALINFSTSVTRTSFPTYGPYVASKAAVEALTLVLARELRGKDITVNAVAPGPTATPLFLDGKSEEEVARLAGAVPLERLGQPEDVAETVAFLAGPGRWINGQVLFVNGGLA
>CP028137.1|AZZ51739.1|1400554_1401013_+|transcriptional-regulator
MDDTEPAAPTAAPTVTELLQVDAPHRELLDELLDKWSLQVLDQLCERPLRFNELRRAVPAVGQKSLTATLRRLERNGMITRVVLESRPIAVEYRISPIGDTLNELVDALLRWTDRQLPAVQAARARYDGAEPAARGGAVDLDTRSAGATRSA
>CP028137.1|AZZ51738.1|1400068_1400479_-|hypothetical-protein
MTVSTSSPEGMLQPVNYDHVAVATGSRHVHVAGQIARDGAGNRLAPDDLAGQVAQVLRNTARGLAGAGASFDDVVRLRFFLTRSTPEMFAEWVAGIEQVREELGLPDPLPPLSAIGVDFLFEPDVLVELEAYAVLD
>CP028137.1|AZZ51748.1|1416863_1418165_+|hypothetical-protein
MSEDENAATLAEVRDCFTDAATAERAASPTRLRAAERIHRGYRVALTVPESFARGATRSETRDLVERSIRAELAVTIGVSEREVSRRLETAQMLMEHLPLTRALLRDGRILWEVGEAVCRTASSLPEASRSALDERAAVAALTMTTTQLRRALSRWREELHEQPLAERHARAKEDRAVWVTPDIDGMATLCVHAPAPAVTGAYDRLRRIARTLRDDGDPRTLQQLSADAAVDLLCDGDIAGTTPNAEHRPDPTFVPGIRAEVRLTLAASTAVGLDDAPADLDGYGPVPAEIARELIRTAPSFTRVLTDPETGAVVSVGRTHRVPPPQMRLHLQLRDQTCRFAGCTRPAATSEADHTLEWRNGGETSLENLVSLCTSHHHIRHGDQWTYVTSDDGMIVWTSPTGRRISNRPPALPGRPPDPPPKPRFEDVPAPF
>CP028137.1|AZZ51749.1|1418714_1422047_-|hypothetical-protein
MTLAQEWNDPDVFEWGTEPAHAVLTPFATLDAALEGDRASTPLAHSLDGDWRFHWAPNPAGRLDGFAAEDWDDSAWPTVPVPASWQLHGYDFPIGTNLVLPWTGANGRHEQPDPRGDYPNAPTLYNPVGQYRTAFELPDGWEQRRTFLQFDGVESACSVWLNGHRLGYREDSYTTGEFEVTEHVRAGSNVLAVEVHRWCTGSYLENQDNVRLSGIFRSVRLLSRAAAMIRDVTVRTPLDDTFTAGSVEVSVAIDAHAGASAAGLELRTRLFDGTAPGAAEVGGQSRTVALDADGRAASQASIPVSSPRLWSAETPELSTLLVELSDATGAVLERVAVRVGFRRVEIVDGVLLVNGRAVSLRGVNRHEWSPRTGRTLSRDDMIADIRLMKQSNITAVRTSHYPNDPRWYDLADEYGLYLVDEANNETHINRIDDDGAPFLPGDRPELRAPLLQRMRSMVEHDKNHPSVIAWSIGNESGVGANLQAMYEWAKEHDPTRPVSYQDPVGSGTWVVPAGLSDFDGDFYPPVAQFAERSRRDPRPYLLVEYAFSQGNTSGYLEEYWAAAREDPRAMPGGFLWDWADKGLYWPRPDRPEEEFLAYGGDWGDEPNQESAHMSGLVLADRTPTPKLAEAALAYQPVSVTAVDLRAGELLVANEHLFTGLDGYVVHWTVSADGEPVQQGSLPGAEWAIGPQEEGRVTLPYLLPEPAAQDAARECRLDVQLALAAPTAWAEAGHVIARAQFELPVDASAARRRASRDLPPVTATEEGTAIVVRGPAFSATVDRSTGRLTSLRYGGRERLAAPLLPNFWRTPNDPELSIPDIRLERPEPSLPWRGVGEEWAIDRVDVEETPGAVRITVDGSVTTAVPFRPSGRVTTSPQSIVYTIHGTGQVDVLSTFSPVEGTPNPQVVGTTFGLAPELSTLHWYGRGPHESSADRRASAFFGRWSGAVDDQPTRYSRPQDSANKADTRWAALVDGSGAGVLVLAGDGTSGGSASGGSASGGSASGGSTSAGSMFFNAQPNSPDELADRRHWHEVPSSTRTVVRVDAAQEGLQGGNWDVQTRPEKYSNTPEKGPYRQHFRLLPLRSGEDPASVAAAAVPTESPVSQPRRVPA
>CP028137.1|AZZ51750.1|1422178_1423864_-|ABC-transporter-substrate-binding-protein
MEGNTLFSRTQHGRVAARRKHLLLGAVLTTAIIGLTGCTGESPEADRKVIRIFGEQGAQIDLNTNSFTKVLEDEFDVDIQFETTSYGASEAAEARQISLAGGDLPEAYMLVPWASQFSRAELQRYGDQGLLVQLNDLIDENGPNIKAALDAEPGFKELTETPDGKIWGLPQWNDCYHCSYPYKFWINTDWLDTLGLAAPTTPDEFFAVMQAFKTQDPNGNGQADEIPLTGSTQQSLVPYIMNAFIYNAFNTGSGANGQPVSLGLDGDTVQLQTMQDGWRDGLKFLRKLWDAGLIDPATFSQGGDQMTATGNAAQGVLIGGFTAIHPGFAVTIGQEDGRDTQYDLLPPLTGPGGQNATFLLPSVPGATFVVTKAADEVEQKVIVEMMDYLFSPEGHVRGEFGEEGIGWRAPEEGEIALDQSLEPSLVDTKMDESNEADYNGNWGPMAQVFDTAEFRASQVQPLDIYTEAGFERRLFEATDQYAGKESDAMFPYWNIWVPSEDASELSTLTANVESSVATATAEFVTGVRDPESDADWQSYLDALTSLGADRYAEIWQSAYDQ
>CP028137.1|AZZ54199.1|1423936_1424800_-|sugar-ABC-transporter-permease
MVDRVFMIAVYVLLTTFLLAVLLPLLYILASSFSSPLAVSSGRVSFWPIDFTLEGYERALGDSTIVTGFANSLFYTAAGTFVSLALTVAIAYPLSRKDFWGRGGITLGVIFTMLFAGGIIPTYLVVQQLGLLDTRWALILPQAVGVWQVIIAVVFFRSSIPDELYEAAQLDGASDLRFLWTIVLPLSKPLLAVIALMYAIYQWNSYFDALLYLRDPSLYPLQLVLRNVLILNQATPGMDAAAQIERQQLADLLKYSLIVISTVPVMILYPFVARYFNKGIMLGAVKG
>CP028137.1|AZZ54200.1|1424895_1425924_-|sugar-ABC-transporter-permease
MPLTGAPGTTVPGSTVPGAPGPEAPVPGGPASIRGRSNARGFRAARRSFRRHWQLYLLILPPLLYFIVFKYVPMSNAIIAFKDYNVIDGVWGSPWVGFKHFERFFSNPIFWTLLKNTFLLSAYVVLAGFPFPILLALALNEVRLRFFQRTVQMVTYAPYFISTVVVISMTILFLSPKLGPVSDVTSFFGLGAIDFLGDPDFFRHIYVFSDVWQTTGYSAVLYLAALSSIDTSLYEAARMDGASRLQKIWHVDIPGIMPTAITILILGVGNVMAIGFEKAFLLQNSLNLSQSEIIPTYVYKVGLLNADFSQAAAIGLFNGMINLVLLLGVNSLAKRITGQGLW
>CP028137.1|AZZ51751.1|1426340_1427360_-|LacI-family-transcriptional-regulator
MSTTDHGRNGPVVTMRDVAKAAGVSVATVSHVINDKPGARIGEGARLRVQEAVAALGYRPNALAKTLRHGSSRFIGLVADAIATTPFAGQIIHGAQDEAWKHGYVLLIANTEGDRAAEDEAIAMMLEHQVHGILYSTWVHREIVVPEMLQQAGTVLVNCFAPGSGLPAVVPDEEQGGRTAAEELLAAGHRRIAFLNTTTDSPARNGRLAGYRAALAAAGISFDVELVVDTSPEQEGGYLATERVLASRATAVFCHNDRVAMGLYDGLRERGLRIPEDVAVIGFDNQDVIAAHLRPPLSTVALPHYELGAAGVRALLGTERGAADRPQLIPCPPVRRRSI
>CP028137.1|AZZ54201.1|1427356_1428259_-|sugar-ABC-transporter-permease
MLTRPAATPSASAPGPRPRRPRRSPRLRVQRTLLTVTIVAIVLVQVYPLAWLFLTSFRTAADFAGGDPFALPAAVTLENYSRAFATGNLGLNIVNSLIVTLGASAVIVVAGMMAAFALQVLGFRFSRLVRSLFLLGIIVPVQIALVPLFIDYSQVGLLDTHLSMIIPLAAFALPMAVYLFSSFYEYIPAEMYEAASLDGAGPYRIFLRITSPLSVNTIITVVLVNSIFIWNDFIFANTFVLSDGLKTIPLGLQNYIGAMGNTDWTATFAAVCVTVTPLLLVFLVLNKAMIQGLESGATKG
>CP028137.1|AZZ54202.1|1428267_1429149_-|sugar-ABC-transporter-permease
MLPRRSRLSVLVFLLPPLVVYGLAVLLPIVQSLVLSFFRWDGITDMAFVGLDNYIKMLTRDDVFWTSFGNALGYLAICLVLQLGGALIVASLLTALPRFRELVKTLYLLPAVISTVAIAILFQRIYSLEPLGLVNQALSWIGLDGLQTAWLSNVSTVLAAVSIPEGWRFTGLYMLIIYAALLAVPRELEEAARLDGATWWQLFRRVRFPYIRPVWITTTIMATTFALRGFDIPYLLTNGGPGQSSELLTTYMYKTAFVHTDYGYASAISVFIVIECLIAVGVILLLLRRRDDS
>CP028137.1|AZZ51752.1|1429198_1430539_-|sugar-binding-protein
MPAITRRGSFLAAASTALVLLLSGCAGGSAGVAPTDVHPEGEIVPRPISWLLSRPADGGVITAMQQIADEYAADHPGFELDLITTPDRPSYVQKYETLAAANKLPELFDTDATPFAQKLASQGRMMDVDALLEDLGLADDYRTAALDYQRFDDGSLHMVPFEFQLEFFWYNSALLEKAGVPVPATLDDFPAMCEALRAQGVTPIALDGQDQWPLERYMAYYPFRTAGPQYVQDLKSGKASFSDAPGRAAAEWLSSLGEAGCFQEGFSSTGYADAQALFTSGKAAVYNIGTWELGNLATESLDPAVRDSVDYFTLPSVEGAVTADDEYVTPSGIGMAVNARTYDPLVRDFLAFALKRYPEVYAATGALSPTTTATTAVPGDATPLYSRAVEQADSVGSAIAMPWDTQLDPATNTRLQQELTLLVQGDTTPDQFVETMDAALAENSDD
>CP028137.1|AZZ51753.1|1430631_1432101_-|glycoside-hydrolase
MSQRGFFRPENAWVGDLIPWQADGEFHLFHLHETRATPKEGMPWRRVITRNLIDFEDAGVALASGGPLADDFNVYTGSVVQDSDGVHHVFYTGQNPERRGTDGLPLQLVLHATSRDGMRSWQRRPADTFGATPGYETADWRDPFVLRDEEAGVWRMLITARHADGPSRRRGVIAQCTSTDLVTWDAAEPFWDPRRYLAHECPEVFQWGGWWYLVWSEFSDSFTTRYRMSRDLHGPWLVPEHDTVDGRAFYAAKSAERDGRRFFFGWIASREGSSDDGAWQWAGTLSVLEAEQRGDGTLAFHLTEELRESFEEPRPLAPEGSVLDAPDGYAQLLSGEEAPSAFRLVATLDIGAGMTECGVLLRASADGDESYVLRLEPRRHRLVLDRWPRRATGTEQWQISGDVPFAVELERPVRLEPGRHELEVVVDGDLCIATVDDAVVLSTRLYDRPAGDVGVFVGEGRIDVLGFALAARRRSSGTDRTRRLVSAGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_5

1416638-1416735

Orphan

Consensus_repeat	Method
TGCTGGTCGAGTAGCCGCCTCCGGCGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_5

>merge|CP028137|5|1416638-1416735|CRISPRCasFinder
TGCTGGTCGAGTAGCCGCCTCCGGCGGCCCCTGCATGCTCGTCGAGTAGCCGCGTCCGGCAGCCCTTGCATGCTGGTCGAGTAGCCGCCTCCGGCGGC

>CP028137|5|5|1416638-1416735|CRISPRCasFinder
TGCTGGTCGAGTAGCCGCCTCCGGCGGC	CCCTGCATGCTCGTCGAGTAGCCGCGTCCGGCAGCCCTTGCA
TGCTGGTCGAGTAGCCGCCTCCGGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ54200.1\|1424895_1425924_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
CP028137.1\|AZZ54199.1\|1423936_1424800_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP028137.1\|AZZ51748.1\|1416863_1418165_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367155
CP028137.1\|AZZ51749.1\|1418714_1422047_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236548
CP028137.1\|AZZ51740.1\|1401120_1401861_-\|3-ketoacyl-ACP-reductase	unknown	unknown	gnl\|CDD\|187620
CP028137.1\|AZZ51750.1\|1422178_1423864_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270299
CP028137.1\|AZZ51743.1\|1406565_1409958_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350139
CP028137.1\|AZZ51739.1\|1400554_1401013_+\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
CP028137.1\|AZZ51746.1\|1415019_1415655_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ51751.1\|1426340_1427360_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380511
CP028137.1\|AZZ51741.1\|1401857_1402814_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|187632
CP028137.1\|AZZ54201.1\|1427356_1428259_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP028137.1\|AZZ54202.1\|1428267_1429149_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP028137.1\|AZZ51744.1\|1410422_1411535_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379501
CP028137.1\|AZZ51752.1\|1429198_1430539_-\|sugar-binding-protein	unknown	unknown	gnl\|CDD\|270452
CP028137.1\|AZZ51753.1\|1430631_1432101_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|350109
CP028137.1\|AZZ51738.1\|1400068_1400479_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223329
CP028137.1\|AZZ51742.1\|1403067_1406442_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350140
CP028137.1\|AZZ51747.1\|1415925_1416285_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ51745.1\|1411752_1414932_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350097

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54200.1\|1424895_1425924_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	1.34859e-118
CP028137.1\|AZZ54199.1\|1423936_1424800_-\|sugar-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.90221e-59
CP028137.1\|AZZ51748.1\|1416863_1418165_+\|hypothetical-protein	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	2.97437e-17
CP028137.1\|AZZ51749.1\|1418714_1422047_-\|hypothetical-protein	gnl\|CDD\|236548	PRK09525, lacZ, beta-galactosidase.	0
CP028137.1\|AZZ51740.1\|1401120_1401861_-\|3-ketoacyl-ACP-reductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	5.24945e-97
CP028137.1\|AZZ51750.1\|1422178_1423864_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270299	cd13581, PBP2_AlgQ_like_2, Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.	3.74185e-129
CP028137.1\|AZZ51743.1\|1406565_1409958_+\|hypothetical-protein	gnl\|CDD\|350139	cd18818, GH43_GbtXyl43B-like, Glycosyl hydrolase family 43 such as Geobacillus thermoleovorans IT-08 beta-xylosidase/exo-xylanase (GbtXyl43B). This glycosyl hydrolase family 43 (GH43) subgroup includes the characterized enzymes Geobacillus thermoleovorans IT-08 beta-xylosidase (EC 3.2.1.37) / exo-xylanase (GbtXyl43B), and Paenibacillus sp. strain E18 alpha-L-arabinofuranosidase (EC 3.2.1.55) Abf43B. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	2.57032e-132
CP028137.1\|AZZ51739.1\|1400554_1401013_+\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	5.00201e-27
CP028137.1\|AZZ51751.1\|1426340_1427360_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|380511	cd06288, PBP1_sucrose_transcription_regulator, ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors. This group includes the ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	3.72057e-113
CP028137.1\|AZZ51742.1\|1403067_1406442_+\|hypothetical-protein	gnl\|CDD\|350140	cd18819, GH43_LbAraf43-like, Glycosyl hydrolase family 43 proteins similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities, similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	1.15719e-44
CP028137.1\|AZZ54201.1\|1427356_1428259_-\|sugar-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.59055e-67
CP028137.1\|AZZ54202.1\|1428267_1429149_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	5.14386e-73
CP028137.1\|AZZ51744.1\|1410422_1411535_-\|hypothetical-protein	gnl\|CDD\|379501	pfam14200, RicinB_lectin_2, Ricin-type beta-trefoil lectin domain-like.	6.56851e-28
CP028137.1\|AZZ51752.1\|1429198_1430539_-\|sugar-binding-protein	gnl\|CDD\|270452	cd14749, PBP2_XBP1_like, The periplasmic-binding component of ABC transport systems specific for xylo-oligosaccharides; possesses type 2 periplasmic binding fold. This group represents the periplasmic component of an ABC transport system XBP1 that shows preference for xylo-oligosaccharides in the order of xylotriose > xylobiose > xylotetraose. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.00673e-37
CP028137.1\|AZZ51753.1\|1430631_1432101_-\|glycoside-hydrolase	gnl\|CDD\|350109	cd08995, GH32_EcAec43-like, Glycosyl hydrolase family 32, such as the putative glycoside hydrolase Escherichia coli Aec43 (FosGH2). This glycosyl hydrolase family 32 (GH32) subgroup includes Escherichia coli strain BEN2908 putative glycoside hydrolase Aec43 (FosGH2). GH32 enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). GH32 family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize.	1.28192e-133
CP028137.1\|AZZ51738.1\|1400068_1400479_-\|hypothetical-protein	gnl\|CDD\|223329	COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis].	4.66689e-18
CP028137.1\|AZZ51741.1\|1401857_1402814_-\|oxidoreductase	gnl\|CDD\|187632	cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. 17beta-hydroxysteroid dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.28744e-73
CP028137.1\|AZZ51745.1\|1411752_1414932_+\|hypothetical-protein	gnl\|CDD\|350097	cd08983, GH43_Bt3655-like, Glycosyl hydrolase family 43 protein such as Bacteroides thetaiotaomicron VPI-5482 arabinofuranosidase Bt3655. This glycosyl hydrolase family 43 (GH43)-like family includes the characterized arabinofuranosidases (EC 3.2.1.55): Bacteroides thetaiotaomicron VPI-5482 (Bt3655;BT_3655) and Penicillium chrysogenum 31B Abf43B, as well as Bifidobacterium adolescentis ATCC 15703 beta-xylosidase (EC 3.2.1.37) BAD_1527. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	2.60408e-94

>CP028137.1|AZZ51747.1|1415925_1416285_+|hypothetical-protein
MAAFRPDAVPSTCRSCAAGRSLDALILIELARGVNCDESRLLSALAVRVDHRIGLVQLRSRLRELANRGLVLLEGHRRTMLLRIAQFSITRAGRDSLAAHARALDLLAEEIHVALLTRR
>CP028137.1|AZZ51746.1|1415019_1415655_+|hypothetical-protein
MQNHTSTARSFLLRGTAGLAGGLLLLGVAGTAFADEQQGADDVDVNVQIAPLTGGGALSMTVASDSTALTENGSNSVARQFTGTLPTVTVTDTRDAADIPAGAGWYVLGTASDFVSSTGDTIGAENLGWAPNLIDGGDSGLVAEGDVVDTALDGGPDGVGLVDQELLAITNDSAGVAAEGSWTANAALTLKTPTTVEAGDYSSTLTLSLFE
>CP028137.1|AZZ51745.1|1411752_1414932_+|hypothetical-protein
MSVRYAFRMPTSVRYSRNGYSTCYREQSLATVKPPPPGRHSSVRGRPMVRSRAREDASLMTSRLPRPGRPSAESARGRRRRAGWSTLAIAALLLSGAMTPLGAAGAATTVPEPILRYSFDESGTSSAVGSAIPDGAIVADGASSPHPGTVVGSGARSVAGPSGSASDRALSLPGGASGSTAASLRIAPGLIPAGTVDVTMSAWLLWSGSPECTWPFTLGSGVSAHLLATTQCGASAYGALTNGTEVRASAPAPVPAARWVHMAVVVDGGDSVSTYLDGSLVGRGVTTSTAVAAIGSSTFSGYLGKSFYGADAFWAGALDDVRVWSSALSAEQVQQSAADVHSALATKDAAVSLGGTSAVTADLSLPAGGANGSTLTWSSSAPRTVSSTGAVTRPAAGSSDAVVQLTPTATHGAATVIGSPTTVTVKAFAAGDSAQAELARAVADAVRSDPALQGPVRGSLSLPDSGAELDAVASRAGAADAVIEWSSSVPTVVSAVDEGAEPDVVRKGSVTRGSTDTAVTLTATVRVTGTTPVTVSLPVTVLAASPLDPADLDAYLFVYFTGDSVEGEKLRFATSDGDNALQWKTLNDAQPVLTSTKGTQGLRDPYILRSAEGDRFFLIATDLSVGRSGWGEATSNGSRHLEVWESTDLVNWGEQRHIEVSVPNAGMTWAPEATYDPAIDAYVVYWTSSMYLDDARTRPDGNGPQIVTSITRDFRTFTEPEPWFASADVAGLNKGNGLIDATVLREGDQYYRFTKATQSSGCPSPDIIGQRSSDLRATTASGAWSLIDTCIGRTAGTPEVEGPEIFRANPGDTSGYRYFLWVDNYGGVGYIPLATNSLEGDIQWTYPAAFSLPSSPRHGSVVSITAKERDALAAKWNPALLVTSVKPVAATAPVGATTVALPATVSAGFRDGHSETVGVTWRTADLSGLKKAGDSVQVTGRLQNSSATLAVATITATAPPAAPAIAATATASTRCVQGKVVLSVVATNPNAFPVKMVVTSTSGSKTFAEVAAGKSVTHSFTTRTAALPAGSATATATAFVAGKPAAATATAPYAAASCG
>CP028137.1|AZZ51744.1|1410422_1411535_-|hypothetical-protein
MIFSPYPRWTGSVRRPPARAAEEPERHCMSRTVKSTIKTRLLGTMTAALIASLTTLGVAAPAEAATAPVGVGAAQEIRNQHSSMCLDDFDFVTQPGAEVRQWSCSESSNQRWQIRDLGTGYAEIKNVFSNLCLDDYNFGSTPGAEVRQWTCTGATNQQWQITDVGGGSSQILNRHSNLCLDDRDFAQTDGAAIQQWTCTGSKVQRWSITDPTVQKMTYALVRSANPSADELDAYARITDAMDRAVARYNRLSNIDRFYTVYYVPGVPTADANPNGTIRFGADRGYMQEGTALHELSHTVGVGYDAFVDRCQNNGWTSALPLLRTWDGPTATINCGGGHMWPYGLNYNPEYNELGFERHVKLVQAMLSDGM
>CP028137.1|AZZ51743.1|1406565_1409958_+|hypothetical-protein
MKPTTRWRAALVGALASVVVAAGVALPAVPATAADDLLVRYDFSQLSGTTVPDASGGGRTAILRGSGAQVSGSELVLPGGASGSAAAYLELPRGLIDGRDTLTIQTWLRNDTGAGNYAAVFFGTAESPPSQYWLLNPRDPGGHFKSVITASRNAQAPWTTEAGIPASGPTGPGTDASWGLYTTVLQPGKLTGYYNGRLIAETVTNRSVSDLGTDLVGYIGRSSYADPFYKGRVRDFQIRTSALSAQQVADSYWSGVDAGVRTAALASDAAAIDLGPSRVSSDLALPTTGAQGSSIRWTSSDPARISSTGAVTRPSGSTDAAVTLTATLTLGGASTTRDVPLTVAAQNAQADLDALAESIVLRPTLADGELLPTAPAGATLTWRTTTAGVSIAAGAVRTSGTAAVSATVTGELRSGTATTTKTFSVRVLPAGQARYLLAYERTALGSQEYGGNVAYSMHLGLGTTRTSTEALNDNTGVLFADAQPTGVLDVVQTRTLRDPYVFQLATGGYGVLATRTLTNGDVDPERRGTPLFFTTQDLVSYEPRGFVDLGVTAASEPRAVWDSAAKQYRVTWKDAAGADFSRSFTDLADAGTRGDLRRGAISLPDAAVSTSITGAVPSNLLVVPADTASSLEKRLGRIRNTTVAVDAATVPQGAAVPALGAATLGYSDGSTKKLPVDWSAADLAAVDTTTPGTYQVSGTVRQRDYAAPFLRAEADPDILRWKDRYLFISTDDRGDDQPGMFLRSSPTIDGLRTAADSMVVAQGTAGIAGCYWAPELHDLAGELYIYYSPCIGAIDWQRVTSYVQKLKTGGDPTRLADWETPRPVLKQDGTALQRDAQHPGISLDMTVFQDGGRTYVSWSQRYVTGGVVGDAELWIATIDPANPWRLTSEPRKLVTASYGWETNLTNVAEGATAITHNGKVYLTYSGSGTDRTYAVGLLTAPSGADLTDQTVWAKSDAPLLKSDPAANLWGPGHNSFTVDEDGNEVLVFHARSNGSSNRDTYLRRIHWAADGGPVLDMSAAEEVLTSNRTVRATITVQASAVTVTATATTRCISGRAVVTITTRNAGAGTADVAWVTPWGARSQQIGAQKTGTLAITTRAASLSAGTLEGTATVNGVATPVTATYPAARCS
>CP028137.1|AZZ51742.1|1403067_1406442_+|hypothetical-protein
MSTSPHLKSPDARRPDSRRPDSRRPDPKAMRALVTAAAASVALLASCAVPVTAAAAADAVPSPEQSLLADFTFDAAPSNGAFVDRSTRASVQGAANLVPGNTGQGTAARLSSASWLDLTATDGTALLAGRQNVTISYDSKPDASANTGWAVFAARSATRQEYAQEHYLGVLDRTSGITVERYDNTNGRNTAGNLATTATNAEWKHVDLVVTETTTRLFVDRKPVAVNGSGIPLSRILGSSGGVLQVGKANWGGGEYFSGLIDNLRIYDRALSGTELGAENPAVTSDAGAALAVPATVLGDLPSRVLGKQVTWSATGAGAGRVQSNGAIDTSGLGTGTAAVTLTATVEGSSQTFRWDSRIAAPGGRIATYVKTVTTTAGTKDDPLAYNDDRRADALFAAALPAGGSSWEPLNRSQAILYVANDGDQASKPNAQVGSPSLFRFSNGGLGAVSSQNNATDSVYVWTSPEGSTFSQQRAVRIAPGSVVTDPRIVFDATAQTYKVFWTDLLTGEGRVTVLADLTAATPLGVTSKADTRVLGVQGAGLPSWAAQSQASDLALTTAEFDVFYKNYVDLQNTGVERIDATVAQGAGAGGVAAALPKQATLTYNDGSKKSLDVDWQDDLSGVDTTKPGSYQVSGTVQQDPEEMVSDARADPHVFFNPDDGYYYLTGSHYGQSSLGPIEESSSYRKIGLKRATTLAGLQDAPEQIVIDPDKGTPGKEGQYPNTFYGWGGFIWAQEFHKINGTWWIVAGMNKGYAPVGGFCDNTVLIPYTGTDASIAAGGFFDQTKWGEPVVLDGAAFDVSYFERTEAGKQQGYWIMPSGGQILIGKAVSGPKGTVPLVDGQLTRVYGESQPWEIGKLAPTPSDTIEGRDQGVVEAPFMVQQGDTISITYSGGTVDKYYSLGLLSTTATADLQDPASWKQTAFPVLDTNDTFTGRLGADETSYYTKQQAGTGHNSFAKDESGNLVLAYHARPYQDPHLATDPVNAGGLFDSDRNTWFKGVNVRANGTLDLSLTKNQEVAPGNRTVTATVVVRGTTPTVTATATSRCVAGKAVVTVVTRNAGTAAAVVTWATPWGERTQSIGAQKTASLAITTRAAAITAGTLTGTSVAGGASTPVTAAYPAARCG
>CP028137.1|AZZ51741.1|1401857_1402814_-|oxidoreductase
MSRVVIVSGASSGFGAMTVRELALAGHRVYAGMRAMDGRNAPAAEDARAFAREQGVDLRPVELDVSDQASVDAAVARIAEESERIDVVVHNAGHMVLGPTEAFTVEQLAEVYDVNVLSTQRLNHAVLPILRSQEDGLLVWVGSSSSRGGTPPYLGPYFAAKAAEDALAVGYAVEVARFGIDTVIVVPGSYTTGTNHFAHAGRAARAEIAAAYEDRYPGLMDDVSARLAELAPADADPREIAVEITRVVGLPRGERPFRVVIDPADDGATRVFALGDAVRREFYERIRMQDLLDPADTGADTADDSAAHATTADQGETR
>CP028137.1|AZZ51740.1|1401120_1401861_-|3-ketoacyl-ACP-reductase
MTAQDQPRTVLVTGGSGGIGRAVVERLARDGLSVAVHCSGNRERAEDVAAAARAHGVEAVVVVGDVADEAAMAAAFTEAEGALGGLDVVVNTAGIMILGPVATFDLADLDRMHRTNIRGPFVIAQLAATRLRPGGALINFSTSVTRTSFPTYGPYVASKAAVEALTLVLARELRGKDITVNAVAPGPTATPLFLDGKSEEEVARLAGAVPLERLGQPEDVAETVAFLAGPGRWINGQVLFVNGGLA
>CP028137.1|AZZ51739.1|1400554_1401013_+|transcriptional-regulator
MDDTEPAAPTAAPTVTELLQVDAPHRELLDELLDKWSLQVLDQLCERPLRFNELRRAVPAVGQKSLTATLRRLERNGMITRVVLESRPIAVEYRISPIGDTLNELVDALLRWTDRQLPAVQAARARYDGAEPAARGGAVDLDTRSAGATRSA
>CP028137.1|AZZ51738.1|1400068_1400479_-|hypothetical-protein
MTVSTSSPEGMLQPVNYDHVAVATGSRHVHVAGQIARDGAGNRLAPDDLAGQVAQVLRNTARGLAGAGASFDDVVRLRFFLTRSTPEMFAEWVAGIEQVREELGLPDPLPPLSAIGVDFLFEPDVLVELEAYAVLD
>CP028137.1|AZZ51748.1|1416863_1418165_+|hypothetical-protein
MSEDENAATLAEVRDCFTDAATAERAASPTRLRAAERIHRGYRVALTVPESFARGATRSETRDLVERSIRAELAVTIGVSEREVSRRLETAQMLMEHLPLTRALLRDGRILWEVGEAVCRTASSLPEASRSALDERAAVAALTMTTTQLRRALSRWREELHEQPLAERHARAKEDRAVWVTPDIDGMATLCVHAPAPAVTGAYDRLRRIARTLRDDGDPRTLQQLSADAAVDLLCDGDIAGTTPNAEHRPDPTFVPGIRAEVRLTLAASTAVGLDDAPADLDGYGPVPAEIARELIRTAPSFTRVLTDPETGAVVSVGRTHRVPPPQMRLHLQLRDQTCRFAGCTRPAATSEADHTLEWRNGGETSLENLVSLCTSHHHIRHGDQWTYVTSDDGMIVWTSPTGRRISNRPPALPGRPPDPPPKPRFEDVPAPF
>CP028137.1|AZZ51749.1|1418714_1422047_-|hypothetical-protein
MTLAQEWNDPDVFEWGTEPAHAVLTPFATLDAALEGDRASTPLAHSLDGDWRFHWAPNPAGRLDGFAAEDWDDSAWPTVPVPASWQLHGYDFPIGTNLVLPWTGANGRHEQPDPRGDYPNAPTLYNPVGQYRTAFELPDGWEQRRTFLQFDGVESACSVWLNGHRLGYREDSYTTGEFEVTEHVRAGSNVLAVEVHRWCTGSYLENQDNVRLSGIFRSVRLLSRAAAMIRDVTVRTPLDDTFTAGSVEVSVAIDAHAGASAAGLELRTRLFDGTAPGAAEVGGQSRTVALDADGRAASQASIPVSSPRLWSAETPELSTLLVELSDATGAVLERVAVRVGFRRVEIVDGVLLVNGRAVSLRGVNRHEWSPRTGRTLSRDDMIADIRLMKQSNITAVRTSHYPNDPRWYDLADEYGLYLVDEANNETHINRIDDDGAPFLPGDRPELRAPLLQRMRSMVEHDKNHPSVIAWSIGNESGVGANLQAMYEWAKEHDPTRPVSYQDPVGSGTWVVPAGLSDFDGDFYPPVAQFAERSRRDPRPYLLVEYAFSQGNTSGYLEEYWAAAREDPRAMPGGFLWDWADKGLYWPRPDRPEEEFLAYGGDWGDEPNQESAHMSGLVLADRTPTPKLAEAALAYQPVSVTAVDLRAGELLVANEHLFTGLDGYVVHWTVSADGEPVQQGSLPGAEWAIGPQEEGRVTLPYLLPEPAAQDAARECRLDVQLALAAPTAWAEAGHVIARAQFELPVDASAARRRASRDLPPVTATEEGTAIVVRGPAFSATVDRSTGRLTSLRYGGRERLAAPLLPNFWRTPNDPELSIPDIRLERPEPSLPWRGVGEEWAIDRVDVEETPGAVRITVDGSVTTAVPFRPSGRVTTSPQSIVYTIHGTGQVDVLSTFSPVEGTPNPQVVGTTFGLAPELSTLHWYGRGPHESSADRRASAFFGRWSGAVDDQPTRYSRPQDSANKADTRWAALVDGSGAGVLVLAGDGTSGGSASGGSASGGSASGGSTSAGSMFFNAQPNSPDELADRRHWHEVPSSTRTVVRVDAAQEGLQGGNWDVQTRPEKYSNTPEKGPYRQHFRLLPLRSGEDPASVAAAAVPTESPVSQPRRVPA
>CP028137.1|AZZ51750.1|1422178_1423864_-|ABC-transporter-substrate-binding-protein
MEGNTLFSRTQHGRVAARRKHLLLGAVLTTAIIGLTGCTGESPEADRKVIRIFGEQGAQIDLNTNSFTKVLEDEFDVDIQFETTSYGASEAAEARQISLAGGDLPEAYMLVPWASQFSRAELQRYGDQGLLVQLNDLIDENGPNIKAALDAEPGFKELTETPDGKIWGLPQWNDCYHCSYPYKFWINTDWLDTLGLAAPTTPDEFFAVMQAFKTQDPNGNGQADEIPLTGSTQQSLVPYIMNAFIYNAFNTGSGANGQPVSLGLDGDTVQLQTMQDGWRDGLKFLRKLWDAGLIDPATFSQGGDQMTATGNAAQGVLIGGFTAIHPGFAVTIGQEDGRDTQYDLLPPLTGPGGQNATFLLPSVPGATFVVTKAADEVEQKVIVEMMDYLFSPEGHVRGEFGEEGIGWRAPEEGEIALDQSLEPSLVDTKMDESNEADYNGNWGPMAQVFDTAEFRASQVQPLDIYTEAGFERRLFEATDQYAGKESDAMFPYWNIWVPSEDASELSTLTANVESSVATATAEFVTGVRDPESDADWQSYLDALTSLGADRYAEIWQSAYDQ
>CP028137.1|AZZ54199.1|1423936_1424800_-|sugar-ABC-transporter-permease
MVDRVFMIAVYVLLTTFLLAVLLPLLYILASSFSSPLAVSSGRVSFWPIDFTLEGYERALGDSTIVTGFANSLFYTAAGTFVSLALTVAIAYPLSRKDFWGRGGITLGVIFTMLFAGGIIPTYLVVQQLGLLDTRWALILPQAVGVWQVIIAVVFFRSSIPDELYEAAQLDGASDLRFLWTIVLPLSKPLLAVIALMYAIYQWNSYFDALLYLRDPSLYPLQLVLRNVLILNQATPGMDAAAQIERQQLADLLKYSLIVISTVPVMILYPFVARYFNKGIMLGAVKG
>CP028137.1|AZZ54200.1|1424895_1425924_-|sugar-ABC-transporter-permease
MPLTGAPGTTVPGSTVPGAPGPEAPVPGGPASIRGRSNARGFRAARRSFRRHWQLYLLILPPLLYFIVFKYVPMSNAIIAFKDYNVIDGVWGSPWVGFKHFERFFSNPIFWTLLKNTFLLSAYVVLAGFPFPILLALALNEVRLRFFQRTVQMVTYAPYFISTVVVISMTILFLSPKLGPVSDVTSFFGLGAIDFLGDPDFFRHIYVFSDVWQTTGYSAVLYLAALSSIDTSLYEAARMDGASRLQKIWHVDIPGIMPTAITILILGVGNVMAIGFEKAFLLQNSLNLSQSEIIPTYVYKVGLLNADFSQAAAIGLFNGMINLVLLLGVNSLAKRITGQGLW
>CP028137.1|AZZ51751.1|1426340_1427360_-|LacI-family-transcriptional-regulator
MSTTDHGRNGPVVTMRDVAKAAGVSVATVSHVINDKPGARIGEGARLRVQEAVAALGYRPNALAKTLRHGSSRFIGLVADAIATTPFAGQIIHGAQDEAWKHGYVLLIANTEGDRAAEDEAIAMMLEHQVHGILYSTWVHREIVVPEMLQQAGTVLVNCFAPGSGLPAVVPDEEQGGRTAAEELLAAGHRRIAFLNTTTDSPARNGRLAGYRAALAAAGISFDVELVVDTSPEQEGGYLATERVLASRATAVFCHNDRVAMGLYDGLRERGLRIPEDVAVIGFDNQDVIAAHLRPPLSTVALPHYELGAAGVRALLGTERGAADRPQLIPCPPVRRRSI
>CP028137.1|AZZ54201.1|1427356_1428259_-|sugar-ABC-transporter-permease
MLTRPAATPSASAPGPRPRRPRRSPRLRVQRTLLTVTIVAIVLVQVYPLAWLFLTSFRTAADFAGGDPFALPAAVTLENYSRAFATGNLGLNIVNSLIVTLGASAVIVVAGMMAAFALQVLGFRFSRLVRSLFLLGIIVPVQIALVPLFIDYSQVGLLDTHLSMIIPLAAFALPMAVYLFSSFYEYIPAEMYEAASLDGAGPYRIFLRITSPLSVNTIITVVLVNSIFIWNDFIFANTFVLSDGLKTIPLGLQNYIGAMGNTDWTATFAAVCVTVTPLLLVFLVLNKAMIQGLESGATKG
>CP028137.1|AZZ54202.1|1428267_1429149_-|sugar-ABC-transporter-permease
MLPRRSRLSVLVFLLPPLVVYGLAVLLPIVQSLVLSFFRWDGITDMAFVGLDNYIKMLTRDDVFWTSFGNALGYLAICLVLQLGGALIVASLLTALPRFRELVKTLYLLPAVISTVAIAILFQRIYSLEPLGLVNQALSWIGLDGLQTAWLSNVSTVLAAVSIPEGWRFTGLYMLIIYAALLAVPRELEEAARLDGATWWQLFRRVRFPYIRPVWITTTIMATTFALRGFDIPYLLTNGGPGQSSELLTTYMYKTAFVHTDYGYASAISVFIVIECLIAVGVILLLLRRRDDS
>CP028137.1|AZZ51752.1|1429198_1430539_-|sugar-binding-protein
MPAITRRGSFLAAASTALVLLLSGCAGGSAGVAPTDVHPEGEIVPRPISWLLSRPADGGVITAMQQIADEYAADHPGFELDLITTPDRPSYVQKYETLAAANKLPELFDTDATPFAQKLASQGRMMDVDALLEDLGLADDYRTAALDYQRFDDGSLHMVPFEFQLEFFWYNSALLEKAGVPVPATLDDFPAMCEALRAQGVTPIALDGQDQWPLERYMAYYPFRTAGPQYVQDLKSGKASFSDAPGRAAAEWLSSLGEAGCFQEGFSSTGYADAQALFTSGKAAVYNIGTWELGNLATESLDPAVRDSVDYFTLPSVEGAVTADDEYVTPSGIGMAVNARTYDPLVRDFLAFALKRYPEVYAATGALSPTTTATTAVPGDATPLYSRAVEQADSVGSAIAMPWDTQLDPATNTRLQQELTLLVQGDTTPDQFVETMDAALAENSDD
>CP028137.1|AZZ51753.1|1430631_1432101_-|glycoside-hydrolase
MSQRGFFRPENAWVGDLIPWQADGEFHLFHLHETRATPKEGMPWRRVITRNLIDFEDAGVALASGGPLADDFNVYTGSVVQDSDGVHHVFYTGQNPERRGTDGLPLQLVLHATSRDGMRSWQRRPADTFGATPGYETADWRDPFVLRDEEAGVWRMLITARHADGPSRRRGVIAQCTSTDLVTWDAAEPFWDPRRYLAHECPEVFQWGGWWYLVWSEFSDSFTTRYRMSRDLHGPWLVPEHDTVDGRAFYAAKSAERDGRRFFFGWIASREGSSDDGAWQWAGTLSVLEAEQRGDGTLAFHLTEELRESFEEPRPLAPEGSVLDAPDGYAQLLSGEEAPSAFRLVATLDIGAGMTECGVLLRASADGDESYVLRLEPRRHRLVLDRWPRRATGTEQWQISGDVPFAVELERPVRLEPGRHELEVVVDGDLCIATVDDAVVLSTRLYDRPAGDVGVFVGEGRIDVLGFALAARRRSSGTDRTRRLVSAGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_6

2252115-2252201

Orphan

Consensus_repeat	Method
CGGGGCTACTCGACCAACATGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_6

>merge|CP028137|6|2252115-2252201|CRISPRCasFinder
CGGGGCTACTCGACCAACATGGATGCATCGCCCGTGCGCGACGGTGGGTCTCGATACGCCCCTCCGGGGCTACTCGACCAGCATGGA

>CP028137|6|6|2252115-2252201|CRISPRCasFinder
CGGGGCTACTCGACCAACATGGA	TGCATCGCCCGTGCGCGACGGTGGGTCTCGATACGCCCCTC
CGGGGCTACTCGACCAGCATGGA

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ54270.1\|2250660_2251914_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224799
CP028137.1\|AZZ52449.1\|2254251_2255139_-\|glycosyl-transferase	unknown	unknown	gnl\|CDD\|133029
CP028137.1\|AZZ52446.1\|2246661_2248191_-\|PLP-dependent-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|224089
CP028137.1\|AZZ52452.1\|2257158_2258694_-\|serine-protease	unknown	unknown	gnl\|CDD\|273938
CP028137.1\|AZZ52447.1\|2248189_2248858_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	unknown	unknown	gnl\|CDD\|378988
CP028137.1\|AZZ52443.1\|2242359_2243178_+\|sugar-ABC-transporter	unknown	unknown	gnl\|CDD\|213187
CP028137.1\|AZZ52442.1\|2240745_2241486_+\|UDP-N-acetylglucosamine-pyrophosphorylase	unknown	unknown	gnl\|CDD\|133014
CP028137.1\|AZZ52456.1\|2262155_2262539_+\|glyoxalase	unknown	unknown	gnl\|CDD\|319911
CP028137.1\|AZZ52457.1\|2262761_2263358_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379312
CP028137.1\|AZZ52444.1\|2243256_2244744_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366166
CP028137.1\|AZZ52450.1\|2255125_2255926_-\|transferase	unknown	unknown	gnl\|CDD\|376450
CP028137.1\|AZZ52445.1\|2246068_2246665_-\|Fe-S-cluster-assembly-protein-HesB	unknown	unknown	gnl\|CDD\|132296
CP028137.1\|AZZ54268.1\|2241577_2242357_+\|sugar-ABC-transporter	unknown	unknown	gnl\|CDD\|224596
CP028137.1\|AZZ52451.1\|2255922_2257017_-\|glycosyl-transferase-family-2	unknown	unknown	gnl\|CDD\|133016
CP028137.1\|AZZ52448.1\|2249408_2250560_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|279875
CP028137.1\|AZZ54269.1\|2245105_2245636_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
CP028137.1\|AZZ52453.1\|2258822_2260025_+\|aminotransferase	unknown	unknown	gnl\|CDD\|236095
CP028137.1\|AZZ54271.1\|2252236_2254141_-\|amylosucrase	unknown	unknown	gnl\|CDD\|200463
CP028137.1\|AZZ52454.1\|2259998_2260892_-\|hydrolase	unknown	unknown	gnl\|CDD\|143605
CP028137.1\|AZZ52455.1\|2260891_2261758_-\|CHAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|226451

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54270.1\|2250660_2251914_-\|hypothetical-protein	gnl\|CDD\|224799	COG1887, TagB, Putative glycosyl/glycerophosphate transferases involved in teichoic acid biosynthesis TagF/TagB/EpsJ/RodC [Cell envelope biogenesis, outer membrane].	0.0030567
CP028137.1\|AZZ52449.1\|2254251_2255139_-\|glycosyl-transferase	gnl\|CDD\|133029	cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.	4.13293e-21
CP028137.1\|AZZ52446.1\|2246661_2248191_-\|PLP-dependent-aminotransferase-family-protein	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	1.49355e-105
CP028137.1\|AZZ52452.1\|2257158_2258694_-\|serine-protease	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	6.31471e-81
CP028137.1\|AZZ52447.1\|2248189_2248858_+\|pyridoxamine-5'-phosphate-oxidase-family-protein	gnl\|CDD\|378988	pfam12900, Pyridox_ox_2, Pyridoxamine 5'-phosphate oxidase. Pyridoxamine 5'-phosphate oxidase is a FMN flavoprotein that catalyzes the oxidation of pyridoxamine-5-P (PMP) and pyridoxine-5-P (PNP) to pyridoxal-5-P (PLP). This entry contains several pyridoxamine 5'-phosphate oxidases, and related proteins.	9.78487e-41
CP028137.1\|AZZ52443.1\|2242359_2243178_+\|sugar-ABC-transporter	gnl\|CDD\|213187	cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.	4.93233e-101
CP028137.1\|AZZ52442.1\|2240745_2241486_+\|UDP-N-acetylglucosamine-pyrophosphorylase	gnl\|CDD\|133014	cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline. This family contains proteins similar to prokaryotic phosphocholine (P-cho) cytidylyltransferases. Phosphocholine (PC) cytidylyltransferases catalyze the transfer of a cytidine monophosphate from CTP to phosphocholine to form CDP-choline. PC is the most abundant phospholipid in eukaryotic membranes and it is also important in prokaryotic membranes. For pathogenic prokaryotes, the cell surface PC facilitates the interaction with host surface and induces attachment and invasion. In addition cell wall PC serves as scaffold for a group of choline-binding proteins that are secreted from the cells. Phosphocholine (PC) cytidylyltransferase is a key enzyme in the prokaryotic choline metabolism pathway. It has been hypothesized to consist of a choline transport system, a choline kinase, CTP:phosphocholine cytidylyltransferase, and a choline phosphotransferase that transfers P-Cho from CDP-Cho to either lipoteichoic acid or lipopolysaccharide.	3.96519e-48
CP028137.1\|AZZ52456.1\|2262155_2262539_+\|glyoxalase	gnl\|CDD\|319911	cd07247, SgaA_N_like, N-terminal domain of Streptomyces griseus SgaA and similar domains. SgaA suppresses the growth disturbances caused by high osmolarity and a high concentration of A-factor, a microbial hormone, during the early growth phase in Streptomyces griseus. A-factor (2-isocapryloyl-3R-hydroxymethyl-gamma-butyrolactone) controls morphological differentiation and secondary metabolism in Streptomyces griseus. It is a chemical signaling molecule that at a very low concentration acts as a switch for yellow pigment production, aerial mycelium formation, streptomycin production, and streptomycin resistance. The structure and amino acid sequence of SgaA are closely related to a group of antibiotics resistance proteins, including bleomycin resistance protein, mitomycin resistance protein, and fosfomycin resistance proteins. SgaA might also function as a streptomycin resistance protein.	8.06025e-10
CP028137.1\|AZZ52457.1\|2262761_2263358_-\|hypothetical-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.03863e-13
CP028137.1\|AZZ52444.1\|2243256_2244744_+\|hypothetical-protein	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	6.97837e-14
CP028137.1\|AZZ52450.1\|2255125_2255926_-\|transferase	gnl\|CDD\|376450	pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase. All of these members have the ability to catalyze the displacement of CMP from a CDP-alcohol by a second alcohol with formation of a phosphodiester bond and concomitant breaking of a phosphoride anhydride bond.	1.5832e-06
CP028137.1\|AZZ52445.1\|2246068_2246665_-\|Fe-S-cluster-assembly-protein-HesB	gnl\|CDD\|132296	TIGR03252, TIGR03252, uncharacterized HhH-GPD family protein. This model describes a small, well-conserved bacterial protein family. Its sequence largely consists of a domain, HhH-GPD, found in a variety of related base excision DNA repair enzymes (see pfam00730). [DNA metabolism, DNA replication, recombination, and repair].	7.61987e-84
CP028137.1\|AZZ54268.1\|2241577_2242357_+\|sugar-ABC-transporter	gnl\|CDD\|224596	COG1682, TagG, ABC-type polysaccharide/polyol phosphate export systems, permease component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane].	4.8347e-46
CP028137.1\|AZZ52451.1\|2255922_2257017_-\|glycosyl-transferase-family-2	gnl\|CDD\|133016	cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.	6.48485e-90
CP028137.1\|AZZ52448.1\|2249408_2250560_-\|AI-2E-family-transporter	gnl\|CDD\|279875	pfam01594, AI-2E_transport, AI-2E family transporter. This family includes four different proteins from E. coli alone. One of them, YdgG or TqsA, has been shown to mediate transport of the quorum-sensing signal autoinducer 2 (AI-2). It is not clear if TqsA enhances secretion of AI-2 or inhibits AI-2 uptake. By altering the intracellular concentration of AI-2, TqsA affects gene expression in biofilms and biofilm formation. TsqA belongs to the AI-2 exporter (AI-2E) superfamily.	3.48934e-41
CP028137.1\|AZZ54269.1\|2245105_2245636_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.00222e-39
CP028137.1\|AZZ52453.1\|2258822_2260025_+\|aminotransferase	gnl\|CDD\|236095	PRK07777, PRK07777, putative succinyldiaminopimelate transaminase DapC.	0
CP028137.1\|AZZ54271.1\|2252236_2254141_-\|amylosucrase	gnl\|CDD\|200463	cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase. Amylosucrase is a glucosyltransferase that catalyzes the transfer of a D-glucopyranosyl moiety from sucrose onto an acceptor molecule. When the acceptor is another saccharide, only alpha-1,4 linkages are produced. Unlike most amylopolysaccharide synthases, it does not require any alpha-D-glucosyl nucleoside diphosphate substrate. In the presence of glycogen it catalyzes the transfer of a D-glucose moiety onto a glycogen branch, but in its absence, it hydrolyzes sucrose and synthesizes polymers, smaller maltosaccharides, and sucrose isoforms. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
CP028137.1\|AZZ52454.1\|2259998_2260892_-\|hydrolase	gnl\|CDD\|143605	cd07581, nitrilase_3, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	4.36567e-118
CP028137.1\|AZZ52455.1\|2260891_2261758_-\|CHAP-domain-containing-protein	gnl\|CDD\|226451	COG3942, COG3942, Surface antigen [General function prediction only].	1.32264e-12

