CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP035160	Lactobacillus plantarum strain SRCM103362 plasmid unnamed4	0 crisprs	NA	0	0
CP035158	Lactobacillus plantarum strain SRCM103362 plasmid unnamed2	0 crisprs	NA	0	0
CP035159	Lactobacillus plantarum strain SRCM103362 plasmid unnamed3	0 crisprs	NA	0	0
CP035157	Lactobacillus plantarum strain SRCM103362 plasmid unnamed1	0 crisprs	NA	0	0
CP035156	Lactobacillus plantarum strain SRCM103362 chromosome, complete genome	1 crisprs	cas9,cas1,cas2,csn2,csa3,DinG,cas3,DEDDh	7	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035156_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035156_1

129037-129930

TypeII

Consensus_repeat	Method
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRT

13 spacers

csn2,cas2,cas1,cas9,csa3

The CRISPR arrays of CP035156_1

>merge|CP035156|1|129037-129930|PILER-CR,CRISPRCasFinder,CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAACCAGTCCCAAAGGACAAGTTAAGGATAGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAAGAAACACTAAACACAGGGTTCTATTGAGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAAGTAGTCAAGAGAGTTCCGAGGTCAGGTTGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAATTGGAAATGTGAGTGCATCCGCTGCATCGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACCTGAAAGATTTGGCGCGCGTGACATTATCAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACAAACGTCTTTAGCGTAGTCATTCATTGGCTGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTGCACACTCAGCGACAAAATCATTACGCAAGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTATTGAGTGCAGCGTTGTTTGCGAGCGTCCGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGTACAGTGTCGCTCAACGTCTATCACTCCCGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACCTTGCGGGGCGTCTGATGAGCGCGATAAGGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACATTACTCGTGCGGTTAATGAAGAAGTTCCGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGGTATGGAGTACAACAAGGAACAAGACACGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGATGCTGAGGAAACGAAGCATAGAACGTTTGTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

>CP035156|1|1|129037-129864|PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AACCAGTCCCAAAGGACAAGTTAAGGATAG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAGAAACACTAAACACAGGGTTCTATTGAG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAGTAGTCAAGAGAGTTCCGAGGTCAGGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AATTGGAAATGTGAGTGCATCCGCTGCATC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTGAAAGATTTGGCGCGCGTGACATTATCA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACGTCTTTAGCGTAGTCATTCATTGGCT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TGCACACTCAGCGACAAAATCATTACGCAA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TATTGAGTGCAGCGTTGTTTGCGAGCGTCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GTACAGTGTCGCTCAACGTCTATCACTCCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTTGCGGGGCGTCTGATGAGCGCGATAAGG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ATTACTCGTGCGGTTAATGAAGAAGTTCCG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>CP035156|1|1|129037-129864|CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AACCAGTCCCAAAGGACAAGTTAAGGATAG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAGAAACACTAAACACAGGGTTCTATTGAG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAGTAGTCAAGAGAGTTCCGAGGTCAGGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AATTGGAAATGTGAGTGCATCCGCTGCATC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTGAAAGATTTGGCGCGCGTGACATTATCA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACGTCTTTAGCGTAGTCATTCATTGGCT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TGCACACTCAGCGACAAAATCATTACGCAA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TATTGAGTGCAGCGTTGTTTGCGAGCGTCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GTACAGTGTCGCTCAACGTCTATCACTCCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTTGCGGGGCGTCTGATGAGCGCGATAAGG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ATTACTCGTGCGGTTAATGAAGAAGTTCCG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>CP035156|1|1|129037-129930|CRT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AACCAGTCCCAAAGGACAAGTTAAGGATAG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAGAAACACTAAACACAGGGTTCTATTGAG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAGTAGTCAAGAGAGTTCCGAGGTCAGGTT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AATTGGAAATGTGAGTGCATCCGCTGCATC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTGAAAGATTTGGCGCGCGTGACATTATCA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	AAACGTCTTTAGCGTAGTCATTCATTGGCT
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TGCACACTCAGCGACAAAATCATTACGCAA
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TATTGAGTGCAGCGTTGTTTGCGAGCGTCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GTACAGTGTCGCTCAACGTCTATCACTCCC
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CTTGCGGGGCGTCTGATGAGCGCGATAAGG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	ATTACTCGTGCGGTTAATGAAGAAGTTCCG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	GATGCTGAGGAAACGAAGCATAGAACGTTT
GTCTTGAATAGCGGCCACATCAAAAACAGTTTCACG

Protein	Signature genes	Signature genes Name	Protein_function
CP035156.1\|QAS22945.1\|134793_135267_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP035156.1\|QAS22935.1\|121075_121783_+\|hypothetical-protein	unknown	unknown	unknown
CP035156.1\|QAS22931.1\|116204_116945_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
CP035156.1\|QAS22938.1\|127149_128055_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
CP035156.1\|QAS22941.1\|129994_132733_-\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
CP035156.1\|QAS22948.1\|136374_136881_-\|LytTR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197918
CP035156.1\|QAS22947.1\|135922_136378_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
CP035156.1\|QAS22936.1\|121807_122590_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP035156.1\|QAS22939.1\|128032_128338_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
CP035156.1\|QAS22950.1\|138304_138670_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP035156.1\|QAS22933.1\|118896_119367_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240033
CP035156.1\|QAS22937.1\|122878_126955_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
CP035156.1\|QAS22946.1\|135412_135835_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
CP035156.1\|QAS22934.1\|119599_120964_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
CP035156.1\|QAS22932.1\|117188_118781_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|214906
CP035156.1\|QAS22949.1\|137047_138280_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
CP035156.1\|QAS22943.1\|133818_134013_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
CP035156.1\|QAS22942.1\|133017_133776_+\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
CP035156.1\|QAS22940.1\|128334_129012_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
CP035156.1\|QAS22944.1\|134078_134681_-\|NADPH-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026

Protein	Function_ID	Function_description	E-value
CP035156.1\|QAS22945.1\|134793_135267_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000255443
CP035156.1\|QAS22931.1\|116204_116945_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	4.48973e-88
CP035156.1\|QAS22938.1\|127149_128055_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.41428e-89
CP035156.1\|QAS22941.1\|129994_132733_-\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
CP035156.1\|QAS22948.1\|136374_136881_-\|LytTR-family-transcriptional-regulator	gnl\|CDD\|197918	smart00850, LytTR, LytTr DNA-binding domain. This domain is found in a variety of bacterial transcriptional regulators. The domain binds to a specific DNA sequence pattern.	2.71307e-18
CP035156.1\|QAS22947.1\|135922_136378_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	3.15452e-25
CP035156.1\|QAS22936.1\|121807_122590_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.18043e-25
CP035156.1\|QAS22939.1\|128032_128338_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
CP035156.1\|QAS22950.1\|138304_138670_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	7.3086e-14
CP035156.1\|QAS22933.1\|118896_119367_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
CP035156.1\|QAS22937.1\|122878_126955_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	2.74422e-128
CP035156.1\|QAS22946.1\|135412_135835_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	2.67238e-43
CP035156.1\|QAS22934.1\|119599_120964_+\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0
CP035156.1\|QAS22932.1\|117188_118781_+\|DNA-binding-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	4.41904e-17
CP035156.1\|QAS22949.1\|137047_138280_+\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
CP035156.1\|QAS22943.1\|133818_134013_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
CP035156.1\|QAS22942.1\|133017_133776_+\|purine-nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	1.56346e-89
CP035156.1\|QAS22940.1\|128334_129012_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.34637e-80
CP035156.1\|QAS22944.1\|134078_134681_-\|NADPH-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.2024e-30

>CP035156.1|QAS22940.1|128334_129012_+|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGVHFPTELMNDPRAILEALVQTHVELGLKQKLVLTNVSHYLNQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>CP035156.1|QAS22939.1|128032_128338_+|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>CP035156.1|QAS22938.1|127149_128055_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGAQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPNEVSSDAINSHV
>CP035156.1|QAS22937.1|122878_126955_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEENQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRIKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKHKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAVRGGGVAGRRTQSRSKQIVAAYQGTAQAIVSDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFVYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKTDFGKLQVPGGIKLTGDAEIIYQSPTGLFERKISLKDL
>CP035156.1|QAS22936.1|121807_122590_+|alpha/beta-hydrolase
MRFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLKQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSVAFNKALLEFLATC
>CP035156.1|QAS22935.1|121075_121783_+|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQTSIQTATGIDWEKVAQLLDSTVIAQNTLSKAGLDDKTRQWLEKLKKLTPQDFNDHVE
>CP035156.1|QAS22934.1|119599_120964_+|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>CP035156.1|QAS22933.1|118896_119367_-|NUDIX-domain-containing-protein
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>CP035156.1|QAS22932.1|117188_118781_+|DNA-binding-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTGDAAVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYAALMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTAITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQALIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEIQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>CP035156.1|QAS22931.1|116204_116945_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAITVNSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSVQARLFAAFMRACVA
>CP035156.1|QAS22941.1|129994_132733_-|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNLVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPMTETTLALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDELTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>CP035156.1|QAS22942.1|133017_133776_+|purine-nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFQQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLAAIELAVESLAAY
>CP035156.1|QAS22943.1|133818_134013_-|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>CP035156.1|QAS22944.1|134078_134681_-|NADPH-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALLNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>CP035156.1|QAS22945.1|134793_135267_+|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIMAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDATIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>CP035156.1|QAS22946.1|135412_135835_+|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAANKITASQADGVLTITLPKTQPSANDGQIEIQ
>CP035156.1|QAS22947.1|135922_136378_-|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATKLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSFLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>CP035156.1|QAS22948.1|136374_136881_-|LytTR-family-transcriptional-regulator
MSSRIFTTISLSKSLFKGESTRHVQLTISETIHQVFVTIHGPQLTPAIKELQRNIEALTNQQFINVFQDRSLIKLPLQSVSRFYTANKRLYCETTTGAYLVHSHLHTLMDQLPPHQFLRISSSEIVRIACVKNFTLTKWGSFQVNLTTGTTTYASRRYTQQIRKAAQL
>CP035156.1|QAS22949.1|137047_138280_+|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>CP035156.1|QAS22950.1|138304_138670_+|ArsR-family-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRRKAQTKYLSLQLATFDRFLPGFLATL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_KM063576	Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence	33125-33154	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012287	Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-4, complete sequence	29617-29646	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_017017	Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence	6188-6217	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012274	Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-5, complete sequence	30825-30854	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012279	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence	2701-2730	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP019031	Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence	10004-10033	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	7625-7654	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014928	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence	28043-28072	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014889	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-8, complete sequence	6977-7006	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014918	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-3, complete sequence	4795-4824	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014631	Lactobacillus backii strain TMW 1.1988 plasmid L11988-7, complete sequence	25834-25863	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017358	Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence	4033-4062	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP035117	Lactobacillus plantarum strain SRCM103295 plasmid unnamed4	5612-5641	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP035117	Lactobacillus plantarum strain SRCM103295 plasmid unnamed4	31049-31078	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017368	Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence	6567-6596	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017265	Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence	27303-27332	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	CP031020	Lactobacillus helveticus isolate NWC_2_4 plasmid pNWC_2_4, complete sequence	18312-18341	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP047122	Lactobacillus hilgardii strain FLUB plasmid unnamed1	42445-42474	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP031183	Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence	69-98	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP008840	Lactobacillus gasseri DSM 14869 plasmid pEB01-2, complete sequence	10626-10655	0	1.0
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP028268	Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence	14100-14129	0	1.0
CP035156_1	1.3\|129205\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129205-129234	30	NZ_CP012658	Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK09, complete sequence	3475-3504	0	1.0
CP035156_1	1.8\|129535\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129535-129564	30	NZ_CP025993	Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	51476-51505	0	1.0
CP035156_1	1.10\|129667\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129667-129696	30	NZ_CP025993	Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence	30227-30256	0	1.0
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP032746	Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed2, complete sequence	44823-44852	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017375	Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-1, complete sequence	667-696	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014927	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-3, complete sequence	34772-34801	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014930	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-6, complete sequence	2092-2121	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014888	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-7, complete sequence	18631-18660	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014916	Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-1, complete sequence	106-135	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP035015	Lactobacillus plantarum strain 12_3 plasmid pldC, complete sequence	4013-4042	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017412	Lactobacillus plantarum strain RI-113 plasmid pRI113_6, complete sequence	12324-12353	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_006530	Lactobacillus salivarius UCC118 plasmid pSF118-44, complete sequence	8868-8897	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP015967	Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence	14602-14631	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP044413	Lactobacillus sp. JM1 plasmid unnamed1, complete sequence	15957-15986	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_011352	Lactobacillus paracasei plasmid plca36, complete sequence	36201-36230	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017957	Lactobacillus plantarum strain C410L1 plasmid unnamed3, complete sequence	11432-11461	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_013543	Lactobacillus paracasei subsp. paracasei plasmid pCD01, complete sequence	10608-10637	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP032650	Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence	7466-7495	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP033890	Lactobacillus plantarum strain LMT1-48 plasmid p_2, complete sequence	33391-33420	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP031201	Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_C, complete sequence	7797-7826	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_024991	Tetragenococcus halophilus plasmid pTDC-B DNA, complete sequence, strain: TyrB	13451-13480	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP046657	Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence	31361-31390	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_021516	Lactobacillus plantarum 16 plasmid Lp16C, complete sequence	4693-4722	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_021517	Lactobacillus plantarum 16 plasmid Lp16E, complete sequence	4366-4395	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP029972	Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence	21491-21520	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_024990	Tetragenococcus halophilus plasmid pTDC-A DNA, complete sequence, strain: TyrA	13451-13480	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP045050	Lactobacillus reuteri strain reuteri plasmid pLTR1318, complete sequence	20121-20150	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP018183	Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-3, complete sequence	33044-33073	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP013156	Lactobacillus plantarum strain MF1298 plasmid pMF1298-6, complete sequence	30383-30412	1	0.967
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP017997	Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence	41603-41632	1	0.967
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP035558	Lactobacillus plantarum strain SRCM103297 plasmid unnamed2	19406-19435	1	0.967
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP050806	Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence	32764-32793	1	0.967
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP021931	Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence	16468-16497	1	0.967
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP012874	Weissella cibaria strain CH2 plasmid pMKC01, complete sequence	21556-21585	1	0.967
CP035156_1	1.3\|129205\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129205-129234	30	NZ_CP026508	Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed3, complete sequence	14434-14463	1	0.967
CP035156_1	1.3\|129205\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129205-129234	30	NZ_CP023494	Lactobacillus plantarum strain NCIMB 700965 plasmid unamed4, complete sequence	10868-10897	1	0.967
CP035156_1	1.3\|129205\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129205-129234	30	NC_019219	Lactobacillus plantarum cryptic plasmid pLJ42, complete sequence	335-364	1	0.967
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014914	Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-2, complete sequence	7646-7675	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP011405	Lactobacillus salivarius str. Ren plasmid pR2, complete sequence	49727-49756	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012278	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-3, complete sequence	44057-44086	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012282	Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-7, complete sequence	8617-8646	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP030883	Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence	22308-22337	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP045730	Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence	2792-2821	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014926	Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence	7370-7399	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014885	Lactobacillus backii strain TMW 1.1991 plasmid pL11991-4, complete sequence	33563-33592	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014877	Lactobacillus backii strain TMW 1.1989 plasmid pL11989-4, complete sequence	22425-22454	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014628	Lactobacillus backii strain TMW 1.1988 plasmid L11988-4, complete sequence	12315-12344	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP019738	Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence	34516-34545	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP018797	Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence	57923-57952	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP017410	Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence	24710-24739	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014935	Pediococcus claussenii strain TMW 2.53 plasmid pL253-2, complete sequence	3658-3687	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP047123	Lactobacillus hilgardii strain FLUB plasmid unnamed2	37381-37410	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP031177	Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_C, complete sequence	10058-10087	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP046661	Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence	23514-23543	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014938	Pediococcus claussenii strain TMW 2.54 plasmid pL254-2, complete sequence	3658-3687	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014903	Lactobacillus backii strain TMW 1.2002 plasmid pL12002-4, complete sequence	59163-59192	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP025283	Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence	29513-29542	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NC_020820	Lactobacillus brevis KB290 plasmid pKB290-1, complete sequence	20890-20919	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014892	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-2, complete sequence	7650-7679	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP014895	Lactobacillus backii strain TMW 1.1992 plasmid pL11992-5, complete sequence	21000-21029	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012290	Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-2, complete sequence	34454-34483	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP012292	Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-4, complete sequence	8617-8646	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	NZ_CP019747	Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence	35650-35679	2	0.933
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP035140	Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed1, complete sequence	21434-21463	2	0.933
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP035749	Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence	19617-19646	2	0.933
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP028257	Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence	8000-8029	2	0.933
CP035156_1	1.1\|129073\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129073-129102	30	CP002035	Lactobacillus salivarius CECT 5713 plasmid pHN1, complete sequence	9171-9200	5	0.833
CP035156_1	1.2\|129139\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129139-129168	30	NZ_CP021276	Legionella pneumophila strain D-4040 plasmid unnamed2, complete sequence	3557-3586	6	0.8
CP035156_1	1.7\|129469\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129469-129498	30	MK765592	Tortoise microvirus 41 isolate 41_SP_100, complete genome	1621-1650	7	0.767
CP035156_1	1.7\|129469\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129469-129498	30	MK765611	Tortoise microvirus 59 isolate 59_SP_97, complete genome	1621-1650	7	0.767
CP035156_1	1.8\|129535\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129535-129564	30	NC_017507	Marinobacter adhaerens HP15 plasmid pHP-187, complete sequence	134270-134299	7	0.767
CP035156_1	1.10\|129667\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129667-129696	30	NZ_CP031175	Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_A, complete sequence	31756-31785	7	0.767
CP035156_1	1.4\|129271\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129271-129300	30	NZ_CP027853	Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence	118657-118686	8	0.733
CP035156_1	1.7\|129469\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129469-129498	30	KU708004	Pseudomonas phage phiAH14a, complete genome	8297-8326	8	0.733
CP035156_1	1.8\|129535\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129535-129564	30	KY296500	Xenohaliotis phage pCXc-HC2016, complete genome	22086-22115	8	0.733
CP035156_1	1.8\|129535\|30\|CP035156\|PILER-CR,CRISPRCasFinder,CRT	129535-129564	30	KY296501	Xenohaliotis phage pCXc-HR2015, complete genome	22084-22113	8	0.733

1. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_KM063576 (Lactobacillus reuteri strain LU4 plasmid pLU4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

2. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012287 (Pediococcus damnosus strain TMW 2.1534 plasmid pL21534-4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

3. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_017017 (Pediococcus claussenii ATCC BAA-344 plasmid pPECL-6, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

4. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012274 (Pediococcus damnosus strain TMW 2.1532 plasmid pL21532-5, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

5. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012279 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

6. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019031 (Lactobacillus fermentum strain SNUV175 plasmid pSNU175-2, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

7. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

8. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014928 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

9. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014889 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-8, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

10. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014918 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-3, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

11. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014631 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-7, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

12. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017358 (Lactobacillus plantarum strain TMW 1.25 plasmid pL125-4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

13. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035117 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

14. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035117 (Lactobacillus plantarum strain SRCM103295 plasmid unnamed4) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

15. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017368 (Lactobacillus plantarum strain TMW 1.277 plasmid pL1277-5, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

16. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017265 (Lactobacillus paracasei strain FAM18149 plasmid pFAM18149.24, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

17. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to CP031020 (Lactobacillus helveticus isolate NWC_2_4 plasmid pNWC_2_4, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

18. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047122 (Lactobacillus hilgardii strain FLUB plasmid unnamed1) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

19. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031183 (Lactobacillus brevis strain UCCLB95 plasmid pUCCLB95_A, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

20. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP008840 (Lactobacillus gasseri DSM 14869 plasmid pEB01-2, complete sequence) position: , mismatch: 0, identity: 1.0

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagttaaggatag	Protospacer
******************************

21. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028268 (Pediococcus pentosaceus strain SRCM102739 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctattgag	Protospacer
******************************

22. spacer 1.3|129205|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012658 (Lactobacillus plantarum strain HFC8 isolate Lactobacillus plantarum plasmid pMK09, complete sequence) position: , mismatch: 0, identity: 1.0

aagtagtcaagagagttccgaggtcaggtt	CRISPR spacer
aagtagtcaagagagttccgaggtcaggtt	Protospacer
******************************

23. spacer 1.8|129535|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025993 (Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence) position: , mismatch: 0, identity: 1.0

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
tattgagtgcagcgttgtttgcgagcgtcc	Protospacer
******************************

24. spacer 1.10|129667|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025993 (Lactobacillus plantarum subsp. plantarum strain LB1-2 plasmid pLB1-2B, complete sequence) position: , mismatch: 0, identity: 1.0

cttgcggggcgtctgatgagcgcgataagg	CRISPR spacer
cttgcggggcgtctgatgagcgcgataagg	Protospacer
******************************

25. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032746 (Lactobacillus paraplantarum strain DSM 10667 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

26. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017375 (Lactobacillus plantarum strain TMW 1.708 plasmid pL1708-1, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

27. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014927 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-3, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

28. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014930 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-6, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

29. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014888 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-7, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

30. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014916 (Lactobacillus paracollinoides strain TMW 1.1994 plasmid pL11994-1, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

31. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035015 (Lactobacillus plantarum strain 12_3 plasmid pldC, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

32. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017412 (Lactobacillus plantarum strain RI-113 plasmid pRI113_6, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

33. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_006530 (Lactobacillus salivarius UCC118 plasmid pSF118-44, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccgaaaggacaagttaaggatag	Protospacer
********* ********************

34. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP015967 (Lactobacillus plantarum strain LZ206 plasmid LZ206p2, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

35. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044413 (Lactobacillus sp. JM1 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccgaaaggacaagttaaggatag	Protospacer
********* ********************

36. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_011352 (Lactobacillus paracasei plasmid plca36, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccgaaaggacaagttaaggatag	Protospacer
********* ********************

37. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017957 (Lactobacillus plantarum strain C410L1 plasmid unnamed3, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

38. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_013543 (Lactobacillus paracasei subsp. paracasei plasmid pCD01, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtcccaaaggacaagtaaaggatag	Protospacer
********************* ********

39. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032650 (Lactobacillus plantarum strain ZFM4 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

40. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033890 (Lactobacillus plantarum strain LMT1-48 plasmid p_2, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

41. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031201 (Lactobacillus brevis strain UCCLBBS449 plasmid pUCCLBBS449_C, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

42. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_024991 (Tetragenococcus halophilus plasmid pTDC-B DNA, complete sequence, strain: TyrB) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

43. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046657 (Lactobacillus plantarum strain 123-17 plasmid p123-18.1, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

44. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_021516 (Lactobacillus plantarum 16 plasmid Lp16C, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

45. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_021517 (Lactobacillus plantarum 16 plasmid Lp16E, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

46. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029972 (Lactobacillus kefiri strain DH5 plasmid pDH5, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

47. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_024990 (Tetragenococcus halophilus plasmid pTDC-A DNA, complete sequence, strain: TyrA) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

48. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045050 (Lactobacillus reuteri strain reuteri plasmid pLTR1318, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccgaaaggacaagttaaggatag	Protospacer
********* ********************

49. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018183 (Lactobacillus nagelii strain TMW 1.1827 plasmid pL11827-3, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaaggacaagttaaggatag	Protospacer
********* ********************

50. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP013156 (Lactobacillus plantarum strain MF1298 plasmid pMF1298-6, complete sequence) position: , mismatch: 1, identity: 0.967

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaggacaagttaaggatag	Protospacer
********** *******************

51. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017997 (Lactobacillus crustorum strain MN047 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgag	Protospacer
************************.*****

52. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035558 (Lactobacillus plantarum strain SRCM103297 plasmid unnamed2) position: , mismatch: 1, identity: 0.967

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgag	Protospacer
************************.*****

53. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050806 (Lactobacillus plantarum strain SPC-SNU 72-2 plasmid pLBP752, complete sequence) position: , mismatch: 1, identity: 0.967

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgag	Protospacer
************************.*****

54. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021931 (Lactobacillus plantarum strain TMW 1.1308 plasmid pL11308-1, complete sequence) position: , mismatch: 1, identity: 0.967

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgag	Protospacer
************************.*****

55. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012874 (Weissella cibaria strain CH2 plasmid pMKC01, complete sequence) position: , mismatch: 1, identity: 0.967

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgag	Protospacer
************************.*****

56. spacer 1.3|129205|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026508 (Lactobacillus plantarum strain NCIMB700965.EF.A plasmid punamed3, complete sequence) position: , mismatch: 1, identity: 0.967

aagtagtcaagagagttccgaggtcaggtt	CRISPR spacer
aagtagtcaagagagttccgaggtcagggt	Protospacer
**************************** *

57. spacer 1.3|129205|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023494 (Lactobacillus plantarum strain NCIMB 700965 plasmid unamed4, complete sequence) position: , mismatch: 1, identity: 0.967

aagtagtcaagagagttccgaggtcaggtt	CRISPR spacer
aagtagtcaagagagttccgaggtcagggt	Protospacer
**************************** *

58. spacer 1.3|129205|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_019219 (Lactobacillus plantarum cryptic plasmid pLJ42, complete sequence) position: , mismatch: 1, identity: 0.967

aagtagtcaagagagttccgaggtcaggtt	CRISPR spacer
aagtagtcaagagagttccgaggtcagggt	Protospacer
**************************** *

59. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014914 (Lactobacillus paracollinoides strain TMW 1.1979 plasmid pL11979-2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccgaggacaagttaaggatag	Protospacer
********** .******************

60. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP011405 (Lactobacillus salivarius str. Ren plasmid pR2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccgaaagggcaagttaaggatag	Protospacer
********* *****.**************

61. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012278 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-3, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccgaggacaagttaaggatag	Protospacer
********** .******************

62. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012282 (Pediococcus damnosus strain TMW 2.1533 plasmid pL21533-7, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

63. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030883 (Lactobacillus plantarum strain nF1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaagacaagttaaggatag	Protospacer
********** **.****************

64. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045730 (Lactobacillus gastricus strain LG045 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccaaaagggcaagttaaggatag	Protospacer
********* *****.**************

65. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014926 (Lactobacillus paracollinoides strain TMW 1.1995 plasmid pL11995-2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

66. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014885 (Lactobacillus backii strain TMW 1.1991 plasmid pL11991-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

67. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014877 (Lactobacillus backii strain TMW 1.1989 plasmid pL11989-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

68. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014628 (Lactobacillus backii strain TMW 1.1988 plasmid L11988-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

69. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019738 (Lactobacillus brevis strain TMW 1.2108 plasmid pl12108-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

70. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP018797 (Lactobacillus parabuchneri strain FAM21731 plasmid pFAM21731.1, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

71. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017410 (Lactobacillus plantarum strain RI-113 plasmid pRI113_4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagcccaaaaggacaagttaaggatag	Protospacer
******.** ********************

72. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014935 (Pediococcus claussenii strain TMW 2.53 plasmid pL253-2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

73. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP047123 (Lactobacillus hilgardii strain FLUB plasmid unnamed2) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccgaggacaagttaaggatag	Protospacer
********** .******************

74. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031177 (Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_C, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaagacaagttaaggatag	Protospacer
********** **.****************

75. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046661 (Lactobacillus plantarum strain 83-18 plasmid p83-18.1, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccgaggacaagttaaggatag	Protospacer
********** .******************

76. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014938 (Pediococcus claussenii strain TMW 2.54 plasmid pL254-2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

77. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014903 (Lactobacillus backii strain TMW 1.2002 plasmid pL12002-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

78. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025283 (Lactobacillus plantarum subsp. plantarum strain nF1-FD plasmid pnF1FD02, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaagacaagttaaggatag	Protospacer
********** **.****************

79. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_020820 (Lactobacillus brevis KB290 plasmid pKB290-1, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccaaagacaagttaaggatag	Protospacer
********** **.****************

80. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014892 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccgaggacaagttaaggatag	Protospacer
********** .******************

81. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014895 (Lactobacillus backii strain TMW 1.1992 plasmid pL11992-5, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

82. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012290 (Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-2, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccccgaggacaagttaaggatag	Protospacer
********** .******************

83. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012292 (Pediococcus damnosus strain TMW 2.1535 plasmid pL21535-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

84. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP019747 (Lactobacillus brevis strain TMW 1.2111 plasmid pl12111-4, complete sequence) position: , mismatch: 2, identity: 0.933

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccggtccaaaaggacaagttaaggatag	Protospacer
****.**** ********************

85. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035140 (Leuconostoc mesenteroides strain SRCM103356 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgaa	Protospacer
************************.****.

86. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035749 (Leuconostoc mesenteroides strain SRCM103460 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.933

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgaa	Protospacer
************************.****.

87. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP028257 (Leuconostoc mesenteroides strain SRCM102735 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacagggttctgttgaa	Protospacer
************************.****.

88. spacer 1.1|129073|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to CP002035 (Lactobacillus salivarius CECT 5713 plasmid pHN1, complete sequence) position: , mismatch: 5, identity: 0.833

aaccagtcccaaaggacaagttaaggatag	CRISPR spacer
aaccagtccgaaaggrcaagttaaggacwa	Protospacer
********* ***** ***********. .

89. spacer 1.2|129139|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021276 (Legionella pneumophila strain D-4040 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.8

aagaaacactaaacacagggttctattgag	CRISPR spacer
aagaaacactaaacacatggtattgattag	Protospacer
***************** *** .*. * **

90. spacer 1.7|129469|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to MK765592 (Tortoise microvirus 41 isolate 41_SP_100, complete genome) position: , mismatch: 7, identity: 0.767

tgcacactcagcgacaaaatcattacgcaa	CRISPR spacer
ggtaggcgcagcgagaaaatcattacgcac	Protospacer
 *.* .* ****** **************

91. spacer 1.7|129469|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to MK765611 (Tortoise microvirus 59 isolate 59_SP_97, complete genome) position: , mismatch: 7, identity: 0.767

tgcacactcagcgacaaaatcattacgcaa	CRISPR spacer
agtaggcgcagcgagaaaatcattacgcac	Protospacer
 *.* .* ****** **************

92. spacer 1.8|129535|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NC_017507 (Marinobacter adhaerens HP15 plasmid pHP-187, complete sequence) position: , mismatch: 7, identity: 0.767

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
acctgagtgcaacgttgtttgcgagactct	Protospacer
  .********.*************  **.

93. spacer 1.10|129667|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP031175 (Lactobacillus brevis strain UCCLB556 plasmid pUCCLB556_A, complete sequence) position: , mismatch: 7, identity: 0.767

cttgcggggcgtctgatgagcgcgataagg	CRISPR spacer
caacgatgccgtctgatgagcgcgataagg	Protospacer
*    . * *********************

94. spacer 1.4|129271|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027853 (Plesiomonas shigelloides strain MS-17-188 plasmid pPS-MS-17-188-1, complete sequence) position: , mismatch: 8, identity: 0.733

aattggaaatgtgagtgcatccgctgcatc	CRISPR spacer
cagtggacacgtgagtgcatccgctgtcag	Protospacer
 * **** *.****************.

95. spacer 1.7|129469|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to KU708004 (Pseudomonas phage phiAH14a, complete genome) position: , mismatch: 8, identity: 0.733

tgcacactcagcgacaaaatcattacgcaa	CRISPR spacer
ccggtattccgcgacaaaatcaatacgcaa	Protospacer
.  ..*.** ************ *******

96. spacer 1.8|129535|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to KY296500 (Xenohaliotis phage pCXc-HC2016, complete genome) position: , mismatch: 8, identity: 0.733

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
cattgattgcagcgttgtttgagatcacag	Protospacer
.***** ************** ** *..

97. spacer 1.8|129535|30|CP035156|PILER-CR,CRISPRCasFinder,CRT matches to KY296501 (Xenohaliotis phage pCXc-HR2015, complete genome) position: , mismatch: 8, identity: 0.733

tattgagtgcagcgttgtttgcgagcgtcc	CRISPR spacer
cattgattgcagcgttgtttgagatcacag	Protospacer
.***** ************** ** *..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

37635 : 54422

Lactococcus_phage(22.22%)

integrase,terminase,tail,head,portal,capsid

attL 37591:37610|attR 42592:42611

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
37591:37610	attL	NA	NA	NA	NA
QAS22849.1\|37635_38790_-\|integrase	site-specific integrase	A0A172LN96	Lactococcus_phage	8.0e-60	36.7
QAS22850.1\|38851_39556_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAS22851.1\|39693_39873_+	DNA-binding protein	NA	NA	NA	NA
QAS22852.1\|39915_40023_+	hypothetical protein	NA	NA	NA	NA
QAS22853.1\|40143_40374_+	hypothetical protein	NA	NA	NA	NA
QAS22854.1\|40387_41188_+	DNA replication protein	NA	NA	NA	NA
QAS22855.1\|41187_42582_+	virulence protein	Q4ZD27	Staphylococcus_phage	1.8e-69	35.4
QAS22856.1\|42724_43204_+	hypothetical protein	NA	NA	NA	NA
42592:42611	attR	NA	NA	NA	NA
QAS22857.1\|43219_43411_+	hypothetical protein	NA	NA	NA	NA
QAS22858.1\|43397_43739_+\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
QAS22859.1\|43731_44121_+	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	1.0e-19	45.6
QAS22860.1\|44707_45181_+\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
QAS22861.1\|45177_46881_+\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	3.2e-121	40.3
QAS22862.1\|46834_47035_+	hypothetical protein	NA	NA	NA	NA
QAS22863.1\|47035_48136_+\|portal	phage portal protein	A0A2H4J9Q5	uncultured_Caudovirales_phage	1.2e-49	34.0
QAS22864.1\|48132_49668_+\|capsid	phage major capsid protein	B8R651	Lactobacillus_phage	6.7e-46	25.8
QAS22865.1\|49785_50055_+\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
QAS22866.1\|50204_50582_+	hypothetical protein	NA	NA	NA	NA
QAS22867.1\|50705_50906_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.4e-20	71.4
QAS22868.1\|50992_51223_+	hypothetical protein	NA	NA	NA	NA
QAS22869.1\|51826_52534_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.9e-44	40.1
QAS22870.1\|52547_54422_+	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	5.5e-34	31.8

DBSCAN-SWA_2

547880 : 556505

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS23304.1\|547880_549578_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
QAS23305.1\|549599_549908_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
QAS23306.1\|549923_550523_+	recombination protein RecR	NA	NA	NA	NA
QAS23307.1\|550537_550789_+	DUF2508 family protein	NA	NA	NA	NA
QAS23308.1\|551187_551853_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
QAS23309.1\|551849_552179_+	hypothetical protein	NA	NA	NA	NA
QAS23310.1\|552195_553215_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
QAS23311.1\|553239_553587_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
QAS23312.1\|553685_554582_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.7e-81	55.7
QAS23313.1\|554585_555371_+	acyl-ACP thioesterase	NA	NA	NA	NA
QAS23314.1\|555509_556505_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9

DBSCAN-SWA_3

1156190 : 1163550

Lactobacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS23787.1\|1156190_1157138_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
QAS23788.1\|1157481_1158096_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
QAS23789.1\|1158098_1160537_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.4
QAS23790.1\|1160624_1161185_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	2.7e-101	100.0
QAS23791.1\|1161255_1161696_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	3.0e-76	98.6
QAS23792.1\|1161791_1161929_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAS23793.1\|1162554_1163550_+	glycosyltransferase	S5FKN0	Shigella_phage	3.1e-52	38.8

DBSCAN-SWA_4

1661698 : 1748312

Lactobacillus_phage(69.39%)

integrase,terminase,protease,tail,holin,head,tRNA,portal,capsid

attL 1687277:1687294|attR 1755246:1755263

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS24236.1\|1661698_1662622_-\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
QAS24237.1\|1663106_1663628_-	shikimate kinase	NA	NA	NA	NA
QAS24238.1\|1663630_1664728_-	prephenate dehydrogenase	NA	NA	NA	NA
QAS24239.1\|1664730_1666029_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
QAS24240.1\|1666042_1666570_-	amino acid biosynthesis protein	NA	NA	NA	NA
QAS24241.1\|1666578_1667748_-	chorismate synthase	NA	NA	NA	NA
QAS24242.1\|1667740_1669195_-	MFS transporter	NA	NA	NA	NA
QAS24243.1\|1672808_1673114_-	hypothetical protein	NA	NA	NA	NA
QAS24244.1\|1673103_1673403_-	YlxR family protein	NA	NA	NA	NA
QAS24245.1\|1674684_1675161_-	ribosome maturation factor RimP	NA	NA	NA	NA
QAS24246.1\|1680262_1681972_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
QAS24247.1\|1682011_1683289_-\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
QAS24248.1\|1683326_1684112_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
QAS24249.1\|1684127_1684907_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	1.1e-23	43.1
QAS24250.1\|1685026_1685590_-	ribosome recycling factor	NA	NA	NA	NA
QAS24251.1\|1685591_1686314_-	UMP kinase	NA	NA	NA	NA
QAS24252.1\|1686514_1687393_-	elongation factor Ts	NA	NA	NA	NA
1687277:1687294	attL	NA	NA	NA	NA
QAS24253.1\|1687495_1688299_-	30S ribosomal protein S2	NA	NA	NA	NA
QAS24254.1\|1688523_1689246_+	HAD family hydrolase	NA	NA	NA	NA
QAS24255.1\|1689534_1690533_-	D-2-hydroxyacid dehydrogenase	M1HKI4	Acanthocystis_turfacea_Chlorella_virus	2.3e-47	34.9
QAS24256.1\|1690617_1690923_-	GIY-YIG nuclease family protein	NA	NA	NA	NA
QAS24257.1\|1690906_1691665_-\|tRNA	tRNA1(Val) (adenine(37)-N6)-methyltransferase	NA	NA	NA	NA
QAS24258.1\|1691776_1692412_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
QAS24259.1\|1692468_1692705_-	YneF family protein	NA	NA	NA	NA
QAS24260.1\|1692802_1693042_-	DUF896 domain-containing protein	NA	NA	NA	NA
QAS24261.1\|1693193_1693826_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	2.3e-16	56.2
QAS25457.1\|1693915_1694146_-	hypothetical protein	NA	NA	NA	NA
QAS24262.1\|1694449_1695079_+	hypothetical protein	NA	NA	NA	NA
QAS24263.1\|1695128_1696298_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
QAS24264.1\|1696333_1696726_-	hypothetical protein	NA	NA	NA	NA
QAS24265.1\|1696889_1697282_+	hypothetical protein	NA	NA	NA	NA
QAS24266.1\|1697727_1698669_+	glycosyltransferase	V9QJB1	Oenococcus_phage	2.4e-78	49.0
QAS24267.1\|1699420_1699993_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAS24268.1\|1700144_1701329_-	LytR family transcriptional regulator	NA	NA	NA	NA
QAS24269.1\|1701309_1702101_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-30	36.8
QAS24270.1\|1702119_1703862_-	ABC transporter permease subunit	NA	NA	NA	NA
QAS24271.1\|1704340_1705552_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
QAS24272.1\|1706793_1707171_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	1.0e-16	68.8
QAS24273.1\|1707183_1707447_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
QAS25458.1\|1707446_1708562_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	1.6e-33	68.3
QAS24274.1\|1708627_1708843_-	hypothetical protein	A0A0A1ENR9	Lactobacillus_phage	5.9e-17	74.3
QAS24275.1\|1710093_1710348_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	9.4e-30	97.2
QAS24276.1\|1710340_1712656_-\|tail	phage tail protein	E9LUR4	Lactobacillus_phage	3.7e-189	65.2
QAS24277.1\|1712673_1715031_-	hypothetical protein	E9LUR3	Lactobacillus_phage	0.0e+00	91.4
QAS24278.1\|1715096_1716869_-\|tail	phage tail protein	E9LUR2	Lactobacillus_phage	0.0e+00	95.6
QAS24279.1\|1716940_1721848_-\|tail	phage tail protein	E9LUR1	Lactobacillus_phage	0.0e+00	62.4
QAS24280.1\|1721860_1722052_-	hypothetical protein	E9LUR0	Lactobacillus_phage	1.5e-27	100.0
QAS24281.1\|1722048_1722432_-	hypothetical protein	E9LUQ9	Lactobacillus_phage	3.9e-64	100.0
QAS24282.1\|1722633_1723272_-\|tail	phage tail protein	E9LUQ8	Lactobacillus_phage	2.7e-110	94.3
QAS24283.1\|1723272_1723656_-	hypothetical protein	E9LUQ7	Lactobacillus_phage	5.2e-64	96.1
QAS24284.1\|1723652_1724093_-\|tail	phage tail protein	E9LUQ6	Lactobacillus_phage	4.2e-78	97.9
QAS24285.1\|1724082_1724445_-\|head,tail	head-tail adaptor protein	E9LUQ5	Lactobacillus_phage	2.4e-63	95.0
QAS24286.1\|1724428_1724773_-\|head,tail	phage gp6-like head-tail connector protein	F8J1B6	Lactobacillus_phage	2.0e-06	33.0
QAS24287.1\|1725005_1726151_-\|capsid	phage major capsid protein	A0A0C5AEH1	Paenibacillus_phage	4.9e-86	45.6
QAS24288.1\|1726153_1726873_-\|protease	Clp protease ClpP	A0A0B5A796	Paenibacillus_phage	3.3e-64	56.5
QAS24289.1\|1726844_1728074_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	1.9e-107	50.8
QAS24290.1\|1728093_1729884_-\|terminase	terminase large subunit	F8J1B1	Lactobacillus_phage	2.3e-231	65.7
QAS24291.1\|1729870_1730329_-\|terminase	phage terminase small subunit P27 family	F8J1A9	Lactobacillus_phage	3.1e-15	35.3
QAS24292.1\|1730487_1730820_-	HNH endonuclease	A0A0C5AFD8	Paenibacillus_phage	8.8e-20	47.7
QAS24293.1\|1730819_1731059_-	hypothetical protein	NA	NA	NA	NA
QAS24294.1\|1731058_1731247_-	hypothetical protein	E9LUP6	Lactobacillus_phage	6.1e-18	85.7
QAS24295.1\|1731300_1732101_-	hypothetical protein	NA	NA	NA	NA
QAS24296.1\|1732496_1732934_-	transcriptional regulator	E9LUP5	Lactobacillus_phage	2.1e-29	45.8
QAS24297.1\|1733008_1733209_-	hypothetical protein	A0A1I9KKG6	Lactobacillus_phage	7.6e-19	72.3
QAS24298.1\|1733240_1733408_-	hypothetical protein	E9LUP4	Lactobacillus_phage	4.4e-12	86.4
QAS24299.1\|1733400_1733580_-	hypothetical protein	A0A1S5RCW8	Lactobacillus_phage	2.7e-15	80.0
QAS24300.1\|1733582_1733954_-	hypothetical protein	Q9T1G9	Lactobacillus_phage	4.3e-15	47.5
QAS24301.1\|1733950_1734397_-	DUF1642 domain-containing protein	A0A1S5RCV9	Lactobacillus_phage	6.9e-44	63.0
QAS24302.1\|1734478_1734904_-	hypothetical protein	K4I239	Lactobacillus_phage	1.8e-33	55.1
QAS24303.1\|1734969_1735179_-	hypothetical protein	D6PSV2	Lactobacillus_phage	9.1e-31	97.1
QAS24304.1\|1735171_1735480_-	hypothetical protein	E9LUN7	Lactobacillus_phage	2.3e-46	91.1
QAS24305.1\|1735615_1736401_-	ATP-binding protein	E9LUN6	Lactobacillus_phage	1.2e-144	98.9
QAS24306.1\|1736400_1737198_-	replication protein	Q9AZA0	Lactobacillus_prophage	2.5e-52	69.7
QAS24307.1\|1737247_1737940_-	hypothetical protein	E9LUU3	Lactobacillus_phage	1.1e-117	88.7
QAS24308.1\|1738720_1738921_-	hypothetical protein	E9LUT7	Lactobacillus_phage	3.4e-27	90.9
QAS24309.1\|1738923_1739178_-	hypothetical protein	NA	NA	NA	NA
QAS24310.1\|1739190_1739394_-	DNA-binding protein	NA	NA	NA	NA
QAS24311.1\|1739559_1739850_+	hypothetical protein	NA	NA	NA	NA
QAS25459.1\|1739928_1740198_+	SinR family protein	A0A0M3LS55	Mannheimia_phage	2.1e-11	42.4
QAS24312.1\|1740442_1740703_-	hypothetical protein	NA	NA	NA	NA
QAS24313.1\|1740760_1741048_+	hypothetical protein	NA	NA	NA	NA
QAS24314.1\|1741024_1741372_-	hypothetical protein	NA	NA	NA	NA
QAS24315.1\|1741384_1741594_-	hypothetical protein	NA	NA	NA	NA
QAS24316.1\|1741605_1742340_-	hypothetical protein	A0A1P8BM06	Lactococcus_phage	2.5e-51	45.3
QAS24317.1\|1742355_1742571_-	XRE family transcriptional regulator	A0A2H4JBV7	uncultured_Caudovirales_phage	5.9e-17	71.0
QAS24318.1\|1742763_1743435_+	LexA family transcriptional regulator	D7RWL5	Brochothrix_phage	2.4e-40	53.6
QAS24319.1\|1743557_1744832_+	hypothetical protein	A0A0K2SUJ2	Clostridium_phage	3.5e-24	35.7
QAS24320.1\|1745128_1745311_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	6.7e-14	66.7
QAS24321.1\|1745412_1745652_+	hypothetical protein	A0A2P0ZL93	Lactobacillus_phage	1.8e-11	60.3
QAS24322.1\|1745832_1746147_+	hypothetical protein	NA	NA	NA	NA
QAS24323.1\|1746343_1746919_-	hypothetical protein	NA	NA	NA	NA
QAS24324.1\|1747148_1748312_+\|integrase	site-specific integrase	B4XYR4	Lactobacillus_phage	2.7e-55	36.5
1755246:1755263	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2040218 : 2098739

Lactobacillus_phage(50.0%)

integrase,terminase,tail,plate,holin,head,portal,capsid

attL 2084807:2084828|attR 2098917:2098938

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS24569.1\|2040218_2040593_-\|holin	holin	A0A2K9VCG4	Lactobacillus_phage	3.5e-17	70.0
QAS24570.1\|2040579_2040876_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
QAS24571.1\|2042245_2044573_-	hypothetical protein	A0A2K9VC32	Lactobacillus_phage	1.6e-38	35.8
QAS24572.1\|2044587_2044734_-	XkdX family protein	U5U4L4	Lactobacillus_phage	6.0e-05	56.8
QAS24573.1\|2044733_2045045_-	DUF2977 domain-containing protein	NA	NA	NA	NA
QAS24574.1\|2045049_2045814_-	hypothetical protein	NA	NA	NA	NA
QAS24575.1\|2045831_2046491_-\|plate	phage baseplate upper protein	A0A1J0MFQ3	Staphylococcus_phage	1.8e-40	48.6
QAS24576.1\|2046502_2047567_-	SGNH/GDSL hydrolase family protein	Q8LTH0	Staphylococcus_virus	1.1e-66	48.6
QAS24577.1\|2047563_2047785_-	hypothetical protein	NA	NA	NA	NA
QAS24578.1\|2047777_2048905_-	hypothetical protein	O03938	Lactobacillus_phage	6.8e-72	42.6
QAS24579.1\|2048916_2049735_-\|tail	phage tail family protein	NA	NA	NA	NA
QAS24580.1\|2049735_2055366_-\|tail	phage tail tape measure protein	A0A1S5SFC1	Streptococcus_phage	4.5e-23	25.2
QAS24581.1\|2055381_2056023_-	hypothetical protein	U3PFU8	Lactobacillus_phage	2.0e-07	30.6
QAS24582.1\|2056019_2056538_-	hypothetical protein	NA	NA	NA	NA
QAS24583.1\|2056656_2057274_-	hypothetical protein	A0A2I7QIP9	Bacillus_phage	1.0e-05	31.8
QAS24584.1\|2057291_2057756_-	hypothetical protein	NA	NA	NA	NA
QAS24585.1\|2057716_2058118_-	hypothetical protein	NA	NA	NA	NA
QAS24586.1\|2058114_2058504_-	hypothetical protein	NA	NA	NA	NA
QAS24587.1\|2058504_2058909_-	hypothetical protein	NA	NA	NA	NA
QAS24588.1\|2059268_2060216_-\|capsid	N4-gp56 family major capsid protein	A8ASJ6	Listeria_phage	3.9e-89	59.5
QAS24589.1\|2060229_2060832_-	hypothetical protein	NA	NA	NA	NA
QAS24590.1\|2060895_2062098_-	hypothetical protein	A0A059T7W2	Listeria_phage	4.0e-38	31.1
QAS24591.1\|2061973_2063569_-\|portal	phage portal protein	B5LPR1	Bacillus_virus	1.3e-84	37.8
QAS24592.1\|2063571_2064897_-\|terminase	PBSX family phage terminase large subunit	A0A1S5SA45	Streptococcus_phage	3.8e-138	55.5
QAS24593.1\|2064877_2065417_-\|terminase	terminase small subunit	O03926	Lactobacillus_phage	9.5e-48	72.6
QAS24594.1\|2065593_2065773_-	hypothetical protein	E9LUP6	Lactobacillus_phage	6.0e-07	49.1
QAS24595.1\|2065833_2066550_-	hypothetical protein	NA	NA	NA	NA
QAS24596.1\|2066830_2066998_-	BC1881 family protein	NA	NA	NA	NA
QAS24597.1\|2067233_2067701_-	hypothetical protein	B4XYT9	Lactobacillus_phage	1.4e-15	40.0
QAS24598.1\|2068160_2068595_-	hypothetical protein	A0A2I7S8E8	Vibrio_phage	3.3e-14	33.8
QAS24599.1\|2068906_2069287_-	hypothetical protein	NA	NA	NA	NA
QAS24600.1\|2069283_2069802_-	hypothetical protein	O03915	Lactobacillus_phage	1.6e-60	72.5
QAS24601.1\|2069798_2070086_-	hypothetical protein	NA	NA	NA	NA
QAS24602.1\|2070082_2071000_-	DUF4373 domain-containing protein	A0A0P0HRQ2	Lactobacillus_phage	1.3e-57	43.2
QAS24603.1\|2071082_2072048_-	hypothetical protein	A6M982	Geobacillus_virus	7.6e-64	53.6
QAS24604.1\|2072059_2072590_-	hypothetical protein	E9LUU0	Lactobacillus_phage	6.7e-54	58.6
QAS24605.1\|2072610_2072724_-	hypothetical protein	NA	NA	NA	NA
QAS24606.1\|2072856_2073027_-	hypothetical protein	NA	NA	NA	NA
QAS24607.1\|2073094_2073607_-	transcriptional regulator	D6PST4	Lactobacillus_phage	7.2e-29	44.1
QAS24608.1\|2073673_2073979_-	DUF771 domain-containing protein	NA	NA	NA	NA
QAS24609.1\|2074239_2074521_+	hypothetical protein	NA	NA	NA	NA
QAS24610.1\|2074677_2074932_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAS24611.1\|2075078_2075582_+	XRE family transcriptional regulator	S6C481	Thermus_phage	3.8e-22	41.4
QAS24612.1\|2075596_2076019_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
QAS24613.1\|2076074_2077043_+	DUF5067 domain-containing protein	NA	NA	NA	NA
QAS24614.1\|2078064_2078241_+	hypothetical protein	NA	NA	NA	NA
QAS24615.1\|2079097_2079457_+	hypothetical protein	NA	NA	NA	NA
QAS24616.1\|2079487_2079769_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
QAS24617.1\|2080019_2081768_+	hypothetical protein	NA	NA	NA	NA
QAS24618.1\|2081821_2082736_+	DNA adenine methylase	NA	NA	NA	NA
QAS24619.1\|2084293_2084500_-	hypothetical protein	NA	NA	NA	NA
2084807:2084828	attL	NA	NA	NA	NA
QAS24620.1\|2084917_2085223_-	hypothetical protein	NA	NA	NA	NA
QAS24621.1\|2085304_2085685_-	hypothetical protein	NA	NA	NA	NA
QAS24622.1\|2085832_2086102_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
QAS24623.1\|2089142_2089343_-	hypothetical protein	NA	NA	NA	NA
QAS24624.1\|2089296_2091000_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	1.1e-121	40.7
QAS24625.1\|2090996_2091470_-\|terminase	phage terminase small subunit P27 family	NA	NA	NA	NA
QAS24626.1\|2092330_2092714_-	HNH endonuclease	A0A1J0MFT4	Staphylococcus_phage	2.5e-18	44.3
QAS24627.1\|2092706_2093045_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
QAS24628.1\|2093031_2093223_-	hypothetical protein	NA	NA	NA	NA
QAS24629.1\|2093237_2093717_-	hypothetical protein	NA	NA	NA	NA
QAS24630.1\|2095254_2096055_-	DNA replication protein	NA	NA	NA	NA
QAS24631.1\|2096068_2096299_-	hypothetical protein	NA	NA	NA	NA
QAS24632.1\|2096418_2096526_-	hypothetical protein	NA	NA	NA	NA
QAS24633.1\|2096568_2096748_-	DNA-binding protein	E9LUT5	Lactobacillus_phage	3.0e-22	89.7
QAS24634.1\|2096904_2097525_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAS24635.1\|2097581_2098739_+\|integrase	site-specific integrase	Q938N9	Temperate_phage	6.6e-54	35.1
2098917:2098938	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage