CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP032126	Pseudomonas aeruginosa strain PAO1161 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas3,DinG,WYL,RT	0	1	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP032126_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP032126_1

343145-343258

Orphan

Consensus_repeat	Method
GGCCAAAGAACTGGAGGGCAAGGTATGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP032126_1

>merge|CP032126|1|343145-343258|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGAGCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGTGGCCAAAGAACTGGAGGGCAAGGTATGA

>CP032126|1|1|343145-343258|CRISPRCasFinder
GGCCAAAGAACTGGAGGGCAAGGTATGA	GCCAGCACAGCGTATCCCGCTCCGTATCCCGTTCAACAGGCTCTCCATCCAGAAGCGT
GGCCAAAGAACTGGAGGGCAAGGTATGA

Protein	Signature genes	Signature genes Name	Protein_function
CP032126.1\|QAS70979.1\|350888_351587_+\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|226274
CP032126.1\|QAS70975.1\|347830_348334_-\|transcriptional-regulator	unknown	unknown	unknown
CP032126.1\|QAS70978.1\|350087_350840_-\|hypothetical-protein	unknown	unknown	unknown
CP032126.1\|QAS70968.1\|336949_338320_+\|aspartate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|180994
CP032126.1\|QAS70963.1\|331032_331698_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP032126.1\|QAS76391.1\|346685_346835_-\|transcriptional-regulator	unknown	unknown	unknown
CP032126.1\|QAS70962.1\|329991_330870_-\|N-carbamoylputrescine-amidase	unknown	unknown	gnl\|CDD\|274553
CP032126.1\|QAS70977.1\|349048_350068_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
CP032126.1\|QAS70976.1\|348438_349050_-\|thiol-disulfide-isomerase	unknown	unknown	gnl\|CDD\|239267
CP032126.1\|QAS70965.1\|333077_334454_-\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP032126.1\|QAS70970.1\|339957_341055_+\|spermidine-binding-periplasmic-protein-SpuE	unknown	unknown	gnl\|CDD\|270377
CP032126.1\|QAS70967.1\|335525_336884_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
CP032126.1\|QAS70980.1\|351608_352163_-\|hypothetical-protein	unknown	unknown	unknown
CP032126.1\|QAS70981.1\|352428_352923_+\|DUF523-domain-containing-protein	unknown	unknown	gnl\|CDD\|224597
CP032126.1\|QAS70969.1\|338435_339539_+\|putrescine-binding-periplasmic-protein-SpuD	unknown	unknown	gnl\|CDD\|270377
CP032126.1\|QAS70974.1\|346799_347852_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378890
CP032126.1\|QAS70966.1\|334732_335485_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|336781
CP032126.1\|QAS70973.1\|344301_346689_-\|penicillin-acylase-family-protein	unknown	unknown	gnl\|CDD\|225241
CP032126.1\|QAS70971.1\|341109_342264_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|183226
CP032126.1\|QAS70964.1\|331760_332822_-\|polyamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270377

Protein	Function_ID	Function_description	E-value
CP032126.1\|QAS70979.1\|350888_351587_+\|2OG-Fe(II)-oxygenase	gnl\|CDD\|226274	COG3751, EGL-9, Predicted proline hydroxylase [Posttranslational modification, protein turnover, chaperones].	2.81845e-78
CP032126.1\|QAS70968.1\|336949_338320_+\|aspartate-aminotransferase-family-protein	gnl\|CDD\|180994	PRK07480, PRK07480, putative aminotransferase; Validated.	0
CP032126.1\|QAS70963.1\|331032_331698_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	8.70235e-09
CP032126.1\|QAS70962.1\|329991_330870_-\|N-carbamoylputrescine-amidase	gnl\|CDD\|274553	TIGR03381, putative_carbon-nitrogen_hydrolase, N-carbamoylputrescine amidase. Members of this family are N-carbamoylputrescine amidase (3.5.1.53). Bacterial genes are designated AguB. The AguAB pathway replaces SpeB for conversion of agmatine to putrescine in two steps rather than one. [Central intermediary metabolism, Polyamine biosynthesis].	0
CP032126.1\|QAS70977.1\|349048_350068_+\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	3.48481e-56
CP032126.1\|QAS70976.1\|348438_349050_-\|thiol-disulfide-isomerase	gnl\|CDD\|239267	cd02969, PRX_like1, Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.	0.0013342
CP032126.1\|QAS70965.1\|333077_334454_-\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.09186e-161
CP032126.1\|QAS70970.1\|339957_341055_+\|spermidine-binding-periplasmic-protein-SpuE	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
CP032126.1\|QAS70967.1\|335525_336884_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	5.71424e-158
CP032126.1\|QAS70981.1\|352428_352923_+\|DUF523-domain-containing-protein	gnl\|CDD\|224597	COG1683, COG1683, Uncharacterized conserved protein [Function unknown].	2.14015e-67
CP032126.1\|QAS70969.1\|338435_339539_+\|putrescine-binding-periplasmic-protein-SpuD	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	0
CP032126.1\|QAS70974.1\|346799_347852_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|378890	pfam12625, Arabinose_bd, Arabinose-binding domain of AraC transcription regulator, N-term. AraC is a bacterial transcriptional regulatory protein with a DNA-binding domain at the C-terminus, HTH_AraC, pfam00165, and this dimerization domain which harbours the arabinose-binding pocket at the N-terminus. AraC positively and negatively regulates expression of the proteins required for the uptake and catabolism of the sugar L-arabinose 1,2,3].	2.54039e-32
CP032126.1\|QAS70966.1\|334732_335485_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|336781	pfam07722, Peptidase_C26, Peptidase C26. These peptidases have gamma-glutamyl hydrolase activity; that is they catalyze the cleavage of the gamma-glutamyl bond in poly-gamma-glutamyl substrates. They are structurally related to pfam00117, but contain extensions in four loops and at the C-terminus.	1.81471e-108
CP032126.1\|QAS70973.1\|344301_346689_-\|penicillin-acylase-family-protein	gnl\|CDD\|225241	COG2366, COG2366, Protein related to penicillin acylase [General function prediction only].	0
CP032126.1\|QAS70971.1\|341109_342264_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|183226	PRK11607, potG, putrescine ABC transporter ATP-binding subunit PotG.	0
CP032126.1\|QAS70964.1\|331760_332822_-\|polyamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270377	cd13659, PBP2_PotF, The periplasmic substrate-binding component of an ABC putrescine transport system and related proteins; contains the type 2 periplasmic-binding fold. This group represents the periplasmic substrate-binding domain that serves as the primary polyamine receptor of ABC-type putrescine-preferential transporter from gram-negative bacteria. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.00795e-165

>CP032126.1|QAS70971.1|341109_342264_+|polyamine-ABC-transporter-ATP-binding-protein
MAIASGAYKKALEGNQQPKEVLVKIDRVTKQFDETLAVDTVSLTINKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIFLDGQDITDLPPYERPINMMFQSYALFPHMSVAQNIAFGLKQDGLPKAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQRIAIMHLGCIEQIGSPMDIYETPASRLVCEFIGNVNLFDGVLVEDVQDHAVIACPQLENPIYIGHGISTRAEDKRITYALRPEKVMISAQKPDNLEHAGHNWAQGTVYDIAYLGGHSVYYIKLASGMIVQAFMANAERHVARPTWDQSVYISWYDDSGVVLQS
>CP032126.1|QAS70970.1|339957_341055_+|spermidine-binding-periplasmic-protein-SpuE
MQHSIGKTLLVAALATAIAGPVQAEKKSLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKVKEVLGDQPIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVIPKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIKTGK
>CP032126.1|QAS70969.1|338435_339539_+|putrescine-binding-periplasmic-protein-SpuD
MMKRFGKTLLALTLAGSVAGMAQAADNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSGK
>CP032126.1|QAS70968.1|336949_338320_+|aspartate-aminotransferase-family-protein
MNSQITNAKTREWQALSRDHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAATRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYWATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKALHEQGDFPIPGIVHIAQPYWYGEGGDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYDILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEVLNQGGEFYHGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADHPLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPLVIDPSQIDELITLARKCLDQTAAAVLA
>CP032126.1|QAS70967.1|335525_336884_+|glutamine-synthetase
MTTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFIAEKGMRLPESVLLQTVTGDYVEDDIYYDLLDPADIDMVCRPDENAVFLVPWAIEPTAMVIHDTFDKLGNPIELSPRNILKRVLKMYADKGWRPIVAPEMEFYLTKRSDDPDYPLQAPVGRSGRQETGRQSFSIDAANEFDPLFEDMYDWCEAQGLDLDTLIHEEGTAQMEINFRHGDALDLADQILVFKRTMREAALKHNVAATFMAKPMTGEPGSAMHLHQSIVDVKTGKNIFSNADGTMSELFLHHIGGLQKFIPEVLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPDSSPENRRVENRLAGADANPYLALAASLLCGYIGMVEGIKPSAQVKGRGYERRNLRLPLTIEAALERMENCKPLEQYLGSKFISGYVAVKRAEHENFKRVISSWEREFLLLSV
>CP032126.1|QAS70966.1|334732_335485_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MSRLPLIGVTACTKQIGLHPYHIAGDKYLRAVVNGAGGLPLIIPALGESIDQAALLDSVDGLLFTGSPSNVEPRHYSGPASEPGTLHDSDRDATTLPLVRAAIDAGIPVLGICRGFQEMNVAFGGSLHQKVHEVGTFMDHREPADQPLEVQYAPRHAMHVQPGGVLAGIGLPSEFQVNSIHGQGVDRLAPGLRVEALAPDGLVEAISVEGAKAFALGVQWHPEWQVLTNPNYLAIFQAFGKACSKRAGQR
>CP032126.1|QAS70965.1|333077_334454_-|glutamine-synthetase
MSVPQRAVQLTEPSEFLKEHPEVQFVDLLIADMNGVVRGKRIERNSLNKVFEKGINLPASLFALDITGSTVESTGLGLDIGDADRICYPIPGTLSMEPWQKRPTAQLLMTMHELEGEPFFADPREVLRQVVARFTEMELTIVAAFELEFYLIDQENVNGRPQPPRSPISGKRPQSVQVYSIDDLDEYVECLQDIIDGARAQGIPADAIVAESAPAQFEVNLNHVNDALKACDHAVLLKRLVKNIAYDHEMDTTFMAKPYPGQAGNGLHVHISLLDKHGNNIFTSEDPEQNAALRHAIGGVLETLPASMAFLCPNVNSYRRFGSQFYVPNAPSWGLDNRTVALRVPTGSPDAVRLEHRVAGADANPYLLLAAVLAGVHHGLTNKVEPGAPIEGNSYEQMEPSLPNNLRDALRELDESEIMAKYIDPKYIDIFVACKESELEEFEHSISDLEYNWYLHTV
>CP032126.1|QAS70964.1|331760_332822_-|polyamine-ABC-transporter-substrate-binding-protein
MPRLSALLFLALAPWLAQAEETLRVYNWNDYIDPQVLESFQKDTGIRVEYHTFATAEELDKALRSGEAIDVAVPSHDTLPALLKDNLLRPLDFTQLPNRSHLDRQLLSKLAAVDPDNRHAVPYLWGAVGLAINTPQAEAAYGGPLPNSWSLLFDASQSQRLKSCGISLLDAPDETLAILLNYQGRNLGRTAPSQVRRAAEALHGLRPNLRYVDSERYIADLEGGRLCLAMAWVGDALRAAKAGQPVSFEVPQEGSVLFIDNLVIPAGAQHPREAHRFIDYLMQPKIAAQITAATLYPSGNADAAGFLDPALRQQPGLYPDRDTSRRLFALETPPEKLRPVVDEIWKAFRGASH
>CP032126.1|QAS70963.1|331032_331698_-|TetR/AcrR-family-transcriptional-regulator
MQPTSPTRKPRASSQARIAAILDAARGLLADEGIGGLSIYSVAERAEMPPSSVYHFFPSVPALLQGLTGEVHAAFRACLEQPVDHAGLRCWRDLSRIVEERMLAVYARDAAARQLILASHGLAEVTQADRQHDVQLGQAMRALFERHFLLPPLPTDIEIFSLAMELGDRVYALSVQRHGIIDARLAEEGMRVFDAYLGLYLPPILEKRSEPLSGFISDLNR
>CP032126.1|QAS70962.1|329991_330870_-|N-carbamoylputrescine-amidase
MTRNVTVAATQMACSWDRPANIARAEKLVRQAAARGAQIILIQELFETPYFCQKPNPDYLQLATTVEENAAIAHFQALARELQVVLPISFFERAGRARFNSIAVIDADGGNLGVYRKSHIPDGPGYHEKYYFNPGDTGFKVWQTRYARIGVGICWDQWFPESARSMALLGAELLFYPTAIGSEPHDASISSRDHWQRVQQGHAGANLMPLVASNRIGREEQDGYDITFYGSSFIADPFGEKVEELNRTEEGILVHTFDLDALERTRSAWGVFRDRRPNLYGPLKTLDGSLES
>CP032126.1|QAS70973.1|344301_346689_-|penicillin-acylase-family-protein
MKRTLTVIAVAVAAAAAGGAWYLHAKQPLRNGSLALAHLQAPVDVRYDERGVPHLYAQNQTDLYRALGYVHAQDRLFQMEMLRRLARGELAEVLGPKLVDTDRLFRTLRIRDHAAEYSARQDKQSQPWKVLEAYLDGVNQFQENNPAPLEFDLLGIPRRPFTPEDTLSIAGYMAYSFAAAFRTEPVLTYIRDELGSDYLRIFDLDWHPQGVLTPSGALGAGDWKDLGALARLSQQALEDAGLPQFEGSNAWVVAGSRTASGKPLLAGDPHIRFAAPAVWYEAQLSAPGFELYGHHQALNPFASLGHNRAFGWSLTMFQNDDLDLVAEKVNPDNPNQVWYQGEWVDLQSEEQEIAVKGAAPVKLTLRRSPHGPIVNDALGASSGKTPIAMWWAFLETENPVLDAFYQLNRADTLAKARAAASKIHSPGLNLVWANAAGDIGWWASAALPKRPEGVNPSFILDGSKGEADKSGFYPFADNPQEENPARGYIVSANFQPVPANGRPIPGYYNLADRGQWLDTQLADRGTKWNLDNSRALQLGNRTGYAPRLLAPLLPVLREVVDDAEGKRLVEQLAAWNGDYPVDSTAATLFNQLLFQIAEGALHDELGDAFFDSLIATRAIDSALPRLAGDADSPWWDDRRTERRETRADIVRTAWNASLAHLRGTLGNDPSGWLWGKAHTLTHEHALGQQALLRRLLNVGPFAAPGTHEVPNNLSAKIGPAPWAVTYGPSTRRLVDFADPTHSLGINPVGQSGVPFDGHYDDQAEAYIEGHYLPQHYEENEVKANSKGVLVLEPKR
>CP032126.1|QAS76391.1|346685_346835_-|transcriptional-regulator
MGQGAGRRVVLHGGSSRLTKDFQGPSIRSMPRAGGIRRMLGTTTRRKDR
>CP032126.1|QAS70974.1|346799_347852_+|AraC-family-transcriptional-regulator
MQDDPSTSPLTHSATLRRLLYEALDALGLDPTRVYRSVYRRIPLPPPTLGGRLVHDNAPLFWTELAAVTGDADIGLHLGEAMKPRLLDVVGYLLLSARDLEEALRSFVRFQHILSGGFAARLEVEGETARLILDINYLGYASLRQQIECLMLLFLKLLALISDDEFVAERIEFRHRAPPRLGEHRRLFGRLPLFSRPHDALVFSAALLRRPSRNANPDMHDVLTRHAEEQSRELSENRLLNRVRYLIELRLGEGYGLRQCAAELGLGSGALQRALAAGGASFRQVRDEVRRQRASEMLLAGRAIREVAKACGFAELSPFYRAFRRWHAAPPEQYRARLAKREEGYSTSGT
>CP032126.1|QAS70975.1|347830_348334_-|transcriptional-regulator
MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE
>CP032126.1|QAS70976.1|348438_349050_-|thiol-disulfide-isomerase
MASLAPVFRVNAMTPRRKTLLVSLVGLLWAGGLLAAYWWFEIRYIRPFSEQTTLFSGDSLRLPAELAGPGAIRLVHFWDPACPCNVGNQQHLGELIERFAGKGVEFHVLQKPGSQGRLPDNLAALRALAGLPGSEQLPASPAVAIWDRDGRLAYFGPYSEGAVCTSSNSFIEPILEALLQGRPVDATHTLAVGCYCPWTPEKG
>CP032126.1|QAS70977.1|349048_350068_+|alpha/beta-hydrolase
MCSRAAEYPWVSPVARPRIDCSPEPPMSEAFNPDYLRQHLRPLAAAEADAAVLAYQAYYGLDLRSRHPRLQARLGSMAVDGRRLAVQAWLLPEARGSLLLMHGYYDHMGLYRHVVDWALGMGFSVLACDLPGHGLSEGERASIRDFAEYQAVFKGLLGQAAELDLAAPWHLCGQSTGGAILLDYLLHGGERPELGETILLAPLVRPRAWGWSKLSYRLLSPFVDSIPRRFSENSSDPQFLDFLREHDPLQPRTLPTAWVGALTRWVPRIERAPRRALSPLVVQGESDETVDWRHGLKVLREKFDEPRILLLEEARHHLANESEGLRRRYFDFLSDALGA
>CP032126.1|QAS70978.1|350087_350840_-|hypothetical-protein
MRALLAFALLLVGLPALADPYQRLYQAAGWPDQRAHFSDALDAAQKRYQDKLPPALYQTLVDNSNRRFAPAEVDQRALNGLRENLPDSASPLNFFESPLGRKVVAAEVLATRRDQLLQHSNGLPRQTASEPRRALVKRLAQVLPAREAGAEVSLALAGVAADSLSQMLPGLPGLLGGGQTGQLLEGQRQRLVQQIGADLENTLLYVYRDLSDAELTQYVNFAESPAGRSYYQAALAALKAGLAVDQAVAP
>CP032126.1|QAS70979.1|350888_351587_+|2OG-Fe(II)-oxygenase
MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESEACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
>CP032126.1|QAS70980.1|351608_352163_-|hypothetical-protein
MLPTRSLLPFFLAPALLASAASQAAMEALDNDSLSQVTGQAGISLRLDLRAGAARVAWVDDGGSLSLRNLVIDNGCVKAGDCPDGRGGNIPLGAAQLGLSLPIFGVEQPTLALDVTTGSGGGQQLAISLPDLATINDQLIASGLPAQRIRLRVASDLYIGDNSIGRIELRDITDLRGTIKVWGH
>CP032126.1|QAS70981.1|352428_352923_+|DUF523-domain-containing-protein
MQKVLVSRCLLGHLVRYDGGSHGPFDLLSRWHAQGRIVALCPEVAGGLPTPRPPAEIPGGQGGEVLDRLNRVFTVDGEDVSEAFLLGAEAAVELVRRHDIRMAVLKARSPSCGNLENYDGRFNGNRVAGEGVTAAALKRMGVLVFNEDELDRAAVCLAGLDAGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP032126_2	2.1\|5089678\|52\|CP032126\|CRISPRCasFinder	5089678-5089729	52	NC_016138	Pseudomonas aeruginosa plasmid pUM505, complete sequence	10884-10935	0	1.0

1. spacer 2.1|5089678|52|CP032126|CRISPRCasFinder matches to NC_016138 (Pseudomonas aeruginosa plasmid pUM505, complete sequence) position: , mismatch: 0, identity: 1.0

tacgccatggaactgcggcatgaaggggcttctcgcgcgaggacgctcgtcg	CRISPR spacer
tacgccatggaactgcggcatgaaggggcttctcgcgcgaggacgctcgtcg	Protospacer
****************************************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

54120 : 108228

Dishui_lake_phycodnavirus(25.0%)

plate,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS70709.1\|54120_54822_+\|transposase	transposase	NA	NA	NA	NA
QAS70710.1\|55088_55325_+	hypothetical protein	NA	NA	NA	NA
QAS70711.1\|55511_55757_+	hypothetical protein	NA	NA	NA	NA
QAS70712.1\|55753_56074_+	hypothetical protein	NA	NA	NA	NA
QAS70713.1\|56168_56447_+\|transposase	transposase	NA	NA	NA	NA
QAS70714.1\|56545_56941_+	hypothetical protein	NA	NA	NA	NA
QAS70715.1\|56954_57215_-	hypothetical protein	NA	NA	NA	NA
QAS70716.1\|57211_58594_-	DUF4010 domain-containing protein	NA	NA	NA	NA
QAS70717.1\|58785_60159_+	exoenzyme T	NA	NA	NA	NA
QAS70718.1\|60655_61342_+	curli production assembly protein CsgG	NA	NA	NA	NA
QAS70719.1\|61372_61726_+	DUF4810 domain-containing protein	NA	NA	NA	NA
QAS70720.1\|61722_62388_+	hypothetical protein	NA	NA	NA	NA
QAS70721.1\|62402_62786_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAS70722.1\|63067_64729_-	hypothetical protein	NA	NA	NA	NA
QAS70723.1\|65338_65479_+	hypothetical protein	NA	NA	NA	NA
QAS70724.1\|66302_68135_+	asparagine synthase (glutamine-hydrolyzing)	A0A2K9R7N5	Dishui_lake_phycodnavirus	2.7e-17	28.3
QAS70725.1\|68187_68616_-	cupin domain-containing protein	NA	NA	NA	NA
QAS70726.1\|69542_70091_-	RNA 2'-phosphotransferase	A0A2R2ZGT8	Clostridioides_phage	6.1e-34	41.6
QAS70727.1\|70129_70636_-	DUF1993 family protein	NA	NA	NA	NA
QAS70728.1\|70701_71622_-	LysR family transcriptional regulator	NA	NA	NA	NA
QAS70729.1\|71729_72617_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
QAS70730.1\|72679_73384_+	DsbA family protein	NA	NA	NA	NA
QAS70731.1\|73467_73923_+	OsmC family peroxiredoxin	NA	NA	NA	NA
QAS70732.1\|74033_74267_+	DUF1161 domain-containing protein	NA	NA	NA	NA
QAS70733.1\|74278_74716_-	hypothetical protein	NA	NA	NA	NA
QAS70734.1\|74772_75189_-	hypothetical protein	NA	NA	NA	NA
QAS76382.1\|75280_76408_+	aminopeptidase	NA	NA	NA	NA
QAS70735.1\|76415_77399_-	hypothetical protein	NA	NA	NA	NA
QAS70736.1\|77431_78097_-	HAD family hydrolase	NA	NA	NA	NA
QAS70737.1\|78089_78632_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
QAS70738.1\|78709_80755_+	oligopeptidase A	NA	NA	NA	NA
QAS70739.1\|80751_81027_+	YheV family putative metal-binding protein	NA	NA	NA	NA
QAS70740.1\|81115_82174_+	PA0069 family radical SAM protein	NA	NA	NA	NA
QAS70741.1\|82403_83318_-	type VI secretion-associated lipoprotein TagQ	NA	NA	NA	NA
QAS70742.1\|83379_85092_-	type VI secretion protein	NA	NA	NA	NA
QAS70743.1\|85084_86284_-	ABC transporter permease	NA	NA	NA	NA
QAS70744.1\|86283_87003_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-18	36.3
QAS70745.1\|86999_90098_-	VWA domain-containing protein	M1PCM5	Moumouvirus	2.5e-23	27.8
QAS70746.1\|90105_90834_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
QAS70747.1\|90843_91524_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
QAS70748.1\|91520_95051_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
QAS70749.1\|95047_96397_-	DotU family type VI secretion system protein	NA	NA	NA	NA
QAS70750.1\|96403_97738_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
QAS70751.1\|97753_98218_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
QAS70752.1\|98262_99756_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
QAS70753.1\|100123_101158_+	type VI secretion system protein TssA	NA	NA	NA	NA
QAS70754.1\|101246_101765_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
QAS70755.1\|101777_103274_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
QAS70756.1\|103349_103838_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
QAS70757.1\|104005_104851_+	tetratricopeptide repeat protein	NA	NA	NA	NA
QAS70758.1\|104852_105362_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
QAS70759.1\|105358_107218_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
QAS70760.1\|107181_108228_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA

DBSCAN-SWA_2

630140 : 721555

Pseudomonas_phage(35.56%)

plate,tail,tRNA,holin,integrase

attL 626402:626418|attR 632349:632365

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
626402:626418	attL	NA	NA	NA	NA
QAS71252.1\|630140_630278_-\|integrase	integrase	NA	NA	NA	NA
QAS71253.1\|630524_634262_-	bifunctional diguanylate cyclase/phosphodiesterase	A0A127AWB9	Bacillus_phage	4.8e-13	35.4
632349:632365	attR	NA	NA	NA	NA
QAS71254.1\|634368_636222_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	1.2e-36	33.8
QAS71255.1\|636301_638296_-	DNA primase	A0A0K1LMQ9	Caulobacter_phage	3.8e-73	40.7
QAS71256.1\|638378_638828_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.0e-18	38.8
QAS71257.1\|638897_639113_-	30S ribosomal protein S21	NA	NA	NA	NA
QAS71258.1\|639313_640339_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.7e-109	58.1
QAS71259.1\|640417_640987_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
QAS71260.1\|641070_641424_+	dihydroneopterin aldolase	NA	NA	NA	NA
QAS71261.1\|641414_641957_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
QAS71262.1\|641929_643162_-\|tRNA	multifunctional CCA tRNA nucleotidyl transferase/2'3'-cyclic phosphodiesterase/2'nucleotidase/phosphatase	A0A076G5T8	Escherichia_phage	3.5e-77	43.1
QAS71263.1\|643205_643712_-	DUF4136 domain-containing protein	NA	NA	NA	NA
QAS71264.1\|643805_645359_-	SpoVR family protein	NA	NA	NA	NA
QAS71265.1\|645355_646627_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	4.2e-09	37.2
QAS71266.1\|646727_648650_-	PrkA family serine protein kinase	NA	NA	NA	NA
QAS71267.1\|648928_649261_-	thiosulfate sulfurtransferase	NA	NA	NA	NA
QAS71268.1\|649304_650156_-	bis(5'-nucleosyl)-tetraphosphatase (symmetrical)	A0A2H4J0P0	uncultured_Caudovirales_phage	1.1e-08	33.3
QAS71269.1\|650155_650536_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
QAS71270.1\|650572_651379_-	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
QAS71271.1\|651494_652481_-	4-hydroxythreonine-4-phosphate dehydrogenase 1	NA	NA	NA	NA
QAS71272.1\|652477_653770_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
QAS71273.1\|653750_656525_-	LPS-assembly protein LptD	NA	NA	NA	NA
QAS71274.1\|656651_657668_+	aminoglycoside phosphotransferase	NA	NA	NA	NA
QAS71275.1\|657664_658339_+	nucleotidyltransferase family protein	NA	NA	NA	NA
QAS71276.1\|658340_659099_+	molecular chaperone DjlA	NA	NA	NA	NA
QAS71277.1\|659099_660161_-	DUF3530 family protein	NA	NA	NA	NA
QAS71278.1\|660312_662706_+	PAS domain S-box protein	NA	NA	NA	NA
QAS71279.1\|662751_663384_+	DNA-binding response regulator	NA	NA	NA	NA
QAS71280.1\|663512_664547_+	extracellular solute-binding protein	NA	NA	NA	NA
QAS71281.1\|664780_665890_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.8e-28	34.4
QAS71282.1\|665945_666992_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
QAS71283.1\|667106_668354_+	ABC transporter permease	NA	NA	NA	NA
QAS71284.1\|668459_669290_+	ABC transporter permease	NA	NA	NA	NA
QAS71285.1\|669413_670088_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
QAS71286.1\|670087_670906_+	phosphoglycolate phosphatase	NA	NA	NA	NA
QAS71287.1\|670978_672457_+	anthranilate synthase component I	NA	NA	NA	NA
QAS71288.1\|672775_673090_-	transcription regulatory protein PrtN	NA	NA	NA	NA
QAS71289.1\|673189_673960_-	transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	1.4e-71	59.1
QAS71290.1\|674417_674618_+	repressor PtrB	W6ATC1	Enterobacter_phage	3.7e-05	58.3
QAS71291.1\|674665_675025_+	hypothetical protein	NA	NA	NA	NA
QAS71292.1\|675388_675838_+\|holin	holin	B5TK61	Pseudomonas_phage	5.0e-26	53.3
QAS71293.1\|675859_676375_+	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	4.1e-32	42.9
QAS71294.1\|676371_676929_+\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	4.6e-45	71.1
QAS71295.1\|677081_677408_+	bacteriophage protein	A0A2H4JA09	uncultured_Caudovirales_phage	2.4e-30	60.2
QAS71296.1\|677404_678292_+	bacteriophage protein	S4TNY7	Salmonella_phage	5.3e-88	59.8
QAS71297.1\|678284_678818_+\|tail	phage tail protein I	Q9ZXK7	Pseudomonas_virus	3.0e-62	64.6
QAS71298.1\|678819_680895_+	bacteriophage protein	Q9ZXK6	Pseudomonas_virus	5.1e-198	50.2
QAS71299.1\|680891_681350_+\|tail	phage tail protein	NA	NA	NA	NA
QAS71300.1\|681392_682553_+\|tail	phage tail sheath family protein	Q38068	Phage_PS17	2.0e-188	83.2
QAS71301.1\|682565_683069_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	8.0e-65	73.5
QAS71302.1\|683083_683428_+\|tail	phage tail assembly protein	NA	NA	NA	NA
QAS71303.1\|683597_685835_+\|tail	phage tail tape measure protein	NA	NA	NA	NA
QAS71304.1\|685844_686717_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.5e-74	51.4
QAS71305.1\|686691_686898_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.3e-18	64.2
QAS71306.1\|686955_687945_+	phage late control D family protein	A0A2H4JBF6	uncultured_Caudovirales_phage	7.5e-107	55.8
QAS71307.1\|687977_688607_+	glycoside hydrolase family 19 protein	A0A125RNP1	Pseudomonas_phage	1.6e-86	78.0
QAS76395.1\|688603_688966_+	hypothetical protein	H2BDA0	Pseudomonas_phage	1.9e-15	47.9
QAS71308.1\|688962_689220_+	hypothetical protein	A0A125RNP3	Pseudomonas_phage	8.3e-18	64.6
QAS71309.1\|689234_689465_+	hypothetical protein	NA	NA	NA	NA
QAS71310.1\|689535_690030_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	1.4e-45	56.5
QAS71311.1\|690041_690389_+	hypothetical protein	NA	NA	NA	NA
QAS71312.1\|690418_690673_+	hypothetical protein	A0A2H4PI34	Pseudomonas_phage	6.3e-10	38.4
QAS71313.1\|690719_692555_+\|tail	phage tail tape measure protein	A0A0S2SYD9	Pseudomonas_phage	1.2e-28	36.2
QAS71314.1\|692547_692889_+\|tail	phage tail protein	Q6UAW6	Klebsiella_phage	1.4e-17	40.0
QAS71315.1\|692896_693592_+\|tail	phage minor tail protein L	A0A1B0VNE0	Pseudomonas_phage	9.7e-69	49.8
QAS71316.1\|693594_694365_+\|tail	phage tail protein	A0A2D1GNP8	Pseudomonas_phage	4.2e-81	55.6
QAS71317.1\|694419_695022_+\|tail	tail assembly protein	A0A1V0E8A0	Vibrio_phage	2.2e-53	57.8
QAS71318.1\|695080_698695_+	DUF1983 domain-containing protein	A0A0S2SYC5	Pseudomonas_phage	0.0e+00	54.7
QAS76396.1\|698930_699719_+	hypothetical protein	NA	NA	NA	NA
QAS71319.1\|699742_700834_+	hypothetical protein	A0A0S2SY45	Pseudomonas_phage	1.3e-46	36.9
QAS71320.1\|700833_701169_+	hypothetical protein	NA	NA	NA	NA
QAS71321.1\|701149_701380_+	hypothetical protein	A0A1W6JT87	Pseudomonas_phage	3.3e-18	62.7
QAS71322.1\|701475_702528_+\|tail	phage tail protein	A0A0H5AXZ9	Pseudomonas_phage	4.6e-62	52.2
QAS71323.1\|702527_702830_+	hypothetical protein	A0A0H5B141	Pseudomonas_phage	4.4e-34	71.0
QAS71324.1\|702826_703057_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	8.2e-25	71.6
QAS71325.1\|703475_704081_+	glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	4.6e-75	66.3
QAS71326.1\|704082_705132_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.8e-111	57.8
QAS71327.1\|705128_705965_+	indole-3-glycerol-phosphate synthase	A0A0P0IR83	Acinetobacter_phage	2.1e-70	56.9
QAS71328.1\|706026_706671_-	cyclic AMP receptor-like protein	NA	NA	NA	NA
QAS71329.1\|706942_707365_+	OsmC family protein	NA	NA	NA	NA
QAS71330.1\|707684_708479_+	S-adenosylmethionine decarboxylase proenzyme	NA	NA	NA	NA
QAS71331.1\|708533_709181_-	2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinone monooxygenase	NA	NA	NA	NA
QAS71332.1\|709280_709619_-	histidine triad nucleotide-binding protein	NA	NA	NA	NA
QAS71333.1\|709697_711179_+	AAA family ATPase	U5XJW0	Phormidium_phage	6.0e-68	34.0
QAS71334.1\|711218_712019_-	SDR family oxidoreductase	NA	NA	NA	NA
QAS71335.1\|712079_713156_-	DUF805 domain-containing protein	NA	NA	NA	NA
QAS71336.1\|713277_714246_-	nitronate monooxygenase	NA	NA	NA	NA
QAS71337.1\|714262_714685_-	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
QAS71338.1\|714975_716010_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
QAS71339.1\|716009_716729_+	hypothetical protein	NA	NA	NA	NA
QAS71340.1\|716729_717152_+	polymer-forming cytoskeletal family protein	NA	NA	NA	NA
QAS71341.1\|717229_717580_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	3.0e-26	53.2
QAS71342.1\|717633_718725_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
QAS76397.1\|718727_720071_-	peptidase M23	O03937	Lactobacillus_phage	3.0e-18	44.1
QAS71343.1\|720355_721555_+\|tRNA	Tyrosine--tRNA ligase 2	NA	NA	NA	NA

DBSCAN-SWA_3

1455237 : 1464266

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS76422.1\|1455237_1455873_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.0e-40	52.3
QAS71993.1\|1455918_1456812_+	lipoprotein NlpD/LppB	A0A0S2SXL7	Bacillus_phage	3.0e-06	34.3
QAS71994.1\|1456916_1457921_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	7.0e-36	37.3
QAS71995.1\|1458347_1458671_-	Ferredoxin 1	NA	NA	NA	NA
QAS71996.1\|1458737_1461305_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	3.2e-24	22.1
QAS71997.1\|1461284_1461449_+	TolB-like translocation protein	NA	NA	NA	NA
QAS71998.1\|1461430_1462438_-	TolB-like translocation protein	NA	NA	NA	NA
QAS71999.1\|1462585_1463092_+	CinA family protein	B5TK85	Pseudomonas_phage	8.1e-57	76.0
QAS72000.1\|1463225_1464266_+	DNA recombination/repair protein RecA	A0A0S2MVG1	Bacillus_phage	1.5e-113	59.5

DBSCAN-SWA_4

2561124 : 2568018

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS73009.1\|2561124_2562405_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.4
QAS73010.1\|2562406_2563804_+	siroheme synthase	NA	NA	NA	NA
QAS73011.1\|2563808_2564783_-	glutathione S-transferase family protein	NA	NA	NA	NA
QAS73012.1\|2564870_2565854_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	9.3e-142	74.3
QAS73013.1\|2565850_2566186_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.5e-38	69.4
QAS73014.1\|2566182_2566488_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
QAS73015.1\|2566487_2566847_-	sulfurtransferase TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.4e-34	61.7
QAS73016.1\|2566843_2567239_-	sulfurtransferase TusD	A0A2H4JA39	uncultured_Caudovirales_phage	2.7e-47	72.1
QAS73017.1\|2567349_2568018_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	1.5e-90	82.1

DBSCAN-SWA_5

4718634 : 4726267

Pseudomonas_phage(100.0%)

coat,integrase

attL 4717664:4717690|attR 4729990:4730016

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4717664:4717690	attL	NA	NA	NA	NA
QAS74904.1\|4718634_4719618_-\|integrase	bacteriophage integrase	Q56VN7	Pseudomonas_phage	4.7e-93	52.6
QAS74905.1\|4719617_4720910_-	hypothetical protein	Q56VN8	Pseudomonas_phage	2.8e-247	94.2
QAS74906.1\|4721139_4722414_-	hypothetical protein	Q56VN9	Pseudomonas_phage	2.1e-202	88.7
QAS74907.1\|4722417_4722774_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
QAS74908.1\|4722778_4724041_-	attachment protein	Q56VP1	Pseudomonas_phage	3.0e-52	56.0
QAS74909.1\|4724176_4724425_-\|coat	phage coat protein B	Q56VP2	Pseudomonas_phage	2.0e-32	92.7
QAS74910.1\|4724437_4724689_-	hypothetical protein	NA	NA	NA	NA
QAS74911.1\|4724701_4724794_-	hypothetical protein	Q56VP4	Pseudomonas_phage	7.3e-09	100.0
QAS74912.1\|4724810_4725245_-	phage destabilizing protein	Q56VP5	Pseudomonas_phage	5.1e-60	86.1
QAS74913.1\|4725379_4725757_-	hypothetical protein	Q56VP6	Pseudomonas_phage	9.9e-60	97.6
QAS74914.1\|4725760_4726051_-	hypothetical protein	Q56VP7	Pseudomonas_phage	7.4e-55	96.9
QAS74915.1\|4726054_4726267_-	hypothetical protein	Q56VP8	Pseudomonas_phage	7.6e-33	95.7
4729990:4730016	attR	NA	NA	NA	NA

DBSCAN-SWA_6

5137639 : 5190556

Shigella_phage(12.5%)

transposase,integrase

attL 5143568:5143582|attR 5161000:5161014

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS75273.1\|5137639_5138792_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.6e-47	44.4
QAS75274.1\|5138975_5144018_+	nuclease	NA	NA	NA	NA
5143568:5143582	attL	NA	NA	NA	NA
QAS75275.1\|5144017_5145442_+	hypothetical protein	NA	NA	NA	NA
QAS75276.1\|5145878_5148041_-\|integrase	integrase	NA	NA	NA	NA
QAS75277.1\|5148037_5149057_-\|integrase	site-specific integrase	NA	NA	NA	NA
QAS75278.1\|5149112_5149268_-	DNA-directed DNA polymerase	I6RSM4	Salmonella_phage	3.6e-08	62.2
QAS75279.1\|5149606_5150023_-	hypothetical protein	NA	NA	NA	NA
QAS75280.1\|5150041_5151724_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	5.3e-36	26.4
QAS75281.1\|5151756_5152191_-	mercury transporter MerC	NA	NA	NA	NA
QAS75282.1\|5152203_5152479_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
QAS75283.1\|5152492_5152843_-	mercuric ion transporter MerT	NA	NA	NA	NA
QAS75284.1\|5152914_5153325_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
QAS75285.1\|5153467_5153650_-	hypothetical protein	NA	NA	NA	NA
QAS75286.1\|5153888_5154242_-	TetR family transcriptional regulator	NA	NA	NA	NA
QAS75287.1\|5154313_5155396_-\|integrase	site-specific integrase	NA	NA	NA	NA
QAS75288.1\|5156147_5157764_-	hypothetical protein	NA	NA	NA	NA
QAS75289.1\|5157774_5158932_-\|integrase	site-specific integrase	NA	NA	NA	NA
QAS75290.1\|5159156_5159588_-	phage repressor protein	A0A2H4J538	uncultured_Caudovirales_phage	1.0e-20	46.6
QAS75291.1\|5159692_5160376_+	DUF159 family protein	A0A2K8I970	Pseudomonas_phage	1.1e-88	67.0
QAS75292.1\|5160433_5160697_-	hypothetical protein	L7TP56	Pseudomonas_virus	1.4e-28	68.2
QAS75293.1\|5160968_5161241_-	hypothetical protein	NA	NA	NA	NA
5161000:5161014	attR	NA	NA	NA	NA
QAS75294.1\|5161458_5162157_+	methyl-accepting chemotaxis protein	NA	NA	NA	NA
QAS75295.1\|5162167_5162923_+	TIGR03759 family integrating conjugative element protein	NA	NA	NA	NA
QAS75296.1\|5162907_5163489_+	lytic transglycosylase domain-containing protein	NA	NA	NA	NA
QAS75297.1\|5163485_5163986_+	integrating conjugative element protein	NA	NA	NA	NA
QAS75298.1\|5163994_5164264_+	hypothetical protein	NA	NA	NA	NA
QAS75299.1\|5164267_5166499_+	conjugative coupling factor TraD, PFGI-1 class	NA	NA	NA	NA
QAS75300.1\|5166498_5167245_+	TIGR03747 family integrating conjugative element membrane protein	NA	NA	NA	NA
QAS75301.1\|5167255_5168737_+	DNA helicase	A0A2I7RIK5	Vibrio_phage	1.5e-39	30.5
QAS75302.1\|5169608_5169809_-	hypothetical protein	NA	NA	NA	NA
QAS75303.1\|5170022_5170334_-	DUF2845 domain-containing protein	NA	NA	NA	NA
QAS75304.1\|5170506_5170806_+	hypothetical protein	NA	NA	NA	NA
QAS75305.1\|5170877_5171237_+	type III effector Hop protein	NA	NA	NA	NA
QAS75306.1\|5171233_5171473_+	TIGR03758 family integrating conjugative element protein	NA	NA	NA	NA
QAS75307.1\|5171490_5171847_+	TIGR03745 family integrating conjugative element membrane protein	NA	NA	NA	NA
QAS75308.1\|5171857_5172244_+	TIGR03750 family conjugal transfer protein	NA	NA	NA	NA
QAS75309.1\|5172240_5172900_+	TIGR03746 family integrating conjugative element protein	NA	NA	NA	NA
QAS76546.1\|5172896_5173781_+	TIGR03749 family integrating conjugative element protein	NA	NA	NA	NA
QAS75310.1\|5173764_5175270_+	TIGR03752 family integrating conjugative element protein	NA	NA	NA	NA
QAS75311.1\|5175247_5175691_+	TIGR03751 family conjugal transfer lipoprotein	NA	NA	NA	NA
QAS75312.1\|5175690_5178633_+	conjugative transfer ATPase	NA	NA	NA	NA
QAS75313.1\|5178629_5178914_+	hypothetical protein	NA	NA	NA	NA
QAS75314.1\|5178910_5179570_+	DsbA family protein	NA	NA	NA	NA
QAS75315.1\|5179566_5179785_-	hypothetical protein	NA	NA	NA	NA
QAS76547.1\|5180600_5181224_-	hypothetical protein	NA	NA	NA	NA
QAS75316.1\|5181258_5181543_-	hypothetical protein	NA	NA	NA	NA
QAS75317.1\|5181921_5182353_+	TIGR03757 family integrating conjugative element protein	NA	NA	NA	NA
QAS75318.1\|5182352_5183291_+	TIGR03756 family integrating conjugative element protein	NA	NA	NA	NA
QAS75319.1\|5183308_5184691_+	integrating conjugative element protein	NA	NA	NA	NA
QAS75320.1\|5184690_5185038_+	hypothetical protein	NA	NA	NA	NA
QAS75321.1\|5185034_5186567_+	conjugal transfer protein TraG	NA	NA	NA	NA
QAS75322.1\|5186611_5186968_-	hypothetical protein	NA	NA	NA	NA
QAS75323.1\|5187086_5187359_+	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
QAS75324.1\|5187362_5187716_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
QAS75325.1\|5187742_5188657_-	hypothetical protein	NA	NA	NA	NA
QAS75326.1\|5188682_5188922_-	hypothetical protein	NA	NA	NA	NA
QAS75327.1\|5189305_5190556_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.2e-42	44.4

DBSCAN-SWA_7

5322437 : 5361969

Pseudomonas_phage(57.89%)

coat,tRNA,integrase

attL 5349405:5349464|attR 5361468:5361549

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAS75439.1\|5322437_5