>CP028137.1|AZZ54270.1|2250660_2251914_-|hypothetical-protein
MLRDATLARGVARDLLTARRARRDVARELAARAPLTPGVFEIGVYFADGDINLYQLRQWYAPLQELAKTHPVVLLSRNATATRALLRESPLPVAHVRSVADLETAIDEQPLRIVLYVNQNARNFQMMRYGRRWHVFVNHGESDKMYMTTNQFKAYDYSFIAGDAALARLRRVLWDFDFDKRAIAIGRPQADHVSGRTPYPADERRVVLYAPTWEGDRPAAGYGSIRTHGVALTRALLADPRYRLVYRPHPRSGAVDPAYGAADREIVALIAAANAADPAARHVHDTSAELGWQLTADIAVLDVSAMVYDRLATGRPLLVTRPISPAAEVDESGYLGDAEWLRAEDAAAIVPRLESVEHDEAAVERLERWVAHYFGDTSPGAATARFHAAIEQLLAEWDRHAELHRDDAAVDEHDPEH
>CP028137.1|AZZ52448.1|2249408_2250560_-|AI-2E-family-transporter
MITPRAFARSRRRAAAPAQPVVEPDIVVSSDPERPQFTIRSFRIGLFGGLGVLVALVVGGLVVSLGTVLTYVFVALFFALGLDPLVSWLESKRIPRALAITIVLASVLLIFAGLLLYIIPILIEQLTIFVTSAPRIVSDIASQPWVLDLERQLSGVVDVDSLIGSVQSFIGNPNNLLSLGGGILAVGSGIASGVTGAIIVLILTLYFLASLRSMKSVAYRFAPASHRPKAREVGEEITGAVGRYVVGQVSLAAVNGVLTFILLLIIGGPVPALLACVAFLGSLIPLVGTISGAVIISLACLLASPVTALVAAIYYLVYMQVEAYVLSPRIMNRAVSVPGAVVVIAAVAGGTLAGVLGALVAIPVAASVIIVVQKVVFPRQDTK
>CP028137.1|AZZ52447.1|2248189_2248858_+|pyridoxamine-5'-phosphate-oxidase-family-protein
MDTLDTTDRTRVTRLRDRQVLDRGALDALLDEALIAHVAVVRDGAAIVLPILFARDGDDLLLHGSSGGGLLREAARGSLLTVAVTLVDGLVVARSAFDSSMNYRSAMILGRAEPVEGPGKARALDLLTERLLPGRPAETRPSTAREIAATLVLRLPLAEASLKIRAAGPSDDDAQTPGVWAGTVPLVTRTLPAVRAPGSAPELPASATAFTSTIDSTVPPFR
>CP028137.1|AZZ52446.1|2246661_2248191_-|PLP-dependent-aminotransferase-family-protein
MVRGSRPHWICENAREPRVEWSRTGESMASGDLEVPLLLRAPERGAVRSGLAEALRAAVLDGRYGAGDAIPSSRVLAQQLGVSRGSVVAAVDQLVGEGYLVAHPRAAVTVAADGVVVPIRSRVERAEPAVLPATARLDLRPGRPDTRDLDGPEWRAAWRPALSAPPSELPSAAGHAGLRRRIAEQLRRSRGIDVEAEDVLVTSGTADAVALLVRAAAIALGRPVRVAVEDPGYPAVRRRLRAEGHEVVGVPVDADGIDLDALATSGADVVVVTPSHQYPTGGRLALAARLELVRRAATERLLVIEDDYDSEFRYVGAPLPALASLDGGGGVAHVGSFSKTVSPWLRVAYLTLPPSSWLHGAVREVDAERDASVSGPTQEALAAFMAGGGFRRHLTRSRRRYAHRRGLVRDFSEAIDWGSARGLDGGLHVVLGLPAPLTARAVVAALAAEGLLVAPLDDYALADRAEQEALVLGYGSASDLELTAALSTIDRTVRALLGGDAGVRGIPGG
>CP028137.1|AZZ52445.1|2246068_2246665_-|Fe-S-cluster-assembly-protein-HesB
MTADSALHITDDADADALLSRDPLALLIGMLLDQQVAMETAFSGPLKLEQRLAEEGSSFDAAAIADFDEDRFSELSRTPPAIHRYPANMAGRVQTLCRAIVDDWNGDASAIWTRDDPDGREVLARLKALPGFGDQKARIFVALLGKRRGFEGEGWREAAGAYGEEDSFRSVADIVSPESLAKVRATKQAAKAAAKAKK
>CP028137.1|AZZ54269.1|2245105_2245636_-|GNAT-family-N-acetyltransferase
MLPSDTAHLRFREMTEADLDLLAELLGDPEVMRYYPAPKTRAEAADWIAWNRRNYERDGVGLWVIETADGDFVGDCGLTWQSVNGVPELEVGYHVRSSLQGRGYATEAATACLELARRCGLAERLVAIIHPENSASQRVAEKIGLLVAGEDRDGGPLVRIVLATPLDGSRSRPEEG
>CP028137.1|AZZ52444.1|2243256_2244744_+|hypothetical-protein
MSSKKDRKDRDELEQAGTADVENAQLARILDRVLAVQRPAVLANIRALRRRRPNATPEQLITSLERQYLSSVAAGGAAIGATAVVPGIGTAASVALSGAGAIGFLEASALFAQSVTEVHGIRLEDPDRARALVLTLMMGSSGSELVRQVAGHATGTSTGMNQYWGSVVTKGLPSFLVGELADRAKKSFAKHFLAQQGAGLVGRAMPFGIGAALGGVGNAMLGRKVVQSARDAFGPAPREFGNTFVLPPTKAERKALAAGAEPLELHVRDYGGTGEKVALLLHGLGTDSRVWYALVPTLHEHGYRVVAPDLAGHGGSPKSPAYSVDHWAEDVRASVLQTPDLVIGHGLGAVVAARLAPEYRAERLILLDPAFSDAKGLGSALRRGGSIAHVEKGDADDLRHRHPIWTDEQIELDVSAHALWDPESASGLTARGAADAPDAFPVPTLVVLPEDPLGHSSLGDVLADHGAEVRTIPGAGASILREDRAALISALADRL
>CP028137.1|AZZ52443.1|2242359_2243178_+|sugar-ABC-transporter
MDAPDRASGGDSPAGRAPAGDSPVVIECRGLGIRFRRNRRGRRSFKDLFSRGTRRSRPGEFWALRGLDVRVHAGEAIGVVGRNGQGKSTLLKLVAGVVLPDEGVVEVRGGVAPLIEITGGFVADLSVRENVYLTAGLHGMSKREVDDRFDSIIEFAEIGDFLDTPYKHLSSGMKVRIAFSVVSRLEEPIILVDEVLAVGDKAFREKCYARIEELLAAGRTLFFVSHNERDLRRFCTRGLYLDKGALVLDAPIDQVLARYSEDYAPKAQPAAE
>CP028137.1|AZZ54268.1|2241577_2242357_+|sugar-ABC-transporter
MRPHRSRAWRYRHSLWLLTKRDLTVRYATSALGYVWSVLDPLVMSGIYYFVFTVVFQRTVGEDPYIVFLLAGLLPWMWFNQATSDATRAFLREAKLVRSTSIPRTIWVGRIVLSKGIEFVASLPVLVLFAVVAGAGVTPAILLFPLAILLQGVLTLGVGLLVAPLVVFFRDLERAIKLVLRFLFYASPIIYSTANLPDAIRPWAALNPLSGIFALYRSTFFASELDLPLILTSVLISFLVLGLGLIVFRRSERAVLKEL
>CP028137.1|AZZ52442.1|2240745_2241486_+|UDP-N-acetylglucosamine-pyrophosphorylase
MTSKPFPTASAGGSTGAPASVVILAAGMGSRLGRSLPKPLTPLSDGRTIMQQQFDNIHHAFGTKVPVSIVVGYKLEHIIEAFPSATFVYNEQYDQTNTSKSLLRALQASGQGGVLWMNGDVVFDPRILDRTADLIAKDVSFVTVNTAKVSDEEVKYTTSAEGYIDELSKTVKRGLGEAVGINYVSAADKPALIRQLARVDAQDYFERGIELAIEQDRLLVEPMDISDLYAVEVDFAEDLERANLFV
>CP028137.1|AZZ54271.1|2252236_2254141_-|amylosucrase
MPTPDDLIAAVRSRVDALGGPVADPEFRSRLDARLPRLVDLLAAVYARRDDLVEQIVALVELAATSWQERPEDLRVLDRARGQHPDWFLSNKALGGVCYVDRFAGDLAGLRAEIPYFRQIGLNYLHLMPVFDAPEGESDGGYAVSSYRRVRPDLGDMDDLRLLAAELREHGIALVVDFVFNHTSNEHEWARKALAGEQRYEDYYWIYPDREQPDAFERTTREIFPDDHPGSFVQLEDGRWVWATFHRYQWDLNYSNPEVFRAMAGEMLFLANQGVDALRMDAVAFIWKELGTTCESQPEAHLLLRAFNEVCRLAAPSLLFKSEAIVHPDEVIEYIDLEECQLSYNPLQMALTWEALATRDVRLLAQALERRHALPAGTAWVNYVRGHDDIGWTFADEDAAELGIDAAGHRRFLNDFYTDRFEGTFARGVPFQENPRTGDRRVSGTTASLAGVEAGDPYGIDRVLLAHSIALSTGGLPLLYLGDEVGQLNDHTYLDDPSTAGDSRWVNRPRRPAERYAERETPGADAAEIFGGLLHLIAVRKRTDLFAGNALTVFDAVNDHVLGYQRPGDGEAVLVLANVSDEAQEVAPERFGGFAPEAVDLVTEIAVDLREGFRLAPLQFVWLRVTPASASPAE
>CP028137.1|AZZ52449.1|2254251_2255139_-|glycosyl-transferase
MSGPEPGGLPRVGVVVLTQGTRPDDLAAGLASVLAQEGVELDVVCVGNGWVPEGLPEGVRALALPENLGIPAGRNAGVPAVAGEYLFFLDDDARVPSPSFLRDAIALLASPRRIGMVQPRVDSVDGTPAPRRWTPRILKGDPRRSGPVFSVWEGAVVLRRDVFERTGGWAAPFFYAHEGIELAWRVWDTGRSTWYAGELVAQHPVIQPTRHADYYRLNARNRVWLARRSLPAPLALAYVGSWTAIQCLRWRNDRPALRAWFAGWREGWTADPGERRILAGRTLLRMTVAGRPPIV
>CP028137.1|AZZ52450.1|2255125_2255926_-|transferase
MTSTDRPRSIAELRAVAQPPEVRGRRNAEHWTASLYLRRFSPYLTMQLLRTSISANGVTGLMILVGWSAAAALLIPGIAGAALALILGQLQMLVDCCDGEVARWRRTSSPAGVFLDKVGHYTTESLIPIALGLRAAGIPFDAPEDFLWTSIGLALALVIVLNKALNDMVHVARANAGLTKLADTKGEATPSSSALARLRRAARFVPFHRLYHSVELTMLAFAASLVGLVVGAGTADRVLVSALLPLALLALVGHFVAIMASKRVRS
>CP028137.1|AZZ52451.1|2255922_2257017_-|glycosyl-transferase-family-2
MQPETPTDDLPDLPGVSYVMPVLNEVTHVRAAVDSLLAQDYTGPFDVVLALAPSIDGTERLVAELSAADERIRVVANPVGSTPAGLNAAIRASRHPVVVRVDAHSVLPPDYARIAVEALQRSGAANVGGVMAAEGLTPFQRAVARAYGSRIGLGGTPHHVGGEEGPADTVYLGVFRRSALERAGLFDERFKRGQDWELNRRLREAGGLVWFTPRLTVTYRPRPSMRALLRQFLSTGMWRGELTRLFPASRSLRYFAPPVLVALLALGLLAGIAGALQALLGAAPWLLLGLVVPVGYLALVAAATIAVARVDGPRTMLWFLVVIPAIHVAWGTGFVLGFAGLTSNIAAHRHHPAADPAADSARDA
>CP028137.1|AZZ52452.1|2257158_2258694_-|serine-protease
MTESHDGPRQPEDPRTPEDRRHEANQPISGEHTPGQPTYPSGTGAPSSSTGPTEPLPSYTSNSAEGNQAQPVPPTPRYGQFAPPAAHTVQSTEQPPVGEQGSFGGGQPPVGPPTATKRRAGVGVVAALAIGAVVGGVAGAGVFGLWSASNGAGTRVVSSSGSQTITVNNAEDATTATAVAAKATPSVVTIAVAGSSSSGTGSGIVLSKDGYVLTNTHVVTLDGQISDGAVTVTTSDGRIFTATIVGTDPTLDLAVIKLADATDLVPITFADSSEVNVGDTAVAIGAPLGLSGTVTDGIVSALNRSIQVASSAAPDDSGDSSSGGAESPFNFDIPGQTQQTPATSTISLPVIQTDAAINPGNSGGALLDSDGELIGVNVAIASAGQSSSSGGQSGNIGVGFAVPSAVAERVAKEIIANGSATHGLLGASVSDSTQDVLGAKIQEVTSGGAAQAAGLAAGDIVTGVAGTPITSASDLTAQVRAQAANADVKLTYVRNGKTFEIDVTLGTMATS
>CP028137.1|AZZ52453.1|2258822_2260025_+|aminotransferase
MSIHGSWTRAAAGAGLLGPSGEVAATVFSEMSALAARTGAINLGQGFPDEDGPQEVLEAARAAISAGLNQYPPGPGFPVLREAVSAHQRRFYDLAVDPDGEVLVTTGATEALAATLLALLEPGDEVVTFTPHYDAYGALIALAGGVHRTVPLRGTDFHVDHEELTAAVSDRTRVILVNDPHNPTGSVLPAETRELIVRLAHRHDALIVTDEVYEHLRFDGGHVPIATLPGARERTLTVSSAGKTFSTTGWKIGWITGPRALITAVLAVKQFLTYVSGSPFQGAVAVGLELPDAFFTGIAATLERKRDVLAAGLAAAGFTVSPSAGSYFVVADAAPLGWDDGVAFCRALPGLAGVVAVPVSAFCSAEDADAYRSLVRFAFCKRFEVLDSAAEGLAGLARRG
>CP028137.1|AZZ52454.1|2259998_2260892_-|hydrolase
MAAQRRASTRKAAQPASAAAVGFAVAQFAPTDDRAANLAAIRRLAGVAAQRGASVVVLPEYSSFFVDPLGPELVAAGEALDGPFVQGLGEIARELGVHLVAGMVESVDDGERIANTLVAVEPGGAVVATYRKLHLYDAFGQTESDWVAPGEIGVPQTFEVGGLVVGLQTCYDLRFPEVTRWLIDAGADVVAAPAEWVRGPLKEAHWRTLVTARALENTIYLVAADQTPPIGVGTSMIVDPMGVEIATLGEVEDVAVAWLSQERIASAREKNPALALRRFEVRPVRAGRRSAAARESR
>CP028137.1|AZZ52455.1|2260891_2261758_-|CHAP-domain-containing-protein
MAVRTPVLATVAPVRRRRGRVLRTTVSTVAAAAIAGMVAVMALPAYSFDPAPDSQAAIEAAARIQALGNQKLTVASTAVQEQVIRDSFTAPTQAQLDEAAAQARALAAAAEKAAADAAAAAAAAAEEASGTSSAAASPSRSGGTSSSVTPREEGDDYPWRDALTDDQGGGLSPLRYYYRECVDFVAWRLNRDQGSTGAPFKWTWGNLTPGGGSAYAWAGQWASHGWETSTTPVPGAVAWFNGNHVAYVQSVNGDGTVSLEEYNWGNDHAYHARTIPASSVPLFLYPPS
>CP028137.1|AZZ52456.1|2262155_2262539_+|glyoxalase
MIRSEWAFSGFSVRDVEAARAFYGDVLGLEVSVNTMGILDIALPGGGSAIAYPKPSHVPAEFTILNFAVEDVDAAVAALNDSGVVTKIYSDSEMPTDENGVMRGRGPTIAWFRDPSGNVLSVIDAAS
>CP028137.1|AZZ52457.1|2262761_2263358_-|hypothetical-protein
MVQVDRGEHLRAGEWLDPNREYWEGRAGDGAPLRAFGAAVPAGARVLHLQCGAGGDALLLAERGEDVIGVDFSMPAIRLAREAARERGLAERTRFVCANLYELRHMLPEPDAFDAVVTTLDAVAWLPDLEEWARVVEWFVAPGGTAVIGAQARPRVDDPAVRTWERSGEDVAEALRATGLEVAASALDGVAWTATKPE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_7

2753921-2754069

Orphan

Consensus_repeat	Method
GGGTCTCGATACGCCCGCTGCGCGGACTACTCGACCAGCATGTTCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_7

>merge|CP028137|7|2753921-2754069|CRISPRCasFinder
GGGTCTCGATACGCCCGCTGCGCGGACTACTCGACCAGCATGTTCGCGTGAAGTGCGAGGCGGAGCGAGGGGTGCGTTCTGCCGCAACTGCGGGAGGACGTGGGTCTCGATACGCCCGCTGCGCGGGCTACTCGACCAGCATGTTCGCG

>CP028137|7|7|2753921-2754069|CRISPRCasFinder
GGGTCTCGATACGCCCGCTGCGCGGACTACTCGACCAGCATGTTCGCG	TGAAGTGCGAGGCGGAGCGAGGGGTGCGTTCTGCCGCAACTGCGGGAGGACGT
GGGTCTCGATACGCCCGCTGCGCGGGCTACTCGACCAGCATGTTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ54310.1\|2745914_2746535_-\|serine-O-acetyltransferase	unknown	unknown	gnl\|CDD\|223975
CP028137.1\|AZZ52821.1\|2753483_2753882_-\|DUF779-domain-containing-protein	unknown	unknown	gnl\|CDD\|377532
CP028137.1\|AZZ52819.1\|2747719_2750263_+\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|223815
CP028137.1\|AZZ52829.1\|2765990_2766833_-\|polyphosphate-glucokinase	unknown	unknown	gnl\|CDD\|224851
CP028137.1\|AZZ52823.1\|2757254_2758223_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
CP028137.1\|AZZ54312.1\|2754260_2755835_-\|aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143434
CP028137.1\|AZZ52828.1\|2764595_2765720_+\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340830
CP028137.1\|AZZ52824.1\|2758341_2759184_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153097
CP028137.1\|AZZ54311.1\|2752912_2753395_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379568
CP028137.1\|AZZ52814.1\|2741818_2742016_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378935
CP028137.1\|AZZ52815.1\|2742332_2743559_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
CP028137.1\|AZZ52825.1\|2759231_2760233_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
CP028137.1\|AZZ52816.1\|2743753_2744344_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
CP028137.1\|AZZ52826.1\|2760470_2761031_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99750
CP028137.1\|AZZ52817.1\|2744429_2745896_+\|deoxyribodipyrimidine-photolyase	unknown	unknown	gnl\|CDD\|223492
CP028137.1\|AZZ52822.1\|2755953_2757246_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|225822
CP028137.1\|AZZ52830.1\|2766933_2767761_-\|taurine-ABC-transporter-ATPase	unknown	unknown	gnl\|CDD\|374030
CP028137.1\|AZZ52820.1\|2750565_2752896_+\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|223815
CP028137.1\|AZZ52818.1\|2746531_2747467_-\|cysteine-synthase-A	unknown	unknown	gnl\|CDD\|273463
CP028137.1\|AZZ52827.1\|2761056_2764512_-\|helicase	unknown	unknown	gnl\|CDD\|223627

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54310.1\|2745914_2746535_-\|serine-O-acetyltransferase	gnl\|CDD\|223975	COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism].	5.28898e-77
CP028137.1\|AZZ52821.1\|2753483_2753882_-\|DUF779-domain-containing-protein	gnl\|CDD\|377532	pfam05610, DUF779, Protein of unknown function (DUF779). This family consists of several bacterial proteins of unknown function.	1.7379e-58
CP028137.1\|AZZ52819.1\|2747719_2750263_+\|penicillin-binding-protein	gnl\|CDD\|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	5.99241e-99
CP028137.1\|AZZ52829.1\|2765990_2766833_-\|polyphosphate-glucokinase	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	2.74591e-26
CP028137.1\|AZZ52823.1\|2757254_2758223_-\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	2.66055e-20
CP028137.1\|AZZ54312.1\|2754260_2755835_-\|aldehyde-dehydrogenase	gnl\|CDD\|143434	cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like. Included in this CD is the NAD+-dependent, acetaldehyde dehydrogenase II (AcDHII, AcoD, EC=1.2.1.3) from Ralstonia (Alcaligenes) eutrophus H16 involved in the catabolism of acetoin and ethanol, and similar proteins, such as, the dimeric dihydrolipoamide dehydrogenase of the acetoin dehydrogenase enzyme system of Klebsiella pneumonia. Also included are sequences similar to the NAD+-dependent chloroacetaldehyde dehydrogenases (AldA and AldB) of Xanthobacter autotrophicus GJ10 which are involved in the degradation of 1,2-dichloroethane. These proteins apparently require RpoN factors for expression.	0
CP028137.1\|AZZ52828.1\|2764595_2765720_+\|glycosyltransferase-family-1-protein	gnl\|CDD\|340830	cd03800, GT4_sucrose_synthase, sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.	1.86663e-85
CP028137.1\|AZZ52824.1\|2758341_2759184_+\|hypothetical-protein	gnl\|CDD\|153097	cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins. Ferritin-like, diiron-carboxylate proteins participate in a range of functions including iron regulation, mono-oxygenation, and reactive radical production. These proteins are characterized by the fact that they catalyze dioxygen-dependent oxidation-hydroxylation reactions within diiron centers; one exception is manganese catalase, which catalyzes peroxide-dependent oxidation-reduction within a dimanganese center. Diiron-carboxylate proteins are further characterized by the presence of duplicate metal ligands, glutamates and histidines (ExxH) and two additional glutamates within a four-helix bundle. Outside of these conserved residues there is little obvious homology. Members include bacterioferritin, ferritin, rubrerythrin, aromatic and alkene monooxygenase hydroxylases (AAMH), ribonucleotide reductase R2 (RNRR2), acyl-ACP-desaturases (Acyl_ACP_Desat), manganese (Mn) catalases, demethoxyubiquinone hydroxylases (DMQH), DNA protecting proteins (DPS), and ubiquinol oxidases (AOX), and the aerobic cyclase system, Fe-containing subunit (ACSF).	0.000320614
CP028137.1\|AZZ54311.1\|2752912_2753395_-\|hypothetical-protein	gnl\|CDD\|379568	pfam14342, DUF4396, Domain of unknown function (DUF4396). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 167 and 310 amino acids in length.	9.3655e-41
CP028137.1\|AZZ52814.1\|2741818_2742016_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	2.84138e-12
CP028137.1\|AZZ52815.1\|2742332_2743559_-\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	2.03351e-20
CP028137.1\|AZZ52825.1\|2759231_2760233_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	3.9474e-80
CP028137.1\|AZZ52816.1\|2743753_2744344_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	2.85924e-10
CP028137.1\|AZZ52826.1\|2760470_2761031_+\|hypothetical-protein	gnl\|CDD\|99750	cd06259, YdcF-like, YdcF-like. YdcF-like is a large family of mainly bacterial proteins, with a few members found in fungi, plants, and archaea. Escherichia coli YdcF has been shown to bind S-adenosyl-L-methionine (AdoMet), but a biochemical function has not been idenitified. The family also includes Escherichia coli sanA and Salmonella typhimurium sfiX, which are involved in vancomycin resistance; sfiX may also be involved in murein synthesis.	1.82271e-07
CP028137.1\|AZZ52817.1\|2744429_2745896_+\|deoxyribodipyrimidine-photolyase	gnl\|CDD\|223492	COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair].	6.71638e-177
CP028137.1\|AZZ52822.1\|2755953_2757246_-\|transcriptional-regulator	gnl\|CDD\|225822	COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription].	2.47225e-24
CP028137.1\|AZZ52830.1\|2766933_2767761_-\|taurine-ABC-transporter-ATPase	gnl\|CDD\|374030	pfam15698, Phosphatase, Phosphatase. Members of this family have phosphatase activity.	3.27012e-82
CP028137.1\|AZZ52820.1\|2750565_2752896_+\|penicillin-binding-protein	gnl\|CDD\|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	3.84681e-89
CP028137.1\|AZZ52818.1\|2746531_2747467_-\|cysteine-synthase-A	gnl\|CDD\|273463	TIGR01136, Cysteine_synthase, cysteine synthase. This model discriminates cysteine synthases (EC 2.5.1.47) (both CysK and CysM) from cystathionine beta-synthase, a protein found primarily in eukaryotes and carrying a C-terminal CBS domain lacking from this protein. Bacterial proteins lacking the CBS domain but otherwise showing resemblamnce to cystathionine beta-synthases and considerable phylogenetic distance from known cysteine synthases were excluded from the seed and score below the trusted cutoff. [Amino acid biosynthesis, Serine family].	1.54534e-162
CP028137.1\|AZZ52827.1\|2761056_2764512_-\|helicase	gnl\|CDD\|223627	COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair].	1.30201e-99

>CP028137.1|AZZ52821.1|2753483_2753882_-|DUF779-domain-containing-protein
MDSTRVDVTEAAAGMLQRMSELHGPLMFHQSGGCCDGSSPMCFPVGMFRTGASDVLVETLHVDGLEPIEFYMSRTQFEYWKHTHLTVDLVDGRGSGFSVEAPEGKRFMIRSRLLTDAELVEFGLLPAAAVQL
>CP028137.1|AZZ54311.1|2752912_2753395_-|hypothetical-protein
MTDAAHDHSSHSASATTSWRTAATATLHCLTGCAIGEVLGMVLGTALGLHNLGTVLLSIVLAFAFGYALTMRGVLRAGVSWRAAVGIALAADTVSIAVMEVIDNTAMLAIPGAMDAGLATGLFWGSLAGSLALAFVVTTPVNRWLIGRGRGHAVVHRFHH
>CP028137.1|AZZ52820.1|2750565_2752896_+|penicillin-binding-protein
MIVSVLAGLLATVVVAPAFALTGAATSSTISAFQSLPSYLEVGELMQKTDVYAGDPDDPTLLASFYDQNRIEVTADQIAAPVFDALVSSEDPRYYEHGGIDLQGTLRAVASTYLLDAAPQGGSSITQQYVKNVLVQKAESISDESERDAAYTEATATTPERKLKEMRLAIGVEKEYSKDEILLGYLNIALFGGTVYGIEAAAEYYYGVHAADLSVGQSAALLAIVNNPEKFRFDRPDDPDNGEANGYALTTSRRDYILDRMLEYGKIDASTRDAAQAAPIEPVITPPSTGCQTAGSAAYFCDYVSHVLRNDPALGDTADERYTALKRGGLKVYTTIDLAMQDTSAQVVADQVPATDPRFDVGAAAVGVETGTGRILSMVQNKKYSQDPEQIASADGAEYSAINLSVDAAYGGGNGFQPGSTYKVFTLMEWLQDGHTLLEQFDAKNKNWTGFQDSCEGPQDYGVFNPNNNGGQIFPASLNALESTIDSINTGFIGMAHLLDLCDIRKTAEAFGVHRADATPLLESPATVLGTNEIAPLTMAVAYAGVANDGRTCSAVAIDSIVGPEGQDIEAPASNCTQSTTTAVARATQYALLEVTSQGTGQAASPGDGIEHITKTGTTDGAADGWTLGASSEVALAVWVGSISALNDAGKRMALDSIDFDSGSAILARHRIWNPVMTAFDREYGGSAFAKPDQSLVKAPMVTIPDVTGKSVDAAVSALKAAGFVVGGMSQVDSSVPQGQVAGTDPSAGTSVIRGSEIGVRISTGSAATSPPQPSV
>CP028137.1|AZZ52819.1|2747719_2750263_+|penicillin-binding-protein
MTEGDRTTGATTRHPAFARHHRAGRTSRSMALPTASRSSARPLGMSLRAVLGFIGMSAVAGVLITVGVTPALALTGLATSNTIGMFQNLPGYLDAGQLMQRTNIYAGDGTTLLASVYNQNRVEVGWDEVAQTAKDAAVAGEDPRFYEHGGIDLQGTLRALAVTLTGDDLQGGSSITQQYVKNVLVQKAESITDEAERDAAYKLATDPTPERKLKEMRLAIGLEKETSKDDILLGYLNIALFGGTVYGIEAAANYYYGIPASQLSTSQAASLLAIVNNPSKFRFDDPTDEANGAANGYAATKERRDYILTEELKYSKISQEVYDAAIAEPITPNITEPSTGCATAGDAAYFCEYVLNVLRNDEAFGADDDERYQRIRQGGFDIVTTLDLDIQQVSQAAINAYIPSYDSRFQVGATAASIQAGTGRVLSMVQNTKYSQDEEFLAANPGFSAINLNVDVAMGGTAGVQTGSTYKVFTLAQWLQAGHTLNESFPSPTSGFRAYPQKCNVANDGLFTERFAPRNDVASEDASSMTAVQATANSINTGFMGMANQLDLCDIRTTAESFGIHRANGNELENGAASVLGTNEIAPLTVANAYAGIANDGSTCAAIVIDRITDSTGAAVAPPTSSCTQSVTPEVARGMQYAMQRVITSGTATASDPRDGIEHIGKTGTTDEAADVWTAGASRAASLAVWVGSIKGFDDGSKQNLRTTRLTGEKGTIRAADARHAIWKPIMTALDQKYGGDDFIDPPASMLASSPRSATLTEVPDVTGLTVAAATATLTAAGFSVGVTEPVDSARIPEGSVVSTTPSADETVLRGAVIPLQVSTGKAPKNPSDISDVNGTLLTTASE
>CP028137.1|AZZ52818.1|2746531_2747467_-|cysteine-synthase-A
MARIHDDVTQLVGRTPLVRINRLDGADSAVVLAKLEFYNPANSVKDRIGVAIVDAAEASGELPPGGTIVEGTSGNTGIALAMVGAARGYKVILTMPETMSTERRVLLRAYGAEIVLTPGSEGMRGAVERAQAIVAETPGAVLARQFENAANPEVHRRTTAEEVWEDTDGEVDVFVAGIGTGGTITGVGQVLKERKPGVQIIGVEPIDSPLLTQGTAGPHKIQGIGANFVPANLDRDVYDEIIDVTLDDSVRVAREMAAQEGILGGISSGSIMWAALEVAKRPENAGKTIVAIVCDFGERYISTVLYEDLRS
>CP028137.1|AZZ54310.1|2745914_2746535_-|serine-O-acetyltransferase
MSAVGPRRGTTGRLTAFARLREDVAAARLRDPAARSAAEVVLAYPGLHAVWVHRLAHRWWRRGARLPARLLAQAARAATGVEIHPGAAIGRRLFIDHGMGVVIGETARIGDDCMLYHSVTLGGKSAKRERRHPTLGDRVVVGAGAVILGPIVLGSDVSVGANAVVVKDAPDGAVLVGIPARDLRALGRAEDALADPAFWIDPAMYI
>CP028137.1|AZZ52817.1|2744429_2745896_+|deoxyribodipyrimidine-photolyase
MSSSSPTLVWLRDDLRLADNPALRAAIDRGGPVAVCYVLDEESDGIRPLGGAARWWLHGSLLALAGDLEEVGASLILRRGPAEAVVLQLAEELGAGAVHWNRRYGKAERTVDAAIKEALRDRDVEAESHQGSLLFEPWTVQTGGGTPYSVYTPFARACRNRDTPRAPLPRPREIDGIAAEAASDDLDDWQLLPTSPDWAGGLRERWVPGEKAAAKRLRAFLAEQLDDYADDRNLPARDATSNLSPHLRWGEISPFQVWHALEEAHAKGQHRGEGSDRFLAELLWREFCYHLLFHWPDLATANFDSRFDSFPWGHPGEDRIDAWHQGRTGFPLVDAGMRELWKTGYMHNRVRMVTASFLIKNLLVDWRVGEDWFWDTLVDADPASNAANWQWVAGSGADASPFFRVFNPVTQSKKFDPEGGYLREYVPELAELDRTVIHEPWTLGDTLTPEADGYPAPILDLKETRAHALDAFAVIKSAKRDISRPDDD
>CP028137.1|AZZ52816.1|2743753_2744344_+|MarR-family-transcriptional-regulator
MKAGRSPQRPAFCRSRTEHRLRATAAGRPRAPGAGRPSRRRILNGTQGGCVSSRRAVAAWESLFRAQVHVMRALSTDFPSKEISLNEYDVLFNLTLQPERRARLRDLNKHVLLTQPSVSRLIDRLVARGCVTKSEDPTDARGTVIQITDEGYALFRRVAMTHMQTISDHVGAALDDDELDQLTALCDKLRERVASA
>CP028137.1|AZZ52815.1|2742332_2743559_-|site-specific-integrase
MATAHDNQGRAYRPGRLSWGSIKEIRVQGKRKADGTTTRGKARFQASYLRKAPTDPAGGKRVYASGSFDTRTDALGWLDQESARTARGTIDPDRLRPAFVPQTFRQFADAYVETRRHPRNGAAIKPSTIAGYHRLIETRMRPFHALDLADVTPDLVRSWYTSETTTGRLTQAARAYGLLRAILAQAVDDGRLPKNPAAIRGASKAKTGKNVSPPTDAELAIITATIDPRFSLLIEVAAWGALRYGELTELRRGDVEFSAPGDDALAVVHVTRAVTQPTSGGFVVGTPKSSAGIRSVALPSILTPALRRHLAALHLGEEALLWPSTKDPELHLSNGAFYGFWIAAREAAGRADMPFHALRHYGLTRYARAGATTKDLMSRAGHSDVTTAMRYQHAAVERDAELAARMTE
>CP028137.1|AZZ52814.1|2741818_2742016_-|helix-turn-helix-domain-containing-protein
MSQPSLHVPELTIAQAADRLGVSDKTVRRWIAAGTLPARRLGAKIIRIRSSDLDTLGSPLRPFED
>CP028137.1|AZZ54312.1|2754260_2755835_-|aldehyde-dehydrogenase
MTLYADPVADQAPKEPESTVYANPGTEGSVASFRSRYDHFIGGEYVAPAKGQYFENITPITGKPFCEIARGTAEDIDRAVEAGWKAFPSWGKTSPAERANVLLRIADRMEANLELLAVAETWENGKPVRETLAADIPLAIDHFRYFAGALRAQEGGVSEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALAAGNCIVLKPAEQTPASIHVLMDLIHDLLPAGVLNIVNGFGIEAGAPLASHPRIRKIAFTGETTTGRLIMQYASENLIPVTLELGGKSPNVFFADVAAERDSFYEKALEGFSFFALNQGEVCTCPSRALVQKSIYDDFVGDGLERVGRIKQGNPLDVSTMIGAQASNDQLEKILSYMDIGKQEGAKLLIGGDRADLGGELSGGYYVNPTVFEGRNSMRIFQEEIFGPVLALTSFEDFDDGIAIANDTLYGLGAGVWSRNGAQLYRAGRAIEAGRVWSNTYHQYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNLLVSYAEGPMGFF
>CP028137.1|AZZ52822.1|2755953_2757246_-|transcriptional-regulator
MPRRPSASPIDDEGADEMTNPWLALPGSGRRRPLVEASWERARRHRLDPERLTAPLSFSSDELRNYRMGHPLASVLPVIRRLLVRDADEDSGVLVAVGDALGRLLWIDGDQALKSSAERMLFVEGAAWAEPDVGTSAPGTALVLDHGVQIHGAEHFASLVHPWSCTAVPIHDPETHEILGVIDITGGAEVVAPQTLPLMEATAAAVESQLMVQRLQRPRRAQPRRSPPRPAAARAPSLRVLGRETGVVTADGVELELSTRHAEILTLLAWHRAGLSAEALAQLLYGREDAVVTVRAEMVRLRRILEPRLPRLVPLSRPYRLASPVDLDARQVVGLLDRGAHRLALDAYAGAPLPGSEAPGVRAIADELRARVRATVLTSAAAETLLAYAHGPDGHDDAEVWAELLRILPRRSPRRAGIVAHLEELEAEQR
>CP028137.1|AZZ52823.1|2757254_2758223_-|EamA-family-transporter
MGSRGSAVAAILLAAVCFGTTGTAQSLGAEGVDPLMLGAARIVLGGALLAALLGVETARAPRRAARRPLASTVLLVLLGAAGVAAYQPAFFTGTAENGVAVGTIVALGSAPAFTGLLEWLLLRSAPSPRWFVSTALAAVGVVLLAGLLTGGAAGGVSVLGLAGSAGAGAAYTLYAVCGKLLLERGFSPAAAMGAQFGTAALLALPVLLVGDPGRLAGSLPAVLWLGVVTVAVAYTFFARGLRLLPAATVSTLTLVEPATATLLGVALLGERLTPDAVAGIAVLVLAVLLLAVPARRGSARRGSARRGRPEVVAPEAPSSLAE
>CP028137.1|AZZ52824.1|2758341_2759184_+|hypothetical-protein
MGIAEPFDVESYRRSAHGSLHDHFSIREFEEAPLDREAIVASAYLRALENAAVVRVLPLARAHPDPRVRSFATTWAAERHRIADALGEVLAASPRIRGVETGPAEPVVRSRVLRDRSSRLLAGPVALALAVDAQIALHAYRRLARLSLHPEMERLAETVAAILERHADFFGELAADTIGRPLRRRIVAAAVLASVRLPVGEAALPEELAREGRELVFGRDDGGLDGIDAGVVALYALPCTAARRLLRPHRTLPLRAAVQAGRVGADVVAGVRELRSLVAD
>CP028137.1|AZZ52825.1|2759231_2760233_-|LacI-family-transcriptional-regulator
MAEPTLVDVARIAGVSRATAARVLAGRTNVDAGMTAAVERAAKQLGYEANGAARMLRGGRAGSIALIVAFEDLDRLPGTILTAVLKGAAASLHAQGVQPVLLPADYDDRGRVARLLRTRAVDGAIVILQNEMTQVTQELADSPAPIAWVGRPRVALADDALVIDADNYGGGRLAARVLAESGRRRLGIITGPHDMKPARERLRGWRDELEHLGIDYAPLAHGAFTVESGVTAMVRLLQRYPDLDGIFASSDLMAHGAIHVLRAAGRRVPTDVSVVGFDDVVIATTTDPPITTIRQPLAEMGRIAAETVVAVLQGREVDRQRILPVSLVQRESA
>CP028137.1|AZZ52826.1|2760470_2761031_+|hypothetical-protein
MHGGRRLARRLGVGALAALVLVVGAGIPVYVLPAIDPVPEHADAVLVLGPPTRARTELGRDLVEAGVADTLVISVWASDLAAAPGENDVVACDEPDMDVICFTADPGTTQGEARALADDARADHWDSVVVITQTPHIARARLLLGRCFDGELSMVSSGEPYTFGDWAYEYVYQTGAFVKALADPAC
>CP028137.1|AZZ52827.1|2761056_2764512_-|helicase
MRSGRCAESVRSMARQSPPEEVLPPSAAPGAEGREPFSEQDIRGLVGTAALDKGVAYADEGRVAELQWFGGRTRLFGQVRGSGRSPYAVSVQLRDEGDHSILLGGACSCPVKHECKHVAAVLIEALRREREGALSGPFPGEAAVDAVPEWRSALAPLLAGAERSHSGIPLGLQFELLPGEPVRRPPGRYNSYRPPPEPRPRLGVRPVRMGDRDRWVRTGTSWRDLGYLHYSHDYDERQIDVVREMQGLLSGHSASSYYSPDTWLYLDQCRSEAIWAALHGAVRAGIGLVMGDRDQTPLKILDTTATASIDVTRTPAGLELRSLVAIGDHPAPEHFGFIGDPAVGLYTWDEGDELRGKAVTLVPFAAPLVSSARTFLWSNEPIRIPEQEESAFLTEHYQRLHRLFDIVSRDGSFEAPPVPEPRLGLTLEHTEGAGLRGSWWWRYGIEGGRGTEAERLPLRLDDESGYRDAEAEQRILDSLGGAGIDPESTPALVSPSSRRLRPTFDLRGMQTVGFLTGEVERLRELGTVEIEEIGQRVEYREAETAPVVAVQTVAQPDSRDWFNLEISVTVNEEAVPLAEIFLALARGDEYMVLPSGVYFALDDERFGRLRELIAEARELSDDPSETLRISRFQSSLWDELVELGVVEAQAAAWRRSVEGLSGFTATGALESRALPEGFAVELRPYQQLGYDWLSFLYDNQLGGVLADDMGLGKTVQSLALVTRVMQEQRAAAASAGTSPRPFLVVAPTSVVPNWVGEAKRFAPDLRVVGIDETSKKKRKALSTMIGEAELVVTSYALFRLDYESYAGIQWSGFLLDEAQFVKNRQSATHQLARRLDVPFKLAITGTPMENNVMELWSLLSIVAPGLFPSPAGFAEYYQKPIERDADTERLSQLRRRIRPLMLRRTKELVATELPPKQEQTIEVELGTRQRKVYDTYLARERQRVLGLIGDFEKNRFAIFRALTVLRQVALDAALVDEAHATVPSTKLDLLDELLADALAEGHRVLVFSQFTRFLGRVRGRLDAAGVEYAYLDGATKKRDEVIDRFRSGEAGVFLISLKAGGFGLNLTEADYCILLDPWWNPATESQAVDRAHRIGQTRSVMVYRLVAKDTIEEKVMALKEAKAALFAAVMSDDGAAATGGITAEDVRELLG
>CP028137.1|AZZ52828.1|2764595_2765720_+|glycosyltransferase-family-1-protein
MPRLSIVSAHTSPLEQPSTGDAGGMNVYLAGVLPELAALGWEVTVLTRGEGVRRLAPGVSVVGVPVEAADKYALAASAPAFAEAAEGADVVHSHYWVSGLAGALTGAPHVHSMHSNSLAKNVRLVPGDVREPEERIRAERSVLSSADAVVVAGASERSDVVDGYGVDPARVLVVPPGVDARFSPGAGERAREIVLLGRVQPLKGQLLAVQALARIPVGERPLLRLAGGPAPGREGYLEEVRAAARELGVDEWVRFEGVADRETAAALLRGARLALVPSAAETFGLIALEAAASATPVLARRTTGLVDAVRDGESGVLIDSGDPAVWAAEIRRLLADDAERARLGRGGVQWAAAHTWAAAAARLDALYRGLLGTR
>CP028137.1|AZZ52829.1|2765990_2766833_-|polyphosphate-glucokinase
MTQPQDGLLPRFAVGVDIGGTSIKASLVDVTTGERAARRFAVANPVGKEPEDFAAAIAGIVRDVSPIAGTPVGVGFPGIVRGGIVRQTTHVSQRWVGIDAQALLSEATGVDVVVVNDADAAGVAEREFGAMRDREGLCLLTTLGTGIGTALVYEGEVIPNSELGHVHIDGPDFEPRVGFSAVRREGITLEEWAGRLNVYYRHLEMLLSPQLFVIGGAAAHVFDEFARFLDLGTEIVSARFGNDAGFTGAAMVAVSPDRLAPWYRSTRGAHFDPGTPAIAD
>CP028137.1|AZZ52830.1|2766933_2767761_-|taurine-ABC-transporter-ATPase
MPLSAAALAALLDESLLTGAVLTGRASNLGNLRRLAAREPAHLYGVDVAEHWDVESLLALMGQRVGISTDPAFEHGQDRIDAALTVAALDAYRDRFARAVREGALILFATAHPATLLDVYRRLAAAATAASARVIDVNALPFARPDGIRVTLADEHQRLWCTGGVTCAYRGGSLQHTHSAEPMNALLDELEKLGIRPDLVVADHGWAGASGRRGLPTIAIADCNDPAVFVAEAQGSIEVVVPIDDGLAVHLYEPVIAYLLDGLDATSEPARTSGS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_8

2785384-2785467

Orphan

Consensus_repeat	Method
CCATGCTGGTCGAGTAGCCCGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_8

>merge|CP028137|8|2785384-2785467|CRISPRCasFinder
CCCTGCTGATCGAGCCGCCCGTAGCAGGCTCCGTGCTCGTCGAGACGCCCGCGGAGCGACTCGTGCTGGTCGAGTACCCCGCAG

>CP028137|8|8|2785384-2785467|CRISPRCasFinder
CCCTGCTGATCGAGCCGCCCGTA	GCAGGCTCCGTGCTCGTCGAGACGCCCGCGGAGCGAC
TCGTGCTGGTCGAGTACCCCGCAG

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ52838.1\|2780092_2780515_+\|DUF4180-domain-containing-protein	unknown	unknown	gnl\|CDD\|379371
CP028137.1\|AZZ52843.1\|2784790_2785369_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP028137.1\|AZZ52847.1\|2790182_2790524_+\|ATP-dependent-DNA-ligase	unknown	unknown	unknown
CP028137.1\|AZZ54316.1\|2783670_2784600_-\|alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176191
CP028137.1\|AZZ54315.1\|2780562_2781075_+\|YfcE-family-phosphodiesterase	unknown	unknown	gnl\|CDD\|223695
CP028137.1\|AZZ52844.1\|2785921_2787223_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367155
CP028137.1\|AZZ54317.1\|2788319_2789585_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP028137.1\|AZZ52852.1\|2795942_2796329_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ52846.1\|2789436_2789997_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP028137.1\|AZZ52845.1\|2787649_2788114_-\|DUF3817-domain-containing-protein	unknown	unknown	gnl\|CDD\|378962
CP028137.1\|AZZ52840.1\|2781957_2782404_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ52841.1\|2782400_2782760_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379011
CP028137.1\|AZZ54314.1\|2777862_2780061_+\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
CP028137.1\|AZZ52837.1\|2777432_2777795_+\|copper-chaperone	unknown	unknown	gnl\|CDD\|225328
CP028137.1\|AZZ52849.1\|2791075_2792386_-\|glycosyl-transferase-family-1	unknown	unknown	gnl\|CDD\|340838
CP028137.1\|AZZ52839.1\|2781119_2781860_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|131480
CP028137.1\|AZZ52842.1\|2782792_2783635_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223200
CP028137.1\|AZZ52848.1\|2790839_2791079_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ52850.1\|2792447_2794649_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|377950
CP028137.1\|AZZ52851.1\|2794786_2795899_-\|NAD-dependent-dehydratase	unknown	unknown	gnl\|CDD\|187652

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ52838.1\|2780092_2780515_+\|DUF4180-domain-containing-protein	gnl\|CDD\|379371	pfam13788, DUF4180, Domain of unknown function (DUF4180).	1.37454e-42
CP028137.1\|AZZ52843.1\|2784790_2785369_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.79534e-08
CP028137.1\|AZZ54316.1\|2783670_2784600_-\|alcohol-dehydrogenase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	3.70477e-71
CP028137.1\|AZZ54315.1\|2780562_2781075_+\|YfcE-family-phosphodiesterase	gnl\|CDD\|223695	COG0622, COG0622, Predicted phosphoesterase [General function prediction only].	3.74126e-36
CP028137.1\|AZZ52844.1\|2785921_2787223_+\|hypothetical-protein	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	2.44617e-15
CP028137.1\|AZZ54317.1\|2788319_2789585_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.75064e-66
CP028137.1\|AZZ52846.1\|2789436_2789997_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	7.49393e-12
CP028137.1\|AZZ52845.1\|2787649_2788114_-\|DUF3817-domain-containing-protein	gnl\|CDD\|378962	pfam12823, DUF3817, Domain of unknown function (DUF3817). This domain is of unknown function. It is sometimes found adjacent to pfam07690 and pfam03176 which are both transporter domains.	4.63547e-21
CP028137.1\|AZZ52841.1\|2782400_2782760_+\|hypothetical-protein	gnl\|CDD\|379011	pfam12993, DUF3877, Domain of unknown function, E. rectale Gene description (DUF3877). Based on Eubacterium rectale gene EUBREC_0237. As seen in gene expression experiments (http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE14737), it appears to be upregulated in the presence of Bacteroides thetaiotaomicron vs when isolated in culture.	3.141e-05
CP028137.1\|AZZ54314.1\|2777862_2780061_+\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
CP028137.1\|AZZ52837.1\|2777432_2777795_+\|copper-chaperone	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	3.95091e-11
CP028137.1\|AZZ52849.1\|2791075_2792386_-\|glycosyl-transferase-family-1	gnl\|CDD\|340838	cd03809, GT4_MtfB-like, glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.	2.28876e-23
CP028137.1\|AZZ52839.1\|2781119_2781860_+\|alpha/beta-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	1.45061e-24
CP028137.1\|AZZ52842.1\|2782792_2783635_-\|hypothetical-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	8.32711e-43
CP028137.1\|AZZ52850.1\|2792447_2794649_-\|glycoside-hydrolase	gnl\|CDD\|377950	pfam07971, Glyco_hydro_92, Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.	3.298e-93
CP028137.1\|AZZ52851.1\|2794786_2795899_-\|NAD-dependent-dehydratase	gnl\|CDD\|187652	cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs. 5beta-POR catalyzes the reduction of progesterone to 5beta-pregnane-3,20-dione in Digitalis plants. This subgroup of atypical-extended SDRs, shares the structure of an extended SDR, but has a different glycine-rich nucleotide binding motif (GXXGXXG) and lacks the YXXXK active site motif of classical and extended SDRs. Tyr-179 and Lys 147 are present in the active site, but not in the usual SDR configuration. Given these differences, it has been proposed that this subfamily represents a new SDR class. Other atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.4602e-120

>CP028137.1|AZZ52843.1|2784790_2785369_+|TetR-family-transcriptional-regulator
MTPPTLEATPPREAILAAADRLYYERGIQSVGMDALRTAAGVSLKRLYSEFPSKESLVLAVLQARHEQWTLGVRSRVAAATGARPKLLAIYDFLFDWFSEDSFRGCSFINAFGEFGSSNPAVAQLAREHKDTFQRFLAVLTEEVGGGAELAAQLALLAEGAQTTAAISGTPESALHARRAAEILIDAATRTS
>CP028137.1|AZZ54316.1|2783670_2784600_-|alcohol-dehydrogenase
MQADDFGGPEALHAVTVEPGEPGPGRVRIRVRAAGVNPADAKLLRGLFGRGRTPVRPGSEVAGVVTAVGEAATGPLGDVRVGDEVVAFRVSGGYSEELVVPAASVLPKPPGLAWEQAAGLLLTGTTAVHLLEATHVSAGDTVLIHGASGAVGSLLVQLVRERGARVIGTSSKRGAAIVERFGGESVRYGEGLVERVRALAPDGIDVALDTAGTDDALDASVELVADRSRIATVAGFERGAALGVLLLGGGAGADPGTALRDAARAPLLERAGRGALEVVLGPSFPLAEAAEALALVESGRAGGKVVLLP
>CP028137.1|AZZ52842.1|2782792_2783635_-|hypothetical-protein
MDPRPVDLDANGPFDVVGAANLLLHHSLPGVERVSDDGRRLERLVTVGSRPVPLALKLTSSGVRVTATDPAVLPLVRAWFDLDSDVEAIGAALALDPLLAPMVAARPGLRATQYPAPFEAAVMAVLGQQVSVAAARTFGGRVVTAFGSEGERGLRSFPTPEALLAGPIEELRAAIGVTRARAATVRAVAAAFADGLVLDRAGDLPEQRRLLLAIPGIGPWTADYLGLRLLGDPDAFPAGDLVLRRALGGIGTAAADAASQAWRPHRAHAAFHLWASTGAV
>CP028137.1|AZZ52841.1|2782400_2782760_+|hypothetical-protein
MNSVIRMHASPMRVRAVTPGSERRGAPTPAPTTRRTSLSIDGRRFLLALSFDTEELEKKLVEAVRERGGMVSFTVAGDREVCVLVSPGVAVILEHEDVPVDEFDPDDASVQYDDVEYLT
>CP028137.1|AZZ52840.1|2781957_2782404_+|hypothetical-protein
MTSSHDHPDSAHLRPDGLDDATVAALGKLSEALETVEHARGLLYGFHRLTGAADLALGEAVDAFREAGRDELADTLEKELVGRNVIEGRWTFQIVEDYDDGYYAAFREQERAARDELAAGRRHLFESEMKEDRRSHGLRHHESRPDPE
>CP028137.1|AZZ52839.1|2781119_2781860_+|alpha/beta-hydrolase
MIEDAVPLASRRIGDGPALVLLHPGGTDSRSLEPLVAELRSDYTLHLPDQRGHGRTADSDAPLSFAAMARDTIALIESLPGVPVHLLGHSDGAIVALHVALRRPDLVASLVFSSGVFHRDGWLPGVLDGEAPEFLRDGYAEVSPDGAAHWDVVVAKLDALHASEPELTTADLRGLAVPTLLLFGDDDEIRFEHVLAMYDAIPDAELAVVPRASHGVIVEKPDLVARLVRDFHDPGKTDGFAPIRRA
>CP028137.1|AZZ54315.1|2780562_2781075_+|YfcE-family-phosphodiesterase
MRLLLLADTHLPKRAKALPDEVWRAVDEADLVVHAGDWVDEATLDALESRAARLLAVWGNNDPAGLRARLPEVARAEIAGLDVRVVHETGPAAGREARADAAHAGADLLVFGHSHIPWDSRTASGMRLLNPGSPTDRRRQPACTYLTAVAEDGELRDVRLVALPVRVPAR
>CP028137.1|AZZ52838.1|2780092_2780515_+|DUF4180-domain-containing-protein
MRTETRQGVPLLLVDDDGPALSTSEDALAVIGEIYGSDAETIVVPVGRLDPEFFRLRSGIAGEFVQRFVMYGKRLVVVGDITEQVSASSTLHDFVVESNRGDHLWFVPALDALDARLRDSATAEEPGADGGVEPTPGPAL
>CP028137.1|AZZ54314.1|2777862_2780061_+|copper-translocating-P-type-ATPase
MTCASCVAKVERRLDALPGVRASVNLALERATVALPEGTTAADAIAAVEAAGYTATVSGAAPVADDGADDGAPSREEEAAEAERRVLRTRLTVSALLAAPVVLLSMIPALQFANWQWLCLTLAAPVAVWGAWPFHRTAWRALRHGTTTMDTLISLGTTAAFAWSVYALFLGDAGRPGMSMPFELLGTRSGHDEIYLEVAAAVPVLVLAGRWLEARSKRDAGAALRALLRLGSKEATRVAADGSEERVAAAALAVGDRLRVRPGEVVAADGTVLDGSSAVDASLLTGESVPVEVGPGSVVTGGVLNAHGVLTVRVDRVGSDTTLARMGRLVSQAQAGKARVQRLADRVSAVFVPVVVVLALATLVGWLLAGADLAAAVSPAVAVLIVACPCALGLATPTAVLVGTGRGSQLGILIRGPEVLETSRRVDTVVLDKTGTLTTGAFTVAAASDDESLRLLAAVERGSEHPLAAAIVRGAEERGLTVPEATGFRASAGFGVRARVDGRLVVAGRLRWLDEQWGYAPGDLAARAEQAAADGGTVVGIGWEGELRGFAVLRDEPRPEAARTVASLRSRGLRVLMLTGDNPRAASAVAAAVGLDEVIAEVLPEEKLAVIERLRSEGRTVAFVGDGVNDAAALAAADLGIAMGAGSDAAIEASDVTLVGDDLARVPDALRLGRRTLGVIRGNLFWAFAYNVAAIPLAMAGLLGPLVAGAAMAFSSVFVVLNSLRLRSFRAE
>CP028137.1|AZZ52837.1|2777432_2777795_+|copper-chaperone
MTAHLDLGLTAKGAAGGSGGGCGSGGACACGGHDSAHASGHGSAAGGASVQSFGVAGMTCEHCVRSVTEELAAYPEVDSIDISLLPDGVSTVTVGSSRPLGREEIAAAVADAGYRLAPLA
>CP028137.1|AZZ52844.1|2785921_2787223_+|hypothetical-protein
MSEDENAAALAEVRDCFTDAAADERAASPTRLRAAERIHRGYRVALTVPESFARGATRSETRDLVERSIRAELAVTLGVSEREVCRRLETAQMLMEHLPLTRALLRDARILWEVGEAVCRTASSLPEASRASLDERAADAALTMTTTQLRRALSRWREELHEQPLAERHARAREDRAVWITPDVDGMATLCVHASAPVVSGAYDRLRRIARSLRDDGDPRTLQQLSADAAVDLLCDGDIAGTTPNAEHRPDPTFVPGVRAEVRLTLAASTAVGLDEAPAELDGYGPVPAPIARELIRTAASFTRVLIDPETGAVVSVGRTHRVPPPQMRLHLQLRDQTCRFAGCTRPAATSEADHTLEWRNGGETSLENLVSLCTSHHHIRHGDQWTYVTSDDGTIVWTSPTGRRISNRPPALPGRPPDPPPKPRFEDVPAPF
>CP028137.1|AZZ52845.1|2787649_2788114_-|DUF3817-domain-containing-protein
MSPRRLFRILSILEAVTWTLLLVGMLLKYAVGVGDWPVSVAGPIHGFAFLAYGAAALVLAVNQRWTAGATLLALASAVVPYTTIPLERGFERRGLLEGDWRREAGADPRDRRLPSRLLRWALGRPVLAAALVLAAVAALFAALLVVGPPGGGEA
>CP028137.1|AZZ54317.1|2788319_2789585_-|serine/threonine-protein-kinase
MPIDPRVRRRIALSAVRKARIAPRTSAAPGALGAAGCRRAAGRVSATSSMHHSLDSHVARRSSHVQPRPGACPRRPQTVRMDKLVRRASEIVATEDCMLDTAPVLPLSDPLLGTTLADRYLLLERIGEGGSATVFRARDLRLARSVAVKVYREVADTPNERSRREREVRLLIDSRHSSIVEILDQGEIATEEGALAFLVLEYFDPADPAAGWFASGDERLLAEVGAQLADALAHLHARDVLHRDMKPENVLVRTRSVAAAGALHEAKLSDFGIARAVDDARLTRSDVLVGTAAYLSPESLGSGTVGPASDVYSLGLVLLEAVSGRRAYTGTTLEISLQRMHHAPVVPDSVPERWRGLLTEMTRLDPAARPSADEVARRLWSGLRDEPRVTPLRSGVHGAIAALSAVAVGVASTLALLGRLG
>CP028137.1|AZZ52846.1|2789436_2789997_+|MarR-family-transcriptional-regulator
MDEVALTRPAALRHPAAPSAPGAAEVLGAMRAFRTAESAMRRRTRGSMGMGENDLLAVQFLMRRQQGGQHVSPKDLAAYLGISSASTTVLIDRLVKSGHVLRQPHPSDRRAIRIVATPTSHREVRETLDDMNQRMLAAAEQLSPEEASAVVRFLQTVREIVEIPGEQGDVLEDDADHELTVERRRA
>CP028137.1|AZZ52847.1|2790182_2790524_+|ATP-dependent-DNA-ligase
MGSIMYGTPPAAIEVDDRTLAHLQIVIINKFRRDERFLLTLDASPNAGTGRRGVWMHPTIPLQFDFKGSRQPTINPEWIEALMERANSGAGLRIVPEPVGATAVPLRRAEPAA
>CP028137.1|AZZ52848.1|2790839_2791079_+|hypothetical-protein
MLDTTTAPRSSAGASGTDPDDVRPGDEFTAVVSDELEWWRVVAVLGIRVLAERLGSGDRHSFTLRFVRYRLAVAAEGGA
>CP028137.1|AZZ52849.1|2791075_2792386_-|glycosyl-transferase-family-1
MDQSTHAHTVQNRLVIVVRADPVICGHSVEARNLAETALERGFDEVRIVTWPIERLQAAGLPLKPLDAVLPYSDGIIVERPEPVGDYKVPDGRFLAGMVGRLVELFTDGVPTVCLSLYLSPHTLAVADALRAAWSTGLPVDVTTIAEAVGSDVTNVVRRAVEEGRLGAAAHIFASYLSQDHCVAVSEYTRDLIVEEAERIDAVHGTRFAEQCRARIEISYPAIDSDAYTGLDPAVVDEVVRARGLRTDGYVLFLSRLTEAKGVEDLIAGYERSAVHADRELVIAGRGPQEAELRRLAAASPLAHRIRFLDDVGDAEKPYLMAGCSAFVLPSKPRPEFVETFGIALAEKMLAGGGPVITTLTGGIGEAVGEHAFITPVDAPDTIAALLDHVVLELTAEDRAQRAVAAREYALQFDRRRVFDRMFARLGRPVQAGQAA
>CP028137.1|AZZ52850.1|2792447_2794649_-|glycoside-hydrolase
MIERVDPFLGTEATQLPDATGLAATWWSPKPQIGNTHPGATFPLGMVSACSYSGAYPTGYGRYDLALEGVPPTIQDGLVASGFTHFQQSGTGAIRKYYNYLRVTPMLEPLDELGRSWAIEDEVAEPGYYAATLSSGIRAELTVGPASVVHRYTFPEHRSARVVVDLSLGGLAIPSGATIPLRAQLHSVSPGVAAGEVVMEGAPLAVHLECDALQWRQMLWYDRRLMPGGTRLDFDHIRPTTLRPFGLMWAGPSTAGQTVELRMGFSLRGTERARENLHRDVPPTTGGFDQRRDRTRKTWRKRLRTIAVDTPSPERETVFATALYHSLIKPCLAPDESPFWPTDGPFVFDLSTMWDIYRTQLPLLTALLPERAVEIGAALLTICEEEGNFPIGYRMAKGSDRFSRQGSALAHTFLADLCRLGLPGIDWEAALVHMGEDLKRTYGEEFLAAGEAHPISHTLDLAHGYWCTAVVARHVGDHLLADQLEERAAQWVNAYDLRSGLLKDSTYYEGTRHNYSFRLLHDMAGRIAISGGDDAFVAQLDEFFGYGAEPVVQPGLRPDRAEMLAGAALGRFEGLNNEPDMDAPWAYHYAGRPDRTAEIVHGVLHQRFGAGRGGLPGNDDSGGLSSWYVWASLGLFPVAGQGLLLVNAPAFARASIAVGGADVELRTTGFVEPVPGGPVQYVQSAELNGAPLDASWITADELHRGGALTLHLGAEPAGWGSAPEHRPPSFPRH
>CP028137.1|AZZ52851.1|2794786_2795899_-|NAD-dependent-dehydratase
MTSAADPSTVPTPEAPTPEQRALVVGATGIGGSALVDLLTERGWPVTALSRRPIAERPGVTPLSADLRSAEDLARVLADEKPTHVFFTAWSRQATEEENIAVNGGMVRDLLAALSHAPLQHVALVTGLKHYLGPFEAYGQGAMPDTPFHEEEERLDAPNFYYAQEDELFAAAERDGFTWSVHRSHTVIGHAVGNAMNMGLTLAVAASIHRAQGTPFVFPGSLTQWNGLTDMTDSTVLAEQMLWASTSEAGRDEAFNVVNGDVFRWRWMWSRIAEHFGVEPVGPGEERQPLEQQMAGADEVWQRLVREHDLIEPDLERVASWWHTDADLGRQIEVVTDISKSRLAGFGVHHRTVDSFTALFDRYRAERLIP
>CP028137.1|AZZ52852.1|2795942_2796329_-|hypothetical-protein
MRWRCRAAAALLAAPVLLLTACALPGRAQDPALCPPVEESWNAFAADPATANREAFEAALDALQYESSTSTAVDAARSAKSALQSTLARKPVRNPSFWNALDLIAEECAEAGVGLSFDGHGEPLPAVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_9

2785695-2785785

Orphan

Consensus_repeat	Method
CCATGCTGGTCGAGTAGCCCGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_9

>merge|CP028137|9|2785695-2785785|CRISPRCasFinder
CCACGCCGGCCGAGCACCCCGCAGGGCGACCGGTCGTGCTGGTCGAGTAGCCGCCCCCGGCGGCCCTTACATGCTGGTCGAGTAGCCGCCC

>CP028137|9|9|2785695-2785785|CRISPRCasFinder
CCACGCCGGCCGAGCACCCCGCA	GGGCGACCGGTCGTGCTGGTCGAGTAGCCGCCCCCGGCGGCCCTT
ACATGCTGGTCGAGTAGCCGCCC

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ52838.1\|2780092_2780515_+\|DUF4180-domain-containing-protein	unknown	unknown	gnl\|CDD\|379371
CP028137.1\|AZZ52843.1\|2784790_2785369_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP028137.1\|AZZ52847.1\|2790182_2790524_+\|ATP-dependent-DNA-ligase	unknown	unknown	unknown
CP028137.1\|AZZ54316.1\|2783670_2784600_-\|alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176191
CP028137.1\|AZZ54315.1\|2780562_2781075_+\|YfcE-family-phosphodiesterase	unknown	unknown	gnl\|CDD\|223695
CP028137.1\|AZZ52844.1\|2785921_2787223_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367155
CP028137.1\|AZZ54317.1\|2788319_2789585_-\|serine/threonine-protein-kinase	unknown	unknown	gnl\|CDD\|270916
CP028137.1\|AZZ52852.1\|2795942_2796329_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ52846.1\|2789436_2789997_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP028137.1\|AZZ52845.1\|2787649_2788114_-\|DUF3817-domain-containing-protein	unknown	unknown	gnl\|CDD\|378962
CP028137.1\|AZZ52840.1\|2781957_2782404_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ52841.1\|2782400_2782760_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379011
CP028137.1\|AZZ54314.1\|2777862_2780061_+\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
CP028137.1\|AZZ52837.1\|2777432_2777795_+\|copper-chaperone	unknown	unknown	gnl\|CDD\|225328
CP028137.1\|AZZ52849.1\|2791075_2792386_-\|glycosyl-transferase-family-1	unknown	unknown	gnl\|CDD\|340838
CP028137.1\|AZZ52839.1\|2781119_2781860_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|131480
CP028137.1\|AZZ52842.1\|2782792_2783635_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223200
CP028137.1\|AZZ52848.1\|2790839_2791079_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ52850.1\|2792447_2794649_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|377950
CP028137.1\|AZZ52851.1\|2794786_2795899_-\|NAD-dependent-dehydratase	unknown	unknown	gnl\|CDD\|187652

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ52838.1\|2780092_2780515_+\|DUF4180-domain-containing-protein	gnl\|CDD\|379371	pfam13788, DUF4180, Domain of unknown function (DUF4180).	1.37454e-42
CP028137.1\|AZZ52843.1\|2784790_2785369_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.79534e-08
CP028137.1\|AZZ54316.1\|2783670_2784600_-\|alcohol-dehydrogenase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	3.70477e-71
CP028137.1\|AZZ54315.1\|2780562_2781075_+\|YfcE-family-phosphodiesterase	gnl\|CDD\|223695	COG0622, COG0622, Predicted phosphoesterase [General function prediction only].	3.74126e-36
CP028137.1\|AZZ52844.1\|2785921_2787223_+\|hypothetical-protein	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	2.44617e-15
CP028137.1\|AZZ54317.1\|2788319_2789585_-\|serine/threonine-protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.75064e-66
CP028137.1\|AZZ52846.1\|2789436_2789997_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	7.49393e-12
CP028137.1\|AZZ52845.1\|2787649_2788114_-\|DUF3817-domain-containing-protein	gnl\|CDD\|378962	pfam12823, DUF3817, Domain of unknown function (DUF3817). This domain is of unknown function. It is sometimes found adjacent to pfam07690 and pfam03176 which are both transporter domains.	4.63547e-21
CP028137.1\|AZZ52841.1\|2782400_2782760_+\|hypothetical-protein	gnl\|CDD\|379011	pfam12993, DUF3877, Domain of unknown function, E. rectale Gene description (DUF3877). Based on Eubacterium rectale gene EUBREC_0237. As seen in gene expression experiments (http://www.ncbi.nlm.nih.gov/geo/query/acc.cgi?acc=GSE14737), it appears to be upregulated in the presence of Bacteroides thetaiotaomicron vs when isolated in culture.	3.141e-05
CP028137.1\|AZZ54314.1\|2777862_2780061_+\|copper-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
CP028137.1\|AZZ52837.1\|2777432_2777795_+\|copper-chaperone	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	3.95091e-11
CP028137.1\|AZZ52849.1\|2791075_2792386_-\|glycosyl-transferase-family-1	gnl\|CDD\|340838	cd03809, GT4_MtfB-like, glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.	2.28876e-23
CP028137.1\|AZZ52839.1\|2781119_2781860_+\|alpha/beta-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	1.45061e-24
CP028137.1\|AZZ52842.1\|2782792_2783635_-\|hypothetical-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	8.32711e-43
CP028137.1\|AZZ52850.1\|2792447_2794649_-\|glycoside-hydrolase	gnl\|CDD\|377950	pfam07971, Glyco_hydro_92, Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.	3.298e-93
CP028137.1\|AZZ52851.1\|2794786_2795899_-\|NAD-dependent-dehydratase	gnl\|CDD\|187652	cd08948, 5beta-POR_like_SDR_a, progesterone 5-beta-reductase-like proteins (5beta-POR), atypical (a) SDRs. 5beta-POR catalyzes the reduction of progesterone to 5beta-pregnane-3,20-dione in Digitalis plants. This subgroup of atypical-extended SDRs, shares the structure of an extended SDR, but has a different glycine-rich nucleotide binding motif (GXXGXXG) and lacks the YXXXK active site motif of classical and extended SDRs. Tyr-179 and Lys 147 are present in the active site, but not in the usual SDR configuration. Given these differences, it has been proposed that this subfamily represents a new SDR class. Other atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.4602e-120

>CP028137.1|AZZ52843.1|2784790_2785369_+|TetR-family-transcriptional-regulator
MTPPTLEATPPREAILAAADRLYYERGIQSVGMDALRTAAGVSLKRLYSEFPSKESLVLAVLQARHEQWTLGVRSRVAAATGARPKLLAIYDFLFDWFSEDSFRGCSFINAFGEFGSSNPAVAQLAREHKDTFQRFLAVLTEEVGGGAELAAQLALLAEGAQTTAAISGTPESALHARRAAEILIDAATRTS
>CP028137.1|AZZ54316.1|2783670_2784600_-|alcohol-dehydrogenase
MQADDFGGPEALHAVTVEPGEPGPGRVRIRVRAAGVNPADAKLLRGLFGRGRTPVRPGSEVAGVVTAVGEAATGPLGDVRVGDEVVAFRVSGGYSEELVVPAASVLPKPPGLAWEQAAGLLLTGTTAVHLLEATHVSAGDTVLIHGASGAVGSLLVQLVRERGARVIGTSSKRGAAIVERFGGESVRYGEGLVERVRALAPDGIDVALDTAGTDDALDASVELVADRSRIATVAGFERGAALGVLLLGGGAGADPGTALRDAARAPLLERAGRGALEVVLGPSFPLAEAAEALALVESGRAGGKVVLLP
>CP028137.1|AZZ52842.1|2782792_2783635_-|hypothetical-protein
MDPRPVDLDANGPFDVVGAANLLLHHSLPGVERVSDDGRRLERLVTVGSRPVPLALKLTSSGVRVTATDPAVLPLVRAWFDLDSDVEAIGAALALDPLLAPMVAARPGLRATQYPAPFEAAVMAVLGQQVSVAAARTFGGRVVTAFGSEGERGLRSFPTPEALLAGPIEELRAAIGVTRARAATVRAVAAAFADGLVLDRAGDLPEQRRLLLAIPGIGPWTADYLGLRLLGDPDAFPAGDLVLRRALGGIGTAAADAASQAWRPHRAHAAFHLWASTGAV
>CP028137.1|AZZ52841.1|2782400_2782760_+|hypothetical-protein
MNSVIRMHASPMRVRAVTPGSERRGAPTPAPTTRRTSLSIDGRRFLLALSFDTEELEKKLVEAVRERGGMVSFTVAGDREVCVLVSPGVAVILEHEDVPVDEFDPDDASVQYDDVEYLT
>CP028137.1|AZZ52840.1|2781957_2782404_+|hypothetical-protein
MTSSHDHPDSAHLRPDGLDDATVAALGKLSEALETVEHARGLLYGFHRLTGAADLALGEAVDAFREAGRDELADTLEKELVGRNVIEGRWTFQIVEDYDDGYYAAFREQERAARDELAAGRRHLFESEMKEDRRSHGLRHHESRPDPE
>CP028137.1|AZZ52839.1|2781119_2781860_+|alpha/beta-hydrolase
MIEDAVPLASRRIGDGPALVLLHPGGTDSRSLEPLVAELRSDYTLHLPDQRGHGRTADSDAPLSFAAMARDTIALIESLPGVPVHLLGHSDGAIVALHVALRRPDLVASLVFSSGVFHRDGWLPGVLDGEAPEFLRDGYAEVSPDGAAHWDVVVAKLDALHASEPELTTADLRGLAVPTLLLFGDDDEIRFEHVLAMYDAIPDAELAVVPRASHGVIVEKPDLVARLVRDFHDPGKTDGFAPIRRA
>CP028137.1|AZZ54315.1|2780562_2781075_+|YfcE-family-phosphodiesterase
MRLLLLADTHLPKRAKALPDEVWRAVDEADLVVHAGDWVDEATLDALESRAARLLAVWGNNDPAGLRARLPEVARAEIAGLDVRVVHETGPAAGREARADAAHAGADLLVFGHSHIPWDSRTASGMRLLNPGSPTDRRRQPACTYLTAVAEDGELRDVRLVALPVRVPAR
>CP028137.1|AZZ52838.1|2780092_2780515_+|DUF4180-domain-containing-protein
MRTETRQGVPLLLVDDDGPALSTSEDALAVIGEIYGSDAETIVVPVGRLDPEFFRLRSGIAGEFVQRFVMYGKRLVVVGDITEQVSASSTLHDFVVESNRGDHLWFVPALDALDARLRDSATAEEPGADGGVEPTPGPAL
>CP028137.1|AZZ54314.1|2777862_2780061_+|copper-translocating-P-type-ATPase
MTCASCVAKVERRLDALPGVRASVNLALERATVALPEGTTAADAIAAVEAAGYTATVSGAAPVADDGADDGAPSREEEAAEAERRVLRTRLTVSALLAAPVVLLSMIPALQFANWQWLCLTLAAPVAVWGAWPFHRTAWRALRHGTTTMDTLISLGTTAAFAWSVYALFLGDAGRPGMSMPFELLGTRSGHDEIYLEVAAAVPVLVLAGRWLEARSKRDAGAALRALLRLGSKEATRVAADGSEERVAAAALAVGDRLRVRPGEVVAADGTVLDGSSAVDASLLTGESVPVEVGPGSVVTGGVLNAHGVLTVRVDRVGSDTTLARMGRLVSQAQAGKARVQRLADRVSAVFVPVVVVLALATLVGWLLAGADLAAAVSPAVAVLIVACPCALGLATPTAVLVGTGRGSQLGILIRGPEVLETSRRVDTVVLDKTGTLTTGAFTVAAASDDESLRLLAAVERGSEHPLAAAIVRGAEERGLTVPEATGFRASAGFGVRARVDGRLVVAGRLRWLDEQWGYAPGDLAARAEQAAADGGTVVGIGWEGELRGFAVLRDEPRPEAARTVASLRSRGLRVLMLTGDNPRAASAVAAAVGLDEVIAEVLPEEKLAVIERLRSEGRTVAFVGDGVNDAAALAAADLGIAMGAGSDAAIEASDVTLVGDDLARVPDALRLGRRTLGVIRGNLFWAFAYNVAAIPLAMAGLLGPLVAGAAMAFSSVFVVLNSLRLRSFRAE
>CP028137.1|AZZ52837.1|2777432_2777795_+|copper-chaperone
MTAHLDLGLTAKGAAGGSGGGCGSGGACACGGHDSAHASGHGSAAGGASVQSFGVAGMTCEHCVRSVTEELAAYPEVDSIDISLLPDGVSTVTVGSSRPLGREEIAAAVADAGYRLAPLA
>CP028137.1|AZZ52844.1|2785921_2787223_+|hypothetical-protein
MSEDENAAALAEVRDCFTDAAADERAASPTRLRAAERIHRGYRVALTVPESFARGATRSETRDLVERSIRAELAVTLGVSEREVCRRLETAQMLMEHLPLTRALLRDARILWEVGEAVCRTASSLPEASRASLDERAADAALTMTTTQLRRALSRWREELHEQPLAERHARAREDRAVWITPDVDGMATLCVHASAPVVSGAYDRLRRIARSLRDDGDPRTLQQLSADAAVDLLCDGDIAGTTPNAEHRPDPTFVPGVRAEVRLTLAASTAVGLDEAPAELDGYGPVPAPIARELIRTAASFTRVLIDPETGAVVSVGRTHRVPPPQMRLHLQLRDQTCRFAGCTRPAATSEADHTLEWRNGGETSLENLVSLCTSHHHIRHGDQWTYVTSDDGTIVWTSPTGRRISNRPPALPGRPPDPPPKPRFEDVPAPF
>CP028137.1|AZZ52845.1|2787649_2788114_-|DUF3817-domain-containing-protein
MSPRRLFRILSILEAVTWTLLLVGMLLKYAVGVGDWPVSVAGPIHGFAFLAYGAAALVLAVNQRWTAGATLLALASAVVPYTTIPLERGFERRGLLEGDWRREAGADPRDRRLPSRLLRWALGRPVLAAALVLAAVAALFAALLVVGPPGGGEA
>CP028137.1|AZZ54317.1|2788319_2789585_-|serine/threonine-protein-kinase
MPIDPRVRRRIALSAVRKARIAPRTSAAPGALGAAGCRRAAGRVSATSSMHHSLDSHVARRSSHVQPRPGACPRRPQTVRMDKLVRRASEIVATEDCMLDTAPVLPLSDPLLGTTLADRYLLLERIGEGGSATVFRARDLRLARSVAVKVYREVADTPNERSRREREVRLLIDSRHSSIVEILDQGEIATEEGALAFLVLEYFDPADPAAGWFASGDERLLAEVGAQLADALAHLHARDVLHRDMKPENVLVRTRSVAAAGALHEAKLSDFGIARAVDDARLTRSDVLVGTAAYLSPESLGSGTVGPASDVYSLGLVLLEAVSGRRAYTGTTLEISLQRMHHAPVVPDSVPERWRGLLTEMTRLDPAARPSADEVARRLWSGLRDEPRVTPLRSGVHGAIAALSAVAVGVASTLALLGRLG
>CP028137.1|AZZ52846.1|2789436_2789997_+|MarR-family-transcriptional-regulator
MDEVALTRPAALRHPAAPSAPGAAEVLGAMRAFRTAESAMRRRTRGSMGMGENDLLAVQFLMRRQQGGQHVSPKDLAAYLGISSASTTVLIDRLVKSGHVLRQPHPSDRRAIRIVATPTSHREVRETLDDMNQRMLAAAEQLSPEEASAVVRFLQTVREIVEIPGEQGDVLEDDADHELTVERRRA
>CP028137.1|AZZ52847.1|2790182_2790524_+|ATP-dependent-DNA-ligase
MGSIMYGTPPAAIEVDDRTLAHLQIVIINKFRRDERFLLTLDASPNAGTGRRGVWMHPTIPLQFDFKGSRQPTINPEWIEALMERANSGAGLRIVPEPVGATAVPLRRAEPAA
>CP028137.1|AZZ52848.1|2790839_2791079_+|hypothetical-protein
MLDTTTAPRSSAGASGTDPDDVRPGDEFTAVVSDELEWWRVVAVLGIRVLAERLGSGDRHSFTLRFVRYRLAVAAEGGA
>CP028137.1|AZZ52849.1|2791075_2792386_-|glycosyl-transferase-family-1
MDQSTHAHTVQNRLVIVVRADPVICGHSVEARNLAETALERGFDEVRIVTWPIERLQAAGLPLKPLDAVLPYSDGIIVERPEPVGDYKVPDGRFLAGMVGRLVELFTDGVPTVCLSLYLSPHTLAVADALRAAWSTGLPVDVTTIAEAVGSDVTNVVRRAVEEGRLGAAAHIFASYLSQDHCVAVSEYTRDLIVEEAERIDAVHGTRFAEQCRARIEISYPAIDSDAYTGLDPAVVDEVVRARGLRTDGYVLFLSRLTEAKGVEDLIAGYERSAVHADRELVIAGRGPQEAELRRLAAASPLAHRIRFLDDVGDAEKPYLMAGCSAFVLPSKPRPEFVETFGIALAEKMLAGGGPVITTLTGGIGEAVGEHAFITPVDAPDTIAALLDHVVLELTAEDRAQRAVAAREYALQFDRRRVFDRMFARLGRPVQAGQAA
>CP028137.1|AZZ52850.1|2792447_2794649_-|glycoside-hydrolase
MIERVDPFLGTEATQLPDATGLAATWWSPKPQIGNTHPGATFPLGMVSACSYSGAYPTGYGRYDLALEGVPPTIQDGLVASGFTHFQQSGTGAIRKYYNYLRVTPMLEPLDELGRSWAIEDEVAEPGYYAATLSSGIRAELTVGPASVVHRYTFPEHRSARVVVDLSLGGLAIPSGATIPLRAQLHSVSPGVAAGEVVMEGAPLAVHLECDALQWRQMLWYDRRLMPGGTRLDFDHIRPTTLRPFGLMWAGPSTAGQTVELRMGFSLRGTERARENLHRDVPPTTGGFDQRRDRTRKTWRKRLRTIAVDTPSPERETVFATALYHSLIKPCLAPDESPFWPTDGPFVFDLSTMWDIYRTQLPLLTALLPERAVEIGAALLTICEEEGNFPIGYRMAKGSDRFSRQGSALAHTFLADLCRLGLPGIDWEAALVHMGEDLKRTYGEEFLAAGEAHPISHTLDLAHGYWCTAVVARHVGDHLLADQLEERAAQWVNAYDLRSGLLKDSTYYEGTRHNYSFRLLHDMAGRIAISGGDDAFVAQLDEFFGYGAEPVVQPGLRPDRAEMLAGAALGRFEGLNNEPDMDAPWAYHYAGRPDRTAEIVHGVLHQRFGAGRGGLPGNDDSGGLSSWYVWASLGLFPVAGQGLLLVNAPAFARASIAVGGADVELRTTGFVEPVPGGPVQYVQSAELNGAPLDASWITADELHRGGALTLHLGAEPAGWGSAPEHRPPSFPRH
>CP028137.1|AZZ52851.1|2794786_2795899_-|NAD-dependent-dehydratase
MTSAADPSTVPTPEAPTPEQRALVVGATGIGGSALVDLLTERGWPVTALSRRPIAERPGVTPLSADLRSAEDLARVLADEKPTHVFFTAWSRQATEEENIAVNGGMVRDLLAALSHAPLQHVALVTGLKHYLGPFEAYGQGAMPDTPFHEEEERLDAPNFYYAQEDELFAAAERDGFTWSVHRSHTVIGHAVGNAMNMGLTLAVAASIHRAQGTPFVFPGSLTQWNGLTDMTDSTVLAEQMLWASTSEAGRDEAFNVVNGDVFRWRWMWSRIAEHFGVEPVGPGEERQPLEQQMAGADEVWQRLVREHDLIEPDLERVASWWHTDADLGRQIEVVTDISKSRLAGFGVHHRTVDSFTALFDRYRAERLIP
>CP028137.1|AZZ52852.1|2795942_2796329_-|hypothetical-protein
MRWRCRAAAALLAAPVLLLTACALPGRAQDPALCPPVEESWNAFAADPATANREAFEAALDALQYESSTSTAVDAARSAKSALQSTLARKPVRNPSFWNALDLIAEECAEAGVGLSFDGHGEPLPAVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_10

3234214-3234316

Orphan

Consensus_repeat	Method
GCGGCGTATCGAGACCCGGAAGCACAGCGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_10

>merge|CP028137|10|3234214-3234316|CRISPRCasFinder
GCGGCGTATCGAGACCCGGAAGCACAGCGCGCATCGCGCGCCCTTCCATGCTGGTCGAGTAGCCGCGGCACGCGGCGTATCGAGACCCGGAAGCACAGCGCGC

>CP028137|10|10|3234214-3234316|CRISPRCasFinder
GCGGCGTATCGAGACCCGGAAGCACAGCGCGC	ATCGCGCGCCCTTCCATGCTGGTCGAGTAGCCGCGGCAC
GCGGCGTATCGAGACCCGGAAGCACAGCGCGC

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ53175.1\|3229628_3230327_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ54358.1\|3242884_3243382_+\|ADP-ribose-pyrophosphatase	unknown	unknown	gnl\|CDD\|239516
CP028137.1\|AZZ53174.1\|3228691_3229480_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379379
CP028137.1\|AZZ53177.1\|3231857_3232139_+\|oligoribonuclease	unknown	unknown	unknown
CP028137.1\|AZZ53172.1\|3222690_3222924_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53171.1\|3221613_3222609_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176191
CP028137.1\|AZZ53184.1\|3238821_3240909_+\|amylo-alpha-1,6-glucosidase	unknown	unknown	gnl\|CDD\|225942
CP028137.1\|AZZ53178.1\|3232338_3233004_+\|peroxiredoxin	unknown	unknown	gnl\|CDD\|239268
CP028137.1\|AZZ54357.1\|3222990_3223425_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP028137.1\|AZZ53182.1\|3236369_3237614_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270451
CP028137.1\|AZZ53181.1\|3235244_3236354_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP028137.1\|AZZ53183.1\|3237687_3238725_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
CP028137.1\|AZZ53187.1\|3243437_3244391_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|197666
CP028137.1\|AZZ53176.1\|3230298_3231768_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366721
CP028137.1\|AZZ53186.1\|3242490_3242688_+\|DUF3073-domain-containing-protein	unknown	unknown	gnl\|CDD\|378620
CP028137.1\|AZZ53185.1\|3241232_3242336_-\|pyridine-nucleotide-disulfide-oxidoreductase	unknown	unknown	gnl\|CDD\|224983
CP028137.1\|AZZ53188.1\|3244673_3245222_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53173.1\|3225807_3228111_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|223605
CP028137.1\|AZZ53179.1\|3233123_3233960_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP028137.1\|AZZ53180.1\|3234333_3235248_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54358.1\|3242884_3243382_+\|ADP-ribose-pyrophosphatase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	4.17223e-31
CP028137.1\|AZZ53174.1\|3228691_3229480_-\|hypothetical-protein	gnl\|CDD\|379379	pfam13803, DUF4184, Domain of unknown function (DUF4184). This domain of unknown function contains several highly conserved histidines.	5.68587e-32
CP028137.1\|AZZ53182.1\|3236369_3237614_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.72671e-62
CP028137.1\|AZZ53171.1\|3221613_3222609_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176191	cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases. Members identified as zinc-dependent alcohol dehydrogenases and quinone oxidoreductase. QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.75601e-82
CP028137.1\|AZZ53186.1\|3242490_3242688_+\|DUF3073-domain-containing-protein	gnl\|CDD\|378620	pfam11273, DUF3073, Protein of unknown function (DUF3073). This family of proteins with unknown function appears to be restricted to Actinobacteria.	3.9816e-16
CP028137.1\|AZZ53183.1\|3237687_3238725_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.50216e-70
CP028137.1\|AZZ54357.1\|3222990_3223425_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	5.90373e-21
CP028137.1\|AZZ53184.1\|3238821_3240909_+\|amylo-alpha-1,6-glucosidase	gnl\|CDD\|225942	COG3408, GDB1, Glycogen debranching enzyme [Carbohydrate transport and metabolism].	4.34555e-72
CP028137.1\|AZZ53181.1\|3235244_3236354_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	1.12441e-71
CP028137.1\|AZZ53178.1\|3232338_3233004_+\|peroxiredoxin	gnl\|CDD\|239268	cd02970, PRX_like2, Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.	3.06317e-34
CP028137.1\|AZZ53176.1\|3230298_3231768_-\|hypothetical-protein	gnl\|CDD\|366721	pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.	1.48302e-38
CP028137.1\|AZZ53187.1\|3243437_3244391_+\|hypothetical-protein	gnl\|CDD\|197666	smart00342, HTH_ARAC, helix_turn_helix, arabinose operon control protein.	4.2002e-16
CP028137.1\|AZZ53185.1\|3241232_3242336_-\|pyridine-nucleotide-disulfide-oxidoreductase	gnl\|CDD\|224983	COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism].	5.96333e-32
CP028137.1\|AZZ53173.1\|3225807_3228111_+\|DNA-binding-protein	gnl\|CDD\|223605	COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism].	2.94449e-32
CP028137.1\|AZZ53179.1\|3233123_3233960_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.79048e-39
CP028137.1\|AZZ53180.1\|3234333_3235248_-\|ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.61107e-79

>CP028137.1|AZZ53179.1|3233123_3233960_+|alpha/beta-hydrolase
MAEITAHHGLFKDTDLHVDDTGGSGRPVVLIHGWPLSGESWSEQVPAFAAAGFRVITYDRRGFGRSDKPLTGYTYDTLTEDLHTLLTELDLQDVTLVGFSMGGGEVARYFSKYGTERLHSVVFASAVPPYLMKTDDNPDGPLEKSAAAEMTAGLTKDEDSFYEQFTTEFFSVNGELKVTEAQRQDALALAKQSSKHAALACMAAFAGTDFREDLPKVTVPTLVIHGDGDGTVPFEGSGARTHAAIPGSELHVVAGAPHGVNVSHAEEWNRVVLEFLKK
>CP028137.1|AZZ53178.1|3232338_3233004_+|peroxiredoxin
MPTEQTTATIGAQTADFTTGFNETIGDELATVFASEQADLVENGVPAGAVAAGERLPSATVVTEGGESVALSSLLGDGPAVLVFYRGAWCPYCNITLRHYDATLAPELASRGVAFVAVSPETPDASATLGGELGFTVVTDPGNALATELGIVTAPSDAAIEAHTALGFAVKDSNADDTPAIPFPTVLVLDAEGVVRFADVHVDYTTRTETEAILAAVDALS
>CP028137.1|AZZ53177.1|3231857_3232139_+|oligoribonuclease
MSNDIRELSEGESYLAFFQGGPFDGQTETRVSTEGGYEKSVDVYAAVDGQETHLVYTSVSAKEVGESVHVTYALDAPDSDPVEDPEDRGGGFQ
>CP028137.1|AZZ53176.1|3230298_3231768_-|hypothetical-protein
MTIGRRLFLSGAASGAGLLVLAGCTPPRPTPTRSVTEAPVPTPSTTAVPTPAAFVRSGWAEDPYALGAVSYLAVGATPEHRDDLAGNVLDRLFFAGEATDSQEPGTLQGAWNSGVRAAGEIAAIAEEGERIAIIGAGLAGAVAARRLLDAGYDVALVEARDRVGGRIATSTPDGWPIAVDSGAWALVGAGPALRESVLDAGITTSAVDLATVLSSTEDGDRPDVGDTAAKALTRALEWAAEQPTDLPLADAFAESGAPDPATVEPGSGDGDAARLAAFLAGGPVLRTGAAPAELSAWYGLGDASAASTAEDVADSSDEAAAVLTDGLAPLVETLLTDVEISLRAAVSGIGYSDTGASIRLATGESFTADRVLVTVPIGVLQSDAIAFDPPLPFAHRTAIAAIGSGVVETLWLRFDEPFWDTDPALPARWSLVGSAAGITEWLNLEPTTGEAVLVGLVGADQALSLQSLSDDELLVVAQSALTPFAVAAG
>CP028137.1|AZZ53175.1|3229628_3230327_+|hypothetical-protein
MRKAFAILRLALAGLGAVGLVGDFLYTLGFRLFQIDNFFAYFTTQSNMAGVVVLGLSGIVALAREREPRWLSTLRALVLTYMVVSGIVFGLIAVEANNRGVRVDVPWSSALLHFVIPTLALLDWLLAPGRRPVAWRGTLTVLGFPIVWGVITLVRGALIGWYPYFFLDPAQVDGPVMFVVYDVIVLGLISGIAAFMLALSRVRPLGAARATEWRGPLARLRERLSRQRRRTA
>CP028137.1|AZZ53174.1|3228691_3229480_-|hypothetical-protein
MPFTPSHAVVALAFTNSRIPAAAVAIGAMAPDIGLYLPLRWARDATHSMLGIVTVDLAVGAVGLVLWLVLLQPAWRDLAPWIVRVRLRPPPAPPSTARARTTAIVLAMVGIVIGAASHVLWDAFTHDGGPFVAALPFLREELGPFAGYKWAQYASGVLGLVGLGIGALVWYVARRPHHVAVDHRGPARVAAWTAVLAAAVVPAGVVLSGSGLDPFEEAYRSYVVDAAVLVVVWTTAALLAVAVLWHLALGVAPRQGADADPS
>CP028137.1|AZZ53173.1|3225807_3228111_+|DNA-binding-protein
MGTSLEPLARQLRKCPVTARVQRSRGGRPGGLTAPGHGVVSSLVTHEGPPSGAKASPTGADDADANELRTAKHFFIGEPLSSDKLEGQLLQKRLALPIFASDPLSSVAYAPQELLMILLLGGLSFLTFAPWVAGCVVVLLVVVVLSYRQLIKAYPSGGGDYEVARTNLGETAGLTVAAALLVDYVLTVAVSVASGVDNIISAIPALAPLRVELAILFVILLAAVNLRGVSESSKAFAVPTYLFVASVFVMVVVGLGRAAFGDAPIAESAGYTVQGEQLTQAAIVLLLLRSFASGCAALTGVEAISNGVPAFRVPKVKNAQRTLVAMGTIAIVLFVGLTALALLANVHYAENACHLVGFTDCATTPQRSVIAQVAAATFGNNTILFFVIQAATAAVLLLAANTAFNGFPLLGSVLARDGYAPKSLNTRGDRLIYSNGVIILALVAAIILLVYQASLTSLVQLYIIGVFVSFTLGQSGMVKHWIRMIKNGEGSRTVKTSLAINLFGATLTFAVLVVVTITKFTHGAWLVYLVMPILGVLMAGVYRYYRDVEKEIEVDPTTTFGANGDHAVVLVGRMNKPTLKALDYAIAARHESLEAVHSSIDDAQTAQLKADWARMDIEVPLRCIASPYRDISYPLIKYIKAHRLEHGSEIITVYMPQYIVGHWWEGFLHNHKSRRIRQKLLLVHGVTVALVPWLLDSSELIYGRRSRPIPGQSRRGEPVRPVTRRPIPPASVLPKGAAGEGAPRSGSRTAAATRPKKPAGKGGGKRR
>CP028137.1|AZZ54357.1|3222990_3223425_+|MarR-family-transcriptional-regulator
MDTDPLALQNQVCFSLAVAARTVIGLYRPVLEPLGLTHPQYLVMLALWERAPRSLADLGAALHLEPATLSPLVKRLESAGCVTRARSTEDERRLDVALTPSGAALRERALQVPPQIVERLDLPLDELTAVRDALTRLIGAATRP
>CP028137.1|AZZ53172.1|3222690_3222924_-|hypothetical-protein
MAKPTRSLYQRFNARLFPWLGPPPLGPYDQPEPEAPAGRACPLCGRLMSEHVIDRSGPRTQLYCPGTDPAADPGTAA
>CP028137.1|AZZ53171.1|3221613_3222609_-|NADP-dependent-oxidoreductase
MSRLRSDSARAVQFSRFGGVDVLEIADIARPQPGLGEVLVEVLAAGVNHMEAFIRRGMFDSDHSAAFPMRQGTDFSGIVVGLGEGVSDLKLRSDVVGHALVGSHATHIVVPRENLVAKPASVSWEVGGALFLAGVTAWRAIEATHIGPDDTVVVSAAAGGVGSMEIQLAKLRGATVLGTCGERNFDYLRQIGVKPIVYGDGIADRIRAAAPNGVTVFLDNFGGDNAALAEELGIEPARFHSSDDRKEIELRAVWPDAETARRDTEILGELVALVRDQKLRVLVSGFYPYGFVQDAFDDLEKRHSRGKIVLGMNPVDAGRVTKARDIHEAGA
>CP028137.1|AZZ53180.1|3234333_3235248_-|ABC-transporter-permease
MSTLVDSAPRTEAEPPPQAPLPHRRVQLGARGRASLIGGYLLLIGLALVYIYPFLISVASSFKTDADATSNPLSLLPATWSFASYERLFTDVPLPLWTLNSVIVTVFVTVGRVFFDSLAGYALSRLRFRGRGLLFALFIGVMSVPAVVLLIPRFLILKQLGLYDSYAGMIVPLIVDAAGIFIMKQFFDSIPLSIEEAARIDGAGVFRTFRSIVVPMARPAIVTLFILSFQGSWNEFSHFVVSRQSPELNTLTTGVASLVSGQLGTGNQYPLQLAAAVLMSIPVAVLFFVFQRRIMNTTEGAEKG
>CP028137.1|AZZ53181.1|3235244_3236354_-|sugar-ABC-transporter-permease
MSTATATRSRRSGIRGNEARYGWLFTLPAILVVGVFLVVPIALALWVSVSNWNGLGSPLGPTAEFVGTDNYRAVLLDSGLAQKDFGTAIRNNVYYVLLVVPLQTALALFLAVQVNRRVLRGRGFFRTAFYFPSVTSSIAITVIFLFLFSASGVVNAVLGWFGADGPTWMADPTGVLHSLLGLVGVDGAWFAGGAPLGLTWWDWLSGPSVAMCVLITMAIFTTSGTFMLLFLAALQNIGAEIDEAALMDGAGPLRKFFSVTLPMLKPTLFTVLTLGLIGTWQVFDQIYLTGGGAPGKTLLTPAYLAYESSFTDLRWGQGAAIAFILFFIIVVLTLLQRAILREKGEPSARRTRRAARADAATTLTTGGVR
>CP028137.1|AZZ53182.1|3236369_3237614_-|ABC-transporter-substrate-binding-protein
MTHSTRTARWGAAILAGGLALSLGACSSGGGGGADDSAGLTVMIGSSGDAETTAVTDAVNSWGEANDTAVDVVAASDLTQQLGQGFSGGNPPDLFYMSWDQFQTYASNRYLEPYAQDADDADAFYPALRDAFTYDDQFYCEPKDFSTLGLVINTDLWAAAGLTDADVPTDWASLQSAAQKLTANGVTGLSFGPEYARIGTFMNQAGGSLLSEDGTTVTADTPENVAGLTEVKTLLSDGVLKFPADLDSGWSGEAFGKGAAAMVIEGPWINGALEADYPDVNYTVAELPAGPGGKSTFTFSNCWGIPAGSTTADQAESLVASLTSDEQQLAFSDAFGVIPSTESGAAEYASKYPENAAFVTGNDYAVSPVAFAGAATVITDFNSALEGLASGDPEAILADLQTNLQDALDTANAK
>CP028137.1|AZZ53183.1|3237687_3238725_-|LacI-family-transcriptional-regulator
MALPTVEDVARAAGVSRQTVSNVLNSPQIVRESTRERVEKAIGDLNYRPHASARRLRTRKSGTIGVRMDRVLDGVSGSLLDRFLHAVTEQADARGMRILLYTAASPEEEIERIGKLRDGADVDAFVLTSTFYGDQRTAWLIEQGVPFVTFGRPWGLDDQGDPQHLWVDVDGAAGVAQATAHLADEGCSRIAFFGWPDGSATGDDRRSGWERVMAERFAGVPLLVAEAEDDVQRARSAAIAFLEAHSEVDGLVCVSDSLALGASMAAVAVGRPSLAIVGFDNTPVAGAVGLSSVEQDLGAVAAGALELLLGEQGDDVVHRPLAPGEAHRLITPHLVVRTPLHHSES
>CP028137.1|AZZ53184.1|3238821_3240909_+|amylo-alpha-1,6-glucosidase
MLPAATALSTGRTLQYRRSSEESTVTTDHDDHPRPPRQPLLNDAVVLLRAPTQLWSDDAGELGALPAHGLYHGDVRVLAGLRLLVGGEPLESIAVGRDGASSARFTALARHLDDDAADPRLRVVRLRTVTAGGLEERIRLESALPDAVTTTVELALDPDFSLVHVVKAGLRDETAVAPAVDGSSLVWTHAGARAEVRAEGAAVSPGGTLSWDVVVPARGSVEVAWSIVMTDSAAVVGAAPGPAEWADAVVEAGDSRLASWCRAALDDLDALRMVTLERPDEPFLAAGAPWFFTLFGRDSIWAARMLLPLGTELAASTLRVLAGLQGTEHVAETAEQPGKIMHELRSTTLEIPGEGVSLPPLYFGTVDATALWVCLLHDAWRWGLADEEVEALLPALEAALRWLRDEGDSDGDGFLEYVDTTGHGLANQGWKDSGDSIQWRDGSLADGPIALCEVQAYAHEAAVGGAALLEYFGRDGAEWRAYAAALKDRFTGAFWIDDADGGHPAIALDAAKRPVDTVTSNIGHLLGTGILQPEQAARVAQLLGSPELDSGYGLRTLSTDSGGYWPLSYHGGSVWAHDTAIAVTGLAREGFGAEATALSRGLLAAAEGFGYRMPELHSGDAAAEVAAPVPYPAACRPQAWSAAASIAVLSAALGLAPGGSTLVVAPITPPLAGSIRVDGIRYRGSVVPIDWRDAH
>CP028137.1|AZZ53185.1|3241232_3242336_-|pyridine-nucleotide-disulfide-oxidoreductase
MGSTVDSALDPRPVVVVGAGQAGLSVAYYLRRLGLRPGVDFVVLDRGPRAGGAWQFRWEALRLGSAHRVHDLPGMDRLGLSFATADRRRPARDVVTEYYEAYESAYELAVRRPVAVRGVSSATIGDRTAPLVVETDAGSERARILVNATGTWGSPFLPYYPGRERFEGVQIDTTEYLRAADFAGQQVIVVGGGTSAIGFLLELERVARSLTWATRRPVVYRDGEQLALESAVEAVAEQDRAARAGRALPSIVGGTGVQRTRRVVAGIERGVLHERGMFSSIEPHGVRWPDGSYTRADAIIWATGFRPELRHLAPLGLREREGGVAVEDGASLTDPRVFFAGYGPTASTIGANRSGRRIARAVVARLS
>CP028137.1|AZZ53186.1|3242490_3242688_+|DUF3073-domain-containing-protein
MGRGRQKAKNTKIARELKSFSPTVDYSALERELSHPDEPDYSKWIDDEDEGDDTDLVEEQHQKRA
>CP028137.1|AZZ54358.1|3242884_3243382_+|ADP-ribose-pyrophosphatase
MRVREDEVRWPGGVEGVYSVVERADYALIVPRERDGFWLVEQYRYPIGRRTWEFPSGGWPHDSPGGDAEALARAELREETGLRAGRLRPLGRLSEADGFVAQSFDVFLAEDLEHGEPEREETEQDMRQQWFPDAEVAAMVRSGAIVGTSDVAALGLFWLDRGLGS
>CP028137.1|AZZ53187.1|3243437_3244391_+|hypothetical-protein
MKPASAPSPVWHSETRGRDLDEARAFYSRGYNGSGFRAEHTRIPFAYRYASTGPGPVSLHAASFLGSVRGTVEPTGVYVVLWLNDGRASLDLGRDENRLVAGRPAMFPSGRPFGFETSEYRDALVHFDSAYLERAAAERHGTAPGPIRFAPLAHSPAPWWAAVRVLRDTLTGVKAPSSLQRESASQVAAAAVLQAFAHRVVPLPSAPHSVSARRLRRAVEFVHANADLPLGVADIADAAGLTVRGVQLAFQRAYSMTPRQYLRGVRLDLAHDELVAGGPQTLVVGDVAAHWGFISGGRFAQHYTQRFGELPSETLRR
>CP028137.1|AZZ53188.1|3244673_3245222_+|hypothetical-protein
MFEPEGSARPVARIMSVTAALLIGAVLVGGAVGAAVALALYLPSALAAGALDPSALVGFGMLMGVASGAGLGAVGGLGAIAGMVTVRAMSRRSGAFIAGTSVGAAFGVLILAANLLVSRDAATWITALLATAAAFLLCAWGSWLLTRREHSWERAHAPERRRPAAQPAAPGAPSPASRHRPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_11

3723422-3723553

Orphan

Consensus_repeat	Method
GCGTGCCCGAGGTGGCGGCGGGTGTGCTCCGGCTCGTGGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_11

>merge|CP028137|11|3723422-3723553|CRISPRCasFinder
GCGTGCCCGAGGTGGCGGCGGGTGTGCTCCGGCTCGTGGAGTGCGCTCGGGCTCGCGGGATTCGGGCGGATCGACGTGCCGGAGGGCTAATGGCGTGCCCGAGGTGGTGGCGGGTGTGCTCCGGCTCGTGGA

>CP028137|11|11|3723422-3723553|CRISPRCasFinder
GCGTGCCCGAGGTGGCGGCGGGTGTGCTCCGGCTCGTGGA	GTGCGCTCGGGCTCGCGGGATTCGGGCGGATCGACGTGCCGGAGGGCTAATG
GCGTGCCCGAGGTGGTGGCGGGTGTGCTCCGGCTCGTGGA

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ53555.1\|3716812_3717370_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53570.1\|3727999_3728575_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380054
CP028137.1\|AZZ53562.1\|3722054_3722687_-\|lysine-transporter-LysE	unknown	unknown	gnl\|CDD\|224199
CP028137.1\|AZZ53569.1\|3727372_3727693_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53556.1\|3717574_3717859_-\|DUF1905-domain-containing-protein	unknown	unknown	gnl\|CDD\|378097
CP028137.1\|AZZ53566.1\|3724854_3725775_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223730
CP028137.1\|AZZ54393.1\|3719010_3719766_-\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|235546
CP028137.1\|AZZ53573.1\|3731194_3732676_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|184957
CP028137.1\|AZZ53561.1\|3720972_3721401_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53571.1\|3728575_3729595_-\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|235506
CP028137.1\|AZZ53559.1\|3719840_3720416_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP028137.1\|AZZ53558.1\|3718488_3718722_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53568.1\|3726429_3727284_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|366166
CP028137.1\|AZZ53572.1\|3729906_3730254_+\|Lsr2-family-protein	unknown	unknown	gnl\|CDD\|378714
CP028137.1\|AZZ53557.1\|3717969_3718563_-\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
CP028137.1\|AZZ53567.1\|3725847_3726345_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378696
CP028137.1\|AZZ53560.1\|3720443_3720794_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53565.1\|3724540_3724762_-\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53564.1\|3723641_3724418_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133381
CP028137.1\|AZZ53563.1\|3722732_3723254_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ53562.1\|3722054_3722687_-\|lysine-transporter-LysE	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	1.78916e-38
CP028137.1\|AZZ53572.1\|3729906_3730254_+\|Lsr2-family-protein	gnl\|CDD\|378714	pfam11774, Lsr2, Lsr2. Lsr2 is a small, basic DNA-bridging protein present in Mycobacterium and related actinomycetes. It is a functional homolog of the H-NS-like proteins. H-NS proteins play a role in nucleoid organisation and also function as a pleiotropic regulator of gene expression.	3.4657e-32
CP028137.1\|AZZ53568.1\|3726429_3727284_+\|alpha/beta-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	2.32356e-30
CP028137.1\|AZZ53566.1\|3724854_3725775_+\|hypothetical-protein	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	1.06561e-37
CP028137.1\|AZZ53556.1\|3717574_3717859_-\|DUF1905-domain-containing-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	2.7464e-20
CP028137.1\|AZZ54393.1\|3719010_3719766_-\|short-chain-dehydrogenase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	1.08651e-71
CP028137.1\|AZZ53573.1\|3731194_3732676_+\|MFS-transporter	gnl\|CDD\|184957	PRK14995, PRK14995, SmvA family efflux MFS transporter.	1.06359e-34
CP028137.1\|AZZ53571.1\|3728575_3729595_-\|short-chain-dehydrogenase	gnl\|CDD\|235506	PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	2.71918e-63
CP028137.1\|AZZ53559.1\|3719840_3720416_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	5.01668e-13
CP028137.1\|AZZ53570.1\|3727999_3728575_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|380054	pfam17920, TetR_C_16, Tetracyclin repressor-like, C-terminal domain. TetR family regulators are involved in the transcriptional control of multidrug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. The TetR proteins identified in overm ultiple genera of bacteria and archaea share a common helix-turn-helix (HTH) structure in their DNA-binding domain. However, TetR proteins can work in different ways: they can bind a target operator directly to exert their effect (e.g. TetR binds Tet(A) gene to repress it in the absence of tetracycline), or they can be involved in complex regulatory cascades in which the TetR protein can either be modulated by another regulator or TetR can trigger the cellular response. This entry represents the C-terminal domain found in a number of different TetR transcription regulator proteins found in Actinobacteria. TetR regulates the expression of the membrane-associated tetracycline resistance protein, TetA, which exports the tetracycline antibiotic out of the cell before it can attach to the ribosomes and inhibit protein synthesis. TetR blocks transcription from the genes encoding both TetA and TetR in the absence of antibiotic. The C-terminal domain is multi-helical and is interlocked in the homodimer with the helix-turn-helix (HTH) DNA-binding domain.	1.58759e-16
CP028137.1\|AZZ53557.1\|3717969_3718563_-\|N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.58778e-16
CP028137.1\|AZZ53567.1\|3725847_3726345_-\|hypothetical-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	1.8488e-15
CP028137.1\|AZZ53564.1\|3723641_3724418_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133381	cd01106, HTH_TipAL-Mta, Helix-Turn-Helix DNA binding domain of the transcription regulators TipAL, Mta, and SkgA. Helix-turn-helix (HTH) TipAL, Mta, and SkgA transcription regulators, and related proteins, N-terminal domain. TipAL regulates resistance to and activation by numerous cyclic thiopeptide antibiotics, such as thiostrepton. Mta is a global transcriptional regulator; the N-terminal DNA-binding domain of Mta interacts directly with the promoters of mta, bmr, blt, and ydfK, and induces transcription of these multidrug-efflux transport genes. SkgA has been shown to control stationary-phase expression of catalase-peroxidase in Caulobacter crescentus. These proteins are comprised of distinct domains that harbor an N-terminal active (DNA-binding) site and a regulatory (effector-binding) site. The conserved N-terminal domain of these transcription regulators contains winged HTH motifs that mediate DNA binding. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. Unique to this family, is a TipAL-like, lineage specific Bacilli subgroup, which has five conserved cysteines in the C-terminus of the protein.	1.00422e-31

>CP028137.1|AZZ53563.1|3722732_3723254_-|hypothetical-protein
MLTLLPPISEPWTVTGLGRTDDGPLDEVLIAVDRGTQEHRFTIRTMRRTGTRLGPRGSVHGTVTDSVATASLAVGCLLLDVLPTDLPTQEARAAMRATEERAQALARDRDGWDVTALPLDGVGYALFTRSIPEGTVAHSDLGWATVAMWSRGPLLDGPFRLADVEPGDDLGEH
>CP028137.1|AZZ53562.1|3722054_3722687_-|lysine-transporter-LysE
MISPEHFLAFALASVALIVVPGPSVLFTISRSIAYGRRAGVLSLLGNALGIMPAIFAVAFGVGAVVAASVVAFTVLKLAGAVYLVWLGVQAIRHRHAHAGTAATAPASSWTLLRQGFVVGLTNPKTVAFFVAVLPQFVDPAAGPVWAQLLLLGFTFQALALICDSVWALAAGTARSWFASSPKRMSTVTGTGGVMMIGLGGTLALTGSKS
>CP028137.1|AZZ53561.1|3720972_3721401_-|hypothetical-protein
MLANDAEVWAEAAPAATAPAVEPTFSPAGAVYRHGYWGPIEDPTTALPIQWRDGGRSFVITTGGSGQCLNEPVLLEALAPDRLRIETRLQSDPEGIGCRESFVLASYVIDTPAGIDPARTVEFERTSADRAGTSSLHLDPLP
>CP028137.1|AZZ53560.1|3720443_3720794_-|hypothetical-protein
MSERAQALLLARPWTLAVLSGVFVAMIVVLAADVGWDPAAVVGGGRRHAPLWLVAGIGLPFFGTGVVVGVVKQIGLVRRRRRAPVSPSPEVERLRREGPGWLSRREDEARSRRRAP
>CP028137.1|AZZ53559.1|3719840_3720416_+|TetR/AcrR-family-transcriptional-regulator
MSSTPSPKVRRRPARERAVATADRLFYEQGIHGVGVDLIAAEAGISKASLYTHFRTKDDLVVAYLGGRSAAWQAHVATELPGRGRTASERLLAVFDLLGEWFSEPGYHGCPFINAEAEYGEGHVSHAVTLRHREWVRDLFTGLLRDAGVEDADAAALELCLLYDGAMAGAQADPARPWAAAARRAAGRLLG
>CP028137.1|AZZ54393.1|3719010_3719766_-|short-chain-dehydrogenase
MTDQQKTDQQKTALVTGATSGIGRAAAEQLASRGLHVLVSGRSAERGEAVVQGIRSAGGTADFLLADLRDEASARDLAGRATAVTGRVDVLVNSAGVFPFGPTAETTEEGFDDVFALNVKAPYFLVAALAPAMAERGEGAVVNVTTMVAEFGAAGMALYGASKAALVLLTKSWAAEFGSAGVRVNAVSPGPTRTEGTAAMGEALDQLAAAGPAGRPGKASEVAEAIVFLATDAASFVHGAVLPVDGGRIAV
>CP028137.1|AZZ53558.1|3718488_3718722_+|hypothetical-protein
MEQEPLGRLDRARLRAVALIVPAVHRASLSRGAAGVEELAGRCLPIEGAEGRCLPVEQAEGRFLPIEEAAGPVMLVE
>CP028137.1|AZZ53557.1|3717969_3718563_-|N-acetyltransferase
MDGGDDQRDGAEPSPVETTERLLLHRPAETDLDELFALYSDPRLAEGDPLLLHPTRAHTRAVLDRRREQWARDGLSSWVVRERNPRGGGGLIGVGGCSLLAGTAWNVAFTLHPDHWDKGYAQEIATAGIGRARLLRPELPITAVVVEQNRRSHRAVERLGLVRAWAGTDAHSPDPTARVVLYADRPLSAERIDRLTS
>CP028137.1|AZZ53556.1|3717574_3717859_-|DUF1905-domain-containing-protein
MNGVGPLDVAFTAPIGVTVKGDLWSCVEVPDSAALFGTGKAVKVVATVDGEPLTAGLMPTGAGGHMLSISAKLRKKLGKDLGDEVAVHLTERLT
>CP028137.1|AZZ53555.1|3716812_3717370_+|hypothetical-protein
MLLGLLTGCATGPTAGVDEQILGAEELGDAAVGAAESLHPVLIGADLRVSVRGGKPSARHDDERWVELFLRLVPQGTGPGASGEIQEAIESELLADGWVPDELARDAAETGEGAELWFTRPGAEGTATWDGDSPGDWHVSVWDRLDYVQIDIQSPFALTTGTQYATADNVEARHPEWRSPDGVLP
>CP028137.1|AZZ53564.1|3723641_3724418_-|MerR-family-transcriptional-regulator
MEHEGPTREWSAHEVARLAGTTSRTLRHYGAEGLLPPSRLGANGYRYYDAAALVTLQRILLLRDLGVGLSEIGRILRRDTEPAVALERHLDVLREERRRLDRRIRAVTGTVAAMREGNGPMAEEMFDGFDHAEHREEVERRWGAPAYADGDRWWRSMTAEEREQWLRRQADLAGAWTAAAASGADPAGEEALALAERQRAWLADVPGTPRDASGAPSDEYLLGLGELYVADERFAAHYGGVAGARFVRDALRALVERG
>CP028137.1|AZZ53565.1|3724540_3724762_-|hypothetical-protein
MRRHLAAGGGTLADAVAFWHASRSSEPRPIDPQFELNRFTRAWHAGHPDGDRAGLRAAWQEYRALPADARPRA
>CP028137.1|AZZ53566.1|3724854_3725775_+|hypothetical-protein
MTIRRPLSPLFWALAQIGSRVRVGAPRGLPEPSTRLPAPTGLRIPTRHGVVRAVVQRPAVDDPDAPVVLQLHGGGFVNRYPEQDLHIARAMADRLGAVVVLPDYDTGPRVQYPVAEEEACDIARWLQAETGAGWSGDRLLLGGVSAGAKLAINICQQLHAASLPAPLAVALVVPVTDVIRTDRTSGVRRPAISPFVQRFVGWAYFPDVPRQQEPLASPSRDLALPAAMPPTLVLTGGDDTLAPEGAELAARLRSGGVRTEHHVFVGSDHDLLAGRDRAVVIEALDRITGFFARELGRPRPDGLTAG
>CP028137.1|AZZ53567.1|3725847_3726345_-|hypothetical-protein
MDRDEELLLAVLNSAPVVDGRPTDDLGDASGRELARRWGGVGTEHELERLRGARDALQVVVRSGAPSAVAELSGVIADAVRTPRVTAEGVEWELSAPEADRLAVEAVLAWSSVSARFPGRLRACANDECNLFLLDHSRPGTAKWCSMATCGNRMKARAHASRSRG
>CP028137.1|AZZ53568.1|3726429_3727284_+|alpha/beta-hydrolase
MVTVHHRTVSAGGLDVFWREAGPVDAPVLLLLHGYPSSSHMFRHLIPALAGRYRVIAPDLIGFGRSSAPSVDDFDYTFAALAETTGRFLETIGVSRYTIYVQDYGAPVGWRLALADPAAVVAVISQNGNAYEEGFVPGFWDPIWADAAERTDATRDALRPALGREAVEWQYTHGVPDASTVDPDAWEHDLALLARPGQDDVQLALFRDYAANRELYPAVQAWLRTSRVPVLAVWGRNDEIFAAAGAQAFTRDAPHAQVELVDGGHFLLESDLDRVVGAVTGWLE
>CP028137.1|AZZ53569.1|3727372_3727693_+|hypothetical-protein
MKETGTARRTGRGWTRASLVLGVLAVVSYAIGYLAVAHLWRGDPLVIGIATTLQYVLPLAGVVVGHVARRREGPRRESTVGLVLSYLLLAVAVVPVVIGSFGLLAR
>CP028137.1|AZZ53570.1|3727999_3728575_+|TetR-family-transcriptional-regulator
MPRRSPAALSASIRAAGERLFRERGYSRVTVREIAAEAQVDPAVVVRRFGSKEALFLDVMQVSIQDRPELDVPLRDFGRSFVASLLADERDTQSVFLALVRGGSEPAIGARLHAVHEEAFVAPLRARMTGPDADLRARLAAALVGGLLHSMWVVGDEVLLATDHEQIVERYGDALQGLLTPADRSGPPASA
>CP028137.1|AZZ53571.1|3728575_3729595_-|short-chain-dehydrogenase
MSTTAPLTAQSSIGEWLNHPEGSALIRDVLGGAAGGFDEAKLAPVRSLPLQQLVALSQGQLPQSVVDDLVLRANGGVMPEAVESTGWRESVVAGRFAGRTVIVTGAASGIGRATASRIAREGGRVVAVDISAERLQEFAASLPDAEIVPVAGDITKQDDIDAIVAAAGERIDGLANIAGINDDFSPAHETSDAVWDRVIAINLTGGFKLSRAVLPAMLAAAAGSIVNVASEAGLRGNASGNAYTVSKHGVVGLTRSAAFMYAGSGIRVNAVAPGGVATGIPFPPNVSETGSARLAPFQSAIPSVASAEQLAASITFLLSDDGVNINGAILPSDGGWSVQ
>CP028137.1|AZZ53572.1|3729906_3730254_+|Lsr2-family-protein
MVSQVVLVDDLTGAPIAAGRGGTVSFSVGDDAYEIDLSAANIGHLHRALAPFVDAARPLSEAPSRSRVTSIAASAGRKSPEMLAAIRHWARRHGYEVPRSGRVPSDVQAAYDAAH
>CP028137.1|AZZ53573.1|3731194_3732676_+|MFS-transporter
MVLDTPRSAPRDTAPRRLRDAWIALAGLSAVFLFEMLDNSVLNVALPTLGRELHASTAGLQWVTGAYSVAFGGLMLLFGAIADRFGRRRVMLAGLVLLAAASLATAAVTTTEQLIAVRAVMGVAAAMTTPGSMALAFRLFGTDDLRVRALTVVSTAGLVGLAVGPTAGGLVLAVAPWQVLLLANVPIAVLALIGIRLGVPADAPGDLHRDPIDVVGALLGTVTIAAALVAPTLFVGTGSTGTDGAGTGTGPWAPWAAVATAVLAGAGFVLRQRSARHPLLDLRLVALPLVSSGLAFKAATGLAVGGLSYLVTIQLQLAWGWSPAAAALGLLPQVVVLLAGGRFVGPFVTRVGFERAAALSAGAVVAGLAVFGLLGRLGYGWVLIALVLVAAGMRVVGVVAGTNVLRGLPAERTSVGAALVDTASELATAVGIAAGGTILSALVAGSITSARATAAGAEQLSGAVGVAGLVMAGLAAALVALGVLRARTSPSEQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP028137_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP028137_12

3784683-3784821

Orphan

Consensus_repeat	Method
TTCCGCGTGCCGGAGGTGGCCGGGACGGAGGTCCGGCTCGCGGTTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP028137_12

>merge|CP028137|12|3784683-3784821|CRISPRCasFinder
TTCCGCGTGCCGGAGGTGGCCGGGACGGAGGTCCGGCTCGCGGTTCCGTCTCGGGCTCGTGGATTCGGCTGGTTCCGGCGTGCCGGACCTGATTCCGCGTGCCGGAGGTGGCTGGGACGGAGGTCCGGCTCGCGGTTCC

>CP028137|12|12|3784683-3784821|CRISPRCasFinder
TTCCGCGTGCCGGAGGTGGCCGGGACGGAGGTCCGGCTCGCGGTTCC	GTCTCGGGCTCGTGGATTCGGCTGGTTCCGGCGTGCCGGACCTGA
TTCCGCGTGCCGGAGGTGGCTGGGACGGAGGTCCGGCTCGCGGTTCC

Protein	Signature genes	Signature genes Name	Protein_function
CP028137.1\|AZZ54398.1\|3796219_3797011_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224048
CP028137.1\|AZZ53620.1\|3788619_3789078_+\|cytidine-deaminase	unknown	unknown	gnl\|CDD\|235875
CP028137.1\|AZZ53609.1\|3772533_3773454_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP028137.1\|AZZ53624.1\|3793414_3794464_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
CP028137.1\|AZZ53614.1\|3779656_3780091_-\|glyoxalase	unknown	unknown	gnl\|CDD\|226134
CP028137.1\|AZZ54397.1\|3794486_3796175_+\|peptide-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521
CP028137.1\|AZZ53618.1\|3786213_3786954_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
CP028137.1\|AZZ53611.1\|3774886_3776917_+\|hypothetical-protein	unknown	unknown	unknown
CP028137.1\|AZZ53613.1\|3778994_3779651_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|334619
CP028137.1\|AZZ54396.1\|3781194_3782505_+\|sugar-binding-protein	unknown	unknown	gnl\|CDD\|224567
CP028137.1\|AZZ53623.1\|3791740_3793354_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173853
CP028137.1\|AZZ53615.1\|3782648_3783686_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
CP028137.1\|AZZ53612.1\|3777483_3778266_-\|aquaporin-Z	unknown	unknown	gnl\|CDD\|235453
CP028137.1\|AZZ53616.1\|3783682_3784591_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223472
CP028137.1\|AZZ53617.1\|3785091_3786120_+\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
CP028137.1\|AZZ53619.1\|3787816_3788578_+\|amidohydrolase	unknown	unknown	gnl\|CDD\|225070
CP028137.1\|AZZ53621.1\|3789666_3790272_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
CP028137.1\|AZZ53622.1\|3790264_3791656_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238625
CP028137.1\|AZZ53610.1\|3773456_3774557_+\|glycosidase	unknown	unknown	gnl\|CDD\|350126
CP028137.1\|AZZ53608.1\|3771580_3772537_+\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096

Protein	Function_ID	Function_description	E-value
CP028137.1\|AZZ54398.1\|3796219_3797011_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224048	COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only].	9.69334e-93
CP028137.1\|AZZ53620.1\|3788619_3789078_+\|cytidine-deaminase	gnl\|CDD\|235875	PRK06848, PRK06848, cytidine deaminase.	6.13552e-26
CP028137.1\|AZZ53609.1\|3772533_3773454_+\|sugar-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	4.95461e-72
CP028137.1\|AZZ53624.1\|3793414_3794464_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	4.48948e-76
CP028137.1\|AZZ53614.1\|3779656_3780091_-\|glyoxalase	gnl\|CDD\|226134	COG3607, COG3607, Predicted lactoylglutathione lyase [General function prediction only].	1.8076e-44
CP028137.1\|AZZ54397.1\|3794486_3796175_+\|peptide-ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	8.44075e-91
CP028137.1\|AZZ53618.1\|3786213_3786954_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	1.38808e-47
CP028137.1\|AZZ53613.1\|3778994_3779651_-\|transcriptional-regulator	gnl\|CDD\|334619	pfam01638, HxlR, HxlR-like helix-turn-helix. HxlR, a member of this family, is a DNA-binding protein that acts as a positive regulator of the formaldehyde-inducible hxlAB operon in Bacillus subtilis.	1.18868e-22
CP028137.1\|AZZ54396.1\|3781194_3782505_+\|sugar-binding-protein	gnl\|CDD\|224567	COG1653, UgpB, ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism].	9.78697e-26
CP028137.1\|AZZ53623.1\|3791740_3793354_+\|hypothetical-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.46772e-54
CP028137.1\|AZZ53615.1\|3782648_3783686_+\|ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	8.64374e-77
CP028137.1\|AZZ53612.1\|3777483_3778266_-\|aquaporin-Z	gnl\|CDD\|235453	PRK05420, PRK05420, aquaporin Z; Provisional.	1.25133e-87
CP028137.1\|AZZ53616.1\|3783682_3784591_+\|sugar-ABC-transporter-permease	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	2.06259e-72
CP028137.1\|AZZ53617.1\|3785091_3786120_+\|LacI-family-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	7.03485e-92
CP028137.1\|AZZ53619.1\|3787816_3788578_+\|amidohydrolase	gnl\|CDD\|225070	COG2159, COG2159, Predicted metal-dependent hydrolase of the TIM-barrel fold [General function prediction only].	5.27844e-30
CP028137.1\|AZZ53621.1\|3789666_3790272_+\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	2.35328e-41
CP028137.1\|AZZ53622.1\|3790264_3791656_+\|hypothetical-protein	gnl\|CDD\|238625	cd01300, YtcJ_like, YtcJ_like metal dependent amidohydrolases. YtcJ is a Bacillus subtilis ORF of unknown function. The Arabidopsis homolog LAF3 has been identified as a factor required for photochrome A signalling.	6.87783e-61
CP028137.1\|AZZ53610.1\|3773456_3774557_+\|glycosidase	gnl\|CDD\|350126	cd18614, GH130, Glycosyl hydrolase family 130; uncharacterized. This subfamily contains glycosyl hydrolase family 130 (GH130) proteins, as classified by the carbohydrate-active enzymes database (CAZY), most of which are as yet uncharacterized. GH130 enzymes are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.	6.39113e-72
CP028137.1\|AZZ53608.1\|3771580_3772537_+\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	5.67532e-70

>CP028137.1|AZZ53616.1|3783682_3784591_+|sugar-ABC-transporter-permease
MTATIPTAPAAVPVAAEPERRARRPRSSGAGRVDRPGFLTYGLLSAFILGSTYPLWWSFVVASGSNATRGETLPLIPGGNFLANAAQVFTAIPFWTALLNSVVVSGIITLSVVSFSTLAGYAFAKLRFRGRDGLMITVIATMAIPTQLGIIPLFILMRQLGWTGTLGAVIVPTLVTAFGVFFMRQYLVDVIPDELIEAARVDGANQFRTFLTVAVPAARPAMAILALFTFMMAWTDFLWPLIVLSPTNPTLQTALSQLQSGYYVDYSIVLAGAVLSIIPLLVLFVLAGKQLIAGIMGGAVKG
>CP028137.1|AZZ53615.1|3782648_3783686_+|ABC-transporter-permease
MTSTLTPPTASAAPPPGRRPAPRLPLTARQRMSRFDVKASPYLYISPFFLLFAITGAFPLVYTLVVSLYDWQLLQGQGDFVGLGNFAAVLGDRFFWNSIGNTLSIFLLSTIPQLAVALVLAAVLDQSLRARTFWRMSVLLPYVVSPVAVALIFSSIFGDQEGLANNLLGLVGIAPIDWTNDRLASHIAIASMVNWRWTGYNALILLAAMQAVPRDLHESAALDGAGSFRRFTSITIPSIRPTLIFVIITATIGGLQIFAEPRLFDVSNAGGIGGSDRQFQTTVLYLWEMAFFRQNFGEAAAVAWLLFLLIVLIGLVNFAISRRIASVENRVRTRTRRPAQKVSDR
>CP028137.1|AZZ54396.1|3781194_3782505_+|sugar-binding-protein
MLESRRARIATAIAGAATLALLVSGCSSGSGAAEDGDIELTVTTFGAMGFDDLYAEYEEAHPGVTIVPNNIDTGGNARTDAFTKLAAGSGLADVVAIEEGWLGSIMEVSDQFVDLRDHGIEDRKADWVDWKYEQAVDPDGRVIGYGTDIGPEGLCYSTAAFEAAGLPTDRAAVAELLGGADATWEDYLAAGKQYHDATGKAWYDQSGFVWNAMVNQLPEGYYTADGELNIDGNAELQERWGWITDGAASGLSAAQKAWDWNKGKSFNDGTFATFVCPGWMLGQVKAQVEAGGGDPEATGWDFADVFPGGAANWGGSFLSVPTQSKHPAEAAELASWLSEPEQQIAAFDATGPFPSTVSAQEQLASAAAPDPALNGSPTGAILAERAQGVVAQYKGPDDSLIQENVFGPVLQKVDRGELDGDKGWNEALSLLDELVD
>CP028137.1|AZZ53614.1|3779656_3780091_-|glyoxalase
MPSMFVNLPVTDLERAKAFYVALGFSINPAFSDHNAACVVVEEDHNYFMILVREYFQTFSDLPIGDPAVNPSVSTAIFLDTREAVDATVTAGLAAGGSESRPASDYGFMYQRQVSDPDGNLLEFGWMDPVAAAQGPEAFTGEQA
>CP028137.1|AZZ53613.1|3778994_3779651_-|transcriptional-regulator
MAARDYGQYSALTRAVELVGERWALLIVRDLLVGPRRYSELAQGLARIPSNVLAGRLKELQAAGIIRRAPRSRIIVYELTPYGRELEPIVLALGAWGFKALGDPREEQVITPESMTVDLRTAFRPQVAAELPATVYAAQVGPAGLLIRVDGAALDVSRGEVAGGEAPVDLAFSTGADIRLLLSGELAPERAIATGAVTVLRGRDALLGRFASTFHLAA
>CP028137.1|AZZ53612.1|3777483_3778266_-|aquaporin-Z
MPSSKPASRTTSEQRKEHAEQYSAAARYASEAFGTFLLVAGGVGTAVFASAFPDSGNALGVGFLGVALAFGLTLVAGIYAVGHISGGHFNPAVSIGFALAGRTEWRHIPGYIVAQLVGGIAGAGVVALIAADGPAGYFDAARASGFASNGYGAASPGGFGLGAVILAEVVLTAVFVGVILSVTSKSEYKSVAPIAIGLTLTLVHLISIPISNTSVNPARSIAAAVFAGPDALGQVWVFLLAPVLGAAIAGLASKTLHRSR
>CP028137.1|AZZ53611.1|3774886_3776917_+|hypothetical-protein
MTNFRPRAAAVLAATALAAGGLAVGAAPAQAAEPLTNTAHLDFLLDTATPEPQPGHSTYRLAEEPDLVLPWTYADARDGGTFERVGGGPLDPATGDWAQGAYNTDDVSRAAVVYLRHWQQTGSPASRDKAYETLRSLAYFQTTTGDDAGNVVLWMQPDGDLNPSAEPVELPDPSDSEDSYWLARTLWALGEGYAAFQDENPDFAAFLQERLRLGVSAVDREVLTRYGEYAVADGVDVPAWLIVDGADATAEALLGLSAYVEAAPDDAAVRASTAKLAEGVAAYARTTTEADTTSWPYGAILPWTKSRSLWHSWSSQMAGGLAASSVALGDASLLEPAVVDAARFAPELLTAGGPDNGWNPTPTDRVQIAYGADSRLQNSLALADATGSSATGPSAYLDLAGVQGAWFFGLNLSGAPVYDPATGVTYDGVQADGSVNRNSGAESTIHGLLSMLALDAHPSVAARATAVITQASRDGLRLVEAESARGGTVVTPESAWTGESGWSGSYLSLTNWRRAATIPVGSATQDRLVEAVIFAAERGTEKTPISLWNSGRRPLDVLTSTVGAQGVTEASGILLPQKLRRTLPASSTTVEVRALSGETKLDALLVRPVVSRLVLVGDTGRTELVRNSTATPQPTTVDGTGTLRVYAQDGTLVSESPATGATPVTLPAQGFAMLVG
>CP028137.1|AZZ53610.1|3773456_3774557_+|glycosidase
MTPTPGTTTAATTRTAVPYRLERVGVVMEPLPGEPLEAEGVLNPGSGRGPDGELYLLPRMVAAGNVSRIGLARVLVEDGVPVGVERQGVVLAPDRGFERGATHSGVEDPRVTFIEALGLHVMTYVAYGPLGPRTALAVSEDLREWRRLGPVTFAYDEDLDIDLGLFHNKDTVFFPEIVAAPDGTRCFAVLHRPMWDLGETRPGEGVRLPAGVDDPRQSIWISYVPVDEVDRDLANLTRWTRHRFVAGPEFAYEELKIGGGPAPLRVPEGWLLLHHGVTGTIDSAFSQQQHVNYAAGAILLDADDPSKVIARTSEPLLEAETEEERSGIVPNVVFPTAIEEIDGRHYVFYGMADSKIGAARLLRTDE
>CP028137.1|AZZ53609.1|3772533_3773454_+|sugar-ABC-transporter-permease
MSTLASAGGATSAVPAAAAAPPTRRKRPASSRSAVILRGVVLALGAIVFLFPFYYMVIGSLQTDPDPTLAGAIPEAGNLTLDNYVNVNERIDLLTGLINSGIFTGGVLLCTIVFGVLAGYALAMLEWRGRNAVFALALLVQVIPFQLLQIPLYVLIARDYGLADSHLGMILPFAINSTAVIIFRQYFLQLPKELFEAARIDGAGEIKLLWNIALPLVRPALVTAVLLTFIGPWNEFLWPFLITKDASLQPLAVSLANYISNVASSTDNPFGAILAGAVVLAAPVVVLFIVFQRYFVSTDLGSGVKG
>CP028137.1|AZZ53608.1|3771580_3772537_+|sugar-ABC-transporter-permease
MTTLAPKAPASQGAGAPRPQDKRSLLRRVLGPQPFGLLLGSPYLLFVLAVFAFPVGYSVYIAFHDFFFAAPGVQVERPFVGFDNFVTAFSSPQVIRSFGNIGIFLVINVPLTVVLSLLLASALDKVVHLRTFLRVSFYVPYVTASVAVVGVWLFLFNGNGLVNSLLGPLAPDPSWLINDKLAMPIIALYVTWKQLGFYILLYLAALQNVPKELYESASTDGAGRIRQFWSVTVPSVRPATLLVLLVSTVTGANLFTEPYLLTGGGGPNGASASPVLLMYQLGIQQGQPDVASAIGVVLVLLVLVIAYLQNRFAGERNS
>CP028137.1|AZZ53617.1|3785091_3786120_+|LacI-family-transcriptional-regulator
MSHDTAPAAPTLEAVAALAGVSRATVSRVVNDSPKVKAEAQAAVRLAIEQLGYVPNRAARSLASRRTQVLALLVPESIGKVFGDPFLAAVVQGAATRLATTDYMLNIVIASEATPDKTRRYLLGGNVDGALVVSHHSGDHSYARIGASVPLVFGGRPLSLDDHDSHFVDVDNVGAARQVTEHLLGLGRRAPAMIASRQDMPGAIDRLAGWRATVEAAGLDASLVEIGDYSPRDGAEAMRRLLDSGRPIDAVFASNDQMASGALAVLRERGLSVPGDVALAGFDGHYSSEAAEPPITTVRQPAAGLGDAMAEVLVRLLAGDDVPRATLLPTELLIRGSTVPRS
>CP028137.1|AZZ53618.1|3786213_3786954_-|GntR-family-transcriptional-regulator
MIGSRPTWPLIGGDHRVTTQGDNALVDDLAARIRAKIMSGEIPIGAPLRQAELATQFGISRTPVREALRQLQTGGLIEVVPNRGAVVRVPVPWEVREAYEVRAELESLAARRAVDRLDDATIAELRSVNTAMYERSLAVAAGTAAERDGSANDQFHGLIYQASGNTRLSRMLIEINDAFPRNVSGLVLRENSRHREENFREHEQIVEAFVAGDRERAAAIMREHVLRAGEHLAHWYERRSSTVFTG
>CP028137.1|AZZ53619.1|3787816_3788578_+|amidohydrolase
MIIDAYNTTQDRRGRSDYLSGVRPGEQPPAYTPFDPKRILDRMDAAGVDRAMVCSLAQGIENDFLIDLVKAHPDRLFGFGQVMPQWENATDEIRRFADAGLVGLKLHPSLHGYHVADHGLLDPLFAVCDELGLPVLINALDDAFCAPFAIEEIAKGFPGVPTIIAHMGAVWNVPEAIIVAERNPHIYLETSATLMSDVKRAYARLGAEKILLGSEWPGSDFDLERMKIAKAIPDEADRALVEGGNMARILGWS
>CP028137.1|AZZ53620.1|3788619_3789078_+|cytidine-deaminase
MLDRPVLDRPVLDGPPAGMSAPDRELLEVASAILDARYRTGVHEVAAALRLTDGRIVTGLHVEASAGRASVCAESAALSAAVVAGSPVVAIVGVLQRPAGSRHLIEPCGVCAELLGDHAPDASVWVAVADTYSPVPVATLLPHRRRRAARPV
>CP028137.1|AZZ53621.1|3789666_3790272_+|cysteine-hydrolase
MLAVSGTPVLLVVDIQGGAASGLPTPGIPVMSGRAERAPRVRDLIAHCRSAGVPVVFVQEVHKRDLIDIGRELDGAEGPHCLEGDPGTELASWLEPRPEEFVIRKRRYSAFFGTELEIVLKAYRAGTLLLVGGLTDVCIHYTAADAHQHDYAVRVLTDCVAGSSERAHAATLEAIEYLQRDALVTAADVHDWLDRRETIDA
>CP028137.1|AZZ53622.1|3790264_3791656_+|hypothetical-protein
MPEPRNGTAPRLLVARIRTMDPENPLAEALLIDGDRIAAVGTLQEVRAAAPAGTPEEHLDGTLLPGFIDAHSHAQRAGLKALQLLDAGAGADAFSAAMLADADADPDAPDWLGDTPPTPADRRAALLRIQPLLHELGFTGVIDPAVTLDEIAAYRAAHERGELSLRVVAMPYPELGTEAVPGVDEALALLDTVDGTTGDGDELLRLGPIKVYYDGEGMKGQALLEQPWPGGSHGVQRIATAEFARLAAECVQRGWGLGVHAVGSRAVAEVLDALEGAGPPERIAALRCQLIHAYLEPSAESRERAARLGVVASLQPSIAWSNAAGLTERLGARADPVNPMRDWRDSGVVIALGSDAPYFPFDPRRVVATAVSRRMRRLPDPLGPEQALTVLEVVEGYTRGAAHAAFAEDRRGMLRAGFLADLVLLSVDPGECSAEEFAGAQVLRTVVGGRTVHGPAAEDADQM
>CP028137.1|AZZ53623.1|3791740_3793354_+|hypothetical-protein
MHHPYPLEDSTMVRKSLLAGVALAAVASLALTACGTTSAPQSATGTAGTTDTINAELWYAPSTFDPAKASADADVTVARLGFDTLLRQGETEGYIGGLATEWNAVSASEYTFTLRDGATCADGTAITPTVVADSFTYLTGLDDSGALTWKNQAFGSGDPTFTPDDAAGTLTISLSQPYSQLLGGVTRPGTGIICPAGLADTEGLAAGTVDGAWSGPYMLSNLSAGVSAAYTLRDDYDAWPDWQDVEGEPAKTINLTVQSDSNTSANLLESGGVDLARFYDSNALRFEDDPAYTTVTFASSAYNLVFNEAPGSGSIFEGNEERRAAVAQAIDTQGFNSAGLDGLGVPQYTVNAASYRCALDDESLVQKYDPAAATPELTGQSIRLLMMSNWDPAADYLAESLRAAGATVTVSALDPADWSKAMRTEPATWDVAIAAENAGPGLIHTTIARYLGPTYADGGTNVSSSDNPEGVAYYEAAMAASDTETQCENLLAAQKTILERVDMTPLITDTHRYVARSGFATSVFSGYWDISAMRILS
>CP028137.1|AZZ53624.1|3793414_3794464_+|ABC-transporter-permease
MSTTTATTLASSGAAGPGPGPGAVRAGTLGGAWRRFLLRRALGLLVNLALLVLVTFLIVQLIPGDPAIAIAGEAASLDQVELVRTQLGLDQPLPAQLWTYLLGVLQGDFGASYRYSIPAMDLVMTAVPYTLTITISAVLLLLVLGIALGMAVGVATRGDRRRWLDAVFSTVTGLISSVPTYVLATGFVVVFAVLLKVLPPAYSPAYDFGTAAILPIASLTVGGTCSVARIVRRETAVILEQDYMRTARGWRLPALTLYAKHMLPNLLTTALTLSGIILTALLGSALITEAVFAWPGLGGVIVQAIAIDKDYPVIRAAVFVIGLISLVITLVIDVILGLIDPRTLGEQRG
>CP028137.1|AZZ54397.1|3794486_3796175_+|peptide-ABC-transporter-ATP-binding-protein
MKPAGARTFAWNPGLVIGLGLLGVIALTALIAPIALEGQATGLGGSPSLGSTAEHPLGTDTLGRDMLARTLVATRSTVLMALAATVLSAIVGIAVGIGVWLAPRRVRELGLRAIELAVSYPTMLVAIIVAAILGQGVVQVVVAIAVANIAGFARLTANLASKIAASEYVTTARLTGVPTHLVALRHVLPNMAEPTLILVAGAFSGALVEISGLSFIGLGAQTPAFDWGTLLNDGLSRISVNPVVILGPALALTVASFAALLVGDGLAAAANPRSNTTRARMTRATDSSTAAPAPADAVLVADGITVRHGATGRELVSDLSFTVRRGEVLGIVGESGSGKSLTASVVAKLLGEGLEASARRLELGGTDLLDPVPDRVLAAKIGLIYQDPGTALNPAMVLGTQLSDVLRIRLRHSRRDALDLLLRGFRSVMLSDPEGRLRQYPHQLSGGMKQRAMIASAMSAKPDLLIADEPTTALDVTVQREVLSVLKRMNEDSGAAVLFISHDLGVVRALCDRVLVMKDGRIVERIEDIAHLSEETVTHPYTRQLLAATPVVTVPTPPEVRS
>CP028137.1|AZZ54398.1|3796219_3797011_+|ABC-transporter-ATP-binding-protein
MVDVRGLDVVFGHAKVLHGVDLRVERGRTVGVVGESGSGKSTLAKVLVGSVRAAAGTASVDGVDIVAANRSAMHAYRRRTQMIPQDPYSSLSPRRTIAQTLAEAIDPVRARVGRNEELIVAWLERVGLSADMRHRFPHEFSGGQRQRVAIARGLIIDPTFVIADEITSALDVSVQGQILDLLAGIKESLGLTMMFISHNLAVVQRVSDEVVVLYRGEVVEAGPVERIYADPQHWYTRRLLDADPGSPGFSLSGAASVPAKESA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
CP028137_13	13.12\|3835491\|18\|CP028137\|CRT	3835491-3835508	18	CP028137.1	2193729-2193746	1	0.944
CP028137_13	13.12\|3835491\|18\|CP028137\|CRT	3835491-3835508	18	CP028137.1	4159411-4159428	1	0.944
CP028137_2	2.2\|453542\|19\|CP028137\|CRISPRCasFinder	453542-453560	19	CP028137.1	91257-91275	2	0.895
CP028137_2	2.2\|453542\|19\|CP028137\|CRISPRCasFinder	453542-453560	19	CP028137.1	1623334-1623352	2	0.895

1. spacer 13.12|3835491|18|CP028137|CRT matches to position: 2193729-2193746, mismatch: 1, identity: 0.944

cacgccgccgaccacgcc	CRISPR spacer
cacgccgctgaccacgcc	Protospacer
********.*********

2. spacer 13.12|3835491|18|CP028137|CRT matches to position: 4159411-4159428, mismatch: 1, identity: 0.944

cacgccgccgaccacgcc	CRISPR spacer
cacgccgcagaccacgcc	Protospacer
******** *********

3. spacer 2.2|453542|19|CP028137|CRISPRCasFinder matches to position: 91257-91275, mismatch: 2, identity: 0.895

tgcccgttgccgccgcggt	CRISPR spacer
tgcccgctgccgccgaggt	Protospacer
******.******** ***

4. spacer 2.2|453542|19|CP028137|CRISPRCasFinder matches to position: 1623334-1623352, mismatch: 2, identity: 0.895

tgcccgttgccgccgcggt	CRISPR spacer
tgcccgaggccgccgcggt	Protospacer
******  ***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	MK071653	Meiothermus phage MMP7, complete genome	7543-7572	4	0.867
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	MH939157	UNVERIFIED: Meiothermus phage MMP17, complete genome	31951-31980	4	0.867
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP014797	Salipiger profundus strain JLT2016 plasmid pTPRO1, complete sequence	106051-106080	5	0.833
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP015446	Streptomyces sp. S8 plasmid unnamed, complete sequence	43270-43299	5	0.833
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP020716	Cnuibacter physcomitrellae strain XA(T) plasmid unnamed1, complete sequence	88493-88522	5	0.833
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP008954	Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence	4661-4690	5	0.833
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP021373	Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence	407467-407496	5	0.833
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	KX344445	Streptomyces phage Nanodon, complete genome	8950-8982	6	0.818
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP022365	Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence	69560-69589	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MN224564	Streptomyces phage Araceli, complete genome	6936-6965	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MH229862	Streptomyces phage Henoccus, complete genome	6936-6965	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NC_018582	Gordonia sp. KTR9 plasmid pGKT1, complete sequence	77690-77719	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	207333-207362	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	130686-130715	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	116192-116221	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	93809-93838	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NC_023284	Streptomyces sp. F2 plasmid pFRL4, complete sequence	294241-294270	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	1164687-1164716	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MT553347	Mycobacterium phage Awesomesauce, complete genome	53342-53371	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MH020243	Mycobacterium phage TootsiePop, complete genome	54041-54070	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MH020242	Mycobacterium phage Misha28, complete genome	54041-54070	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MK494120	Mycobacterium phage Piper2020, complete genome	54289-54318	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP047175	Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence	91128-91157	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	KU935727	Mycobacterium phage Panchino, complete genome	7574-7603	6	0.8
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	KU935729	Mycobacterium phage SkinnyPete, complete genome	7598-7627	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NC_012523	Rhodococcus opacus B4 plasmid pKNR, complete sequence	50497-50526	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013597	Rhizobium sp. N741 plasmid pRspN741b, complete sequence	228813-228842	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013501	Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence	229179-229208	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013507	Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence	228813-228842	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013518	Rhizobium sp. N113 plasmid pRspN113a, complete sequence	229179-229208	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013491	Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence	229182-229211	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013513	Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence	250059-250088	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013496	Rhizobium sp. N621 plasmid pRspN621a, complete sequence	229182-229211	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013591	Rhizobium sp. N871 plasmid pRspN871a, complete sequence	229182-229211	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	1060363-1060392	6	0.8
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP013603	Rhizobium sp. N731 plasmid pRspN731b, complete sequence	250059-250088	6	0.8
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1714813-1714845	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1303225-1303257	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	MH171094	Streptomyces phage Nabi, complete genome	8748-8780	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	MK433276	Streptomyces phage Asten, complete genome	8750-8782	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	KX507343	Streptomyces phage Lorelei, complete genome	8748-8780	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	MH171093	Streptomyces phage Rana, complete genome	8748-8780	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	MG757163	Streptomyces phage OzzyJ, complete genome	8751-8783	7	0.788
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP038146	Streptomyces sp. S501 plasmid unnamed, complete sequence	194372-194404	7	0.788
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5649689-5649718	7	0.767
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	38560-38589	7	0.767
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	MH229863	Streptomyces phage JackieB, complete genome	6812-6841	7	0.767
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP041223	Porphyrobacter sp. YT40 plasmid pYT40, complete sequence	11358-11387	7	0.767
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	CP003950	Rhodococcus opacus PD630 plasmid 1, complete sequence	20040-20069	7	0.767
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP016084	Streptomyces sp. SAT1 plasmid unnamed4, complete sequence	90787-90816	7	0.767
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP052758	Cellulosimicrobium sp. BI34T plasmid pCPRO01, complete sequence	56331-56360	7	0.767
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NC_006907	Leptospirillum ferrooxidans plasmid p49879.1, complete sequence	17320-17349	7	0.767
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_LR134462	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 20, complete sequence	5313-5342	7	0.767
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_LR134458	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 16, complete sequence	34011-34040	7	0.767
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NC_022001	Streptomyces collinus Tu 365 plasmid pSCO1, complete sequence	32188-32217	7	0.767
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	25630-25659	7	0.767
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP021084	Deinococcus ficus strain CC-FR2-10 plasmid pDFI3, complete sequence	41685-41717	8	0.758
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	156634-156663	8	0.733
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	503717-503746	8	0.733
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP045326	Mycobacterium sp. THAF192 plasmid pTHAF192_a, complete sequence	30242-30271	8	0.733
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	AP018278	Calothrix sp. NIES-4101 plasmid plasmid5 DNA, complete genome	44666-44695	8	0.733
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NC_015952	Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence	62080-62109	8	0.733
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NC_006907	Leptospirillum ferrooxidans plasmid p49879.1, complete sequence	17398-17427	8	0.733
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	338084-338113	8	0.733
CP028137_13	13.13\|3835527\|30\|CP028137\|CRT	3835527-3835556	30	NC_022599	Micrococcus sp. V7 plasmid pLMV7, complete sequence	16687-16716	8	0.733
CP028137_8	8.1\|2785407\|37\|CP028137\|CRISPRCasFinder	2785407-2785443	37	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	648940-648976	9	0.757
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP010898	Pandoraea vervacti strain NS15 plasmid pPV15, complete sequence	50816-50848	9	0.727
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP033582	Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence	42188-42220	9	0.727
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP046573	Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence	383146-383175	9	0.7
CP028137_13	13.11\|3835443\|30\|CP028137\|CRT	3835443-3835472	30	NZ_CP038639	Cupriavidus oxalaticus strain X32 plasmid unnamed4, complete sequence	200311-200340	9	0.7
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1415573-1415605	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1471721-1471753	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1338018-1338050	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1400225-1400257	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1337040-1337072	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1382411-1382443	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1382402-1382434	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1338010-1338042	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1337363-1337395	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1338001-1338033	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1415719-1415751	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1415700-1415732	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1415685-1415717	11	0.667
CP028137_13	13.1\|3834723\|33\|CP028137\|CRT	3834723-3834755	33	NZ_CP042998	Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence	63180-63212	11	0.667

1. spacer 13.13|3835527|30|CP028137|CRT matches to MK071653 (Meiothermus phage MMP7, complete genome) position: , mismatch: 4, identity: 0.867

gacccct--ccgacgaccccgcccacgacgcc	CRISPR spacer
--cccctggccgacgaacacgcccacgacgcc	Protospacer
  *****  ******* * *************

2. spacer 13.13|3835527|30|CP028137|CRT matches to MH939157 (UNVERIFIED: Meiothermus phage MMP17, complete genome) position: , mismatch: 4, identity: 0.867

gacccct--ccgacgaccccgcccacgacgcc	CRISPR spacer
--cccctggccgacgaacacgcccacgacgcc	Protospacer
  *****  ******* * *************

3. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP014797 (Salipiger profundus strain JLT2016 plasmid pTPRO1, complete sequence) position: , mismatch: 5, identity: 0.833

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
cacgccgcccacgacgcagccgacgaagag	Protospacer
*****************  ******* *

4. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP015446 (Streptomyces sp. S8 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.833

cacgccgcccacgacgcctccgacgacgcc---	CRISPR spacer
caggccgcccacgacgcct---acgacgcacag	Protospacer
** ****************   *******

5. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP020716 (Cnuibacter physcomitrellae strain XA(T) plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

cacgccgcccacgacgcctccga-cgacgcc	CRISPR spacer
gacgcctcccacgacgcccccgaccgacac-	Protospacer
 ***** ***********.**** ****.*

6. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP008954 (Amycolatopsis japonica strain DSM 44213 plasmid pAmyja1, complete sequence) position: , mismatch: 5, identity: 0.833

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gcaaccgccgacgaccccgccaacgacgcc	Protospacer
*   ** ************** ********

7. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP021373 (Rhizobium sp. ACO-34A plasmid pRACO34Ac, complete sequence) position: , mismatch: 5, identity: 0.833

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gagcgatccgacgaccctgcccacgaagcc	Protospacer
** *  ***********.******** ***

8. spacer 13.1|3834723|33|CP028137|CRT matches to KX344445 (Streptomyces phage Nanodon, complete genome) position: , mismatch: 6, identity: 0.818

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gtcccggtcgacaacggcggctccgactacccc	Protospacer
* **  *.**** ****** *************

9. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP022365 (Azospirillum sp. TSH58 plasmid TSH58_p06, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gccgccgaccacgacgcccccgacgacgga	Protospacer
  ***** **********.*********

10. spacer 13.11|3835443|30|CP028137|CRT matches to MN224564 (Streptomyces phage Araceli, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gtggacgcctacgacgcctccgacgacgcg	Protospacer
   * ****.*******************

11. spacer 13.11|3835443|30|CP028137|CRT matches to MH229862 (Streptomyces phage Henoccus, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gtggacgcctacgacgcctccgacgacgcg	Protospacer
   * ****.*******************

12. spacer 13.11|3835443|30|CP028137|CRT matches to NC_018582 (Gordonia sp. KTR9 plasmid pGKT1, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ggtgccgcccgcgacgccaccgacgacggc	Protospacer
 ..*******.******* ********* *

13. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ggcgtcgaccacgacgcctccgacgaccct	Protospacer
 .**.** ******************* *.

14. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ggcgtcgaccacgacgcctccgacgaccct	Protospacer
 .**.** ******************* *.

15. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
cgcgtcctcctcgacgcctccgacgacgcg	Protospacer
*.**.* .** ******************

16. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc--	CRISPR spacer
cacgccgcccacgacgccgcc--taacgtcga	Protospacer
****************** **  ..***.*

17. spacer 13.11|3835443|30|CP028137|CRT matches to NC_023284 (Streptomyces sp. F2 plasmid pFRL4, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ctcgccgcccccgacgccgccgacgagact	Protospacer
* ******** ******* ******* .*.

18. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
cccgccgcccaccacgccaccgacgatgta	Protospacer
* ********** ***** *******.*.

19. spacer 13.11|3835443|30|CP028137|CRT matches to MT553347 (Mycobacterium phage Awesomesauce, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
aacgccgccaacgacgcctcggacgctgtc	Protospacer
 ******** ********** **** .*.*

20. spacer 13.11|3835443|30|CP028137|CRT matches to MH020243 (Mycobacterium phage TootsiePop, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
aacgccgccaacgacgcctcggacgctgtc	Protospacer
 ******** ********** **** .*.*

21. spacer 13.11|3835443|30|CP028137|CRT matches to MH020242 (Mycobacterium phage Misha28, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
aacgccgccaacgacgcctcggacgctgtc	Protospacer
 ******** ********** **** .*.*

22. spacer 13.11|3835443|30|CP028137|CRT matches to MK494120 (Mycobacterium phage Piper2020, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
aacgccgccaacgacgcctcggacgctgtc	Protospacer
 ******** ********** **** .*.*

23. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP047175 (Rathayibacter sp. VKM Ac-2760 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ctcgccgcccacgccacctccgacgcctcg	Protospacer
* *********** *.********* * *

24. spacer 13.11|3835443|30|CP028137|CRT matches to KU935727 (Mycobacterium phage Panchino, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gaggccgcccgcgacgccgccgacgaaacc	Protospacer
 * *******.******* ******* .**

25. spacer 13.11|3835443|30|CP028137|CRT matches to KU935729 (Mycobacterium phage SkinnyPete, complete genome) position: , mismatch: 6, identity: 0.8

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gaggccgcccgcgacgccgccgacgaaacc	Protospacer
 * *******.******* ******* .**

26. spacer 13.13|3835527|30|CP028137|CRT matches to NC_012523 (Rhodococcus opacus B4 plasmid pKNR, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gtccactccgactaccccgcccacgcaacc	Protospacer
* ** ******* ************  .**

27. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013597 (Rhizobium sp. N741 plasmid pRspN741b, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

28. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013501 (Rhizobium esperanzae strain N561 plasmid pRspN561a, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

29. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013507 (Rhizobium sp. N1341 plasmid pRspN1341b, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

30. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013518 (Rhizobium sp. N113 plasmid pRspN113a, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

31. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013491 (Rhizobium sp. N6212 plasmid pRspN6212a, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

32. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013513 (Rhizobium sp. N1314 plasmid pRspN1314b, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

33. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013496 (Rhizobium sp. N621 plasmid pRspN621a, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

34. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013591 (Rhizobium sp. N871 plasmid pRspN871a, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

35. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gaaggcgccgacgatcccgcccccgacgcc	Protospacer
**   * *******.******* *******

36. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP013603 (Rhizobium sp. N731 plasmid pRspN731b, complete sequence) position: , mismatch: 6, identity: 0.8

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gccgcgcccgacgacaccgcccaggacgcc	Protospacer
* * * .******** ******* ******

37. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gaccgcgccgaccaccgcgccgccgcgtgcggc	Protospacer
*************** ***** ***  *.*  *

38. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gatgaagccgaccacggcgccgccgacttccgc	Protospacer
**. . *************** ****** ** *

39. spacer 13.1|3834723|33|CP028137|CRT matches to MH171094 (Streptomyces phage Nabi, complete genome) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gtgccggtcgacaacggcggctccgactacccc	Protospacer
*  *  *.**** ****** *************

40. spacer 13.1|3834723|33|CP028137|CRT matches to MK433276 (Streptomyces phage Asten, complete genome) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gtgccggtcgacaacggcggctccgactacccc	Protospacer
*  *  *.**** ****** *************

41. spacer 13.1|3834723|33|CP028137|CRT matches to KX507343 (Streptomyces phage Lorelei, complete genome) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gtgccggtcgacaacggcggctccgactacccc	Protospacer
*  *  *.**** ****** *************

42. spacer 13.1|3834723|33|CP028137|CRT matches to MH171093 (Streptomyces phage Rana, complete genome) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gtgccggtcgacaacggcggctccgactacccc	Protospacer
*  *  *.**** ****** *************

43. spacer 13.1|3834723|33|CP028137|CRT matches to MG757163 (Streptomyces phage OzzyJ, complete genome) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gtgccggtcgacaacggcggctccgactacccc	Protospacer
*  *  *.**** ****** *************

44. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP038146 (Streptomyces sp. S501 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.788

gaccgcgccgaccacggcgcctcc----gactacccc	CRISPR spacer
gaccgcgacggccacggcgcctccccaggacaa----	Protospacer
******* **.*************    *** *

45. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.767

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
cgcgccgcccacgacgcccccgccgcccgg	Protospacer
*.****************.*** ** *

46. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 7, identity: 0.767

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
tggatcgcccacgacgccaccgatgacgcc	Protospacer
.. ..************* ****.******

47. spacer 13.11|3835443|30|CP028137|CRT matches to MH229863 (Streptomyces phage JackieB, complete genome) position: , mismatch: 7, identity: 0.767

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gtggatgcctacgacgcctccgacgacgcg	Protospacer
   * .***.*******************

48. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP041223 (Porphyrobacter sp. YT40 plasmid pYT40, complete sequence) position: , mismatch: 7, identity: 0.767

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gaacgtgcccacgacgcccgcgacgacgcc	Protospacer
 *   .************. **********

49. spacer 13.11|3835443|30|CP028137|CRT matches to CP003950 (Rhodococcus opacus PD630 plasmid 1, complete sequence) position: , mismatch: 7, identity: 0.767

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
aacgccgccgacgacacctccgaccccctc	Protospacer
 ******** *****.********  * .*

50. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP016084 (Streptomyces sp. SAT1 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ctgtacgccaacgacgccaccgacgacgac	Protospacer
*    **** ******** ********* *

51. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP052758 (Cellulosimicrobium sp. BI34T plasmid pCPRO01, complete sequence) position: , mismatch: 7, identity: 0.767

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
cagctgtccgacgaccccgcccacgaccga	Protospacer
 * *. *********************

52. spacer 13.13|3835527|30|CP028137|CRT matches to NC_006907 (Leptospirillum ferrooxidans plasmid p49879.1, complete sequence) position: , mismatch: 7, identity: 0.767

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gttgcctccgacgaccccccccacgtcgta	Protospacer
* . ************** ****** **.

53. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_LR134462 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 20, complete sequence) position: , mismatch: 7, identity: 0.767

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
caggcctccgacgaccccggcctcgacgag	Protospacer
 *  *************** ** *****

54. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_LR134458 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 16, complete sequence) position: , mismatch: 7, identity: 0.767

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
ctcgacgccgacgacaccgccgacgacgcc	Protospacer
  *  * ******** ***** ********

55. spacer 13.13|3835527|30|CP028137|CRT matches to NC_022001 (Streptomyces collinus Tu 365 plasmid pSCO1, complete sequence) position: , mismatch: 7, identity: 0.767

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
cccgcctcccacgaccccgccgacgacaac	Protospacer
  * ***** *********** *****. *

56. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gaccccttcgacgaccccgccgtggttgcg	Protospacer
*******.*************   * .**

57. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP021084 (Deinococcus ficus strain CC-FR2-10 plasmid pDFI3, complete sequence) position: , mismatch: 8, identity: 0.758

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
caccacgccgaccacggcggctccgtcattcac	Protospacer
 ***.************** ***** *  .* *

58. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gacgccgaccacgacgccgccgacgctctg	Protospacer
 ****** ********** ****** . .

59. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
acgggcgcccacgccgcccccgacgacgag	Protospacer
   * ******** ****.*********

60. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP045326 (Mycobacterium sp. THAF192 plasmid pTHAF192_a, complete sequence) position: , mismatch: 8, identity: 0.733

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
gacgccgcccccgacgactccgactgaatc	Protospacer
 ********* ***** ******* . ..*

61. spacer 13.11|3835443|30|CP028137|CRT matches to AP018278 (Calothrix sp. NIES-4101 plasmid plasmid5 DNA, complete genome) position: , mismatch: 8, identity: 0.733

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
cttgccgcccacaacgccgccgacgagcaa	Protospacer
* .*********.***** *******

62. spacer 13.11|3835443|30|CP028137|CRT matches to NC_015952 (Streptomyces violaceusniger Tu 4113 plasmid pSTRVI02, complete sequence) position: , mismatch: 8, identity: 0.733

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
tgctgcgcccacgatgcctccggcgacggg	Protospacer
..*  *********.*******.*****

63. spacer 13.13|3835527|30|CP028137|CRT matches to NC_006907 (Leptospirillum ferrooxidans plasmid p49879.1, complete sequence) position: , mismatch: 8, identity: 0.733

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
gttgcctccgacgaccccccccacgttgta	Protospacer
* . ************** ****** .*.

64. spacer 13.13|3835527|30|CP028137|CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.733

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
tcggcgcccgacgaccccgccgccgacgcc	Protospacer
    * .**************  *******

65. spacer 13.13|3835527|30|CP028137|CRT matches to NC_022599 (Micrococcus sp. V7 plasmid pLMV7, complete sequence) position: , mismatch: 8, identity: 0.733

gacccctccgacgaccccgcccacgacgcc	CRISPR spacer
cccgtgcccggcgaccccggccacgacgcc	Protospacer
  * . .***.******** **********

66. spacer 8.1|2785407|37|CP028137|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.757

gcaggctccgtgctcgtcgagacgcccgcggagcgac	CRISPR spacer
ggcggctccgggatcgtcgagacgcccgctctgcggg	Protospacer
*  ******* * ****************   ***.

67. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP010898 (Pandoraea vervacti strain NS15 plasmid pPV15, complete sequence) position: , mismatch: 9, identity: 0.727

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
gaccgcgccggccacggtgcctccccaagcgcg	Protospacer
**********.******.******    .* *

68. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP033582 (Streptomyces sp. ADI95-16 plasmid pADI95-16a, complete sequence) position: , mismatch: 9, identity: 0.727

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
ctcttggccgaccacgccgccttcgactacgac	Protospacer
  *.  ********** *****.*******  *

69. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP046573 (Rhodococcus sp. WAY2 plasmid pRWAY01, complete sequence) position: , mismatch: 9, identity: 0.7

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
aacgccgccgacgacacctccgacccactt	Protospacer
 ******** *****.********    ..

70. spacer 13.11|3835443|30|CP028137|CRT matches to NZ_CP038639 (Cupriavidus oxalaticus strain X32 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.7

cacgccgcccacgacgcctccgacgacgcc	CRISPR spacer
ttttccgcccacgactcctccgaggacaga	Protospacer
. . *********** ******* ***.

71. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

72. spacer 13.1|3834723|33|CP028137|CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

73. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

74. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

75. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

76. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

77. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

78. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

79. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

80. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

81. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

82. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

83. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
cgccgcgccgaccacggcgccagcgaagcggaa	Protospacer
 .*******************  ***

84. spacer 13.1|3834723|33|CP028137|CRT matches to NZ_CP042998 (Aquisphaera giovannonii strain OJF2 plasmid pOJF2_1, complete sequence) position: , mismatch: 11, identity: 0.667

gaccgcgccgaccacggcgcctccgactacccc	CRISPR spacer
ccccgcgccgaccacggcgccccggaggtagag	Protospacer
  *******************.* **

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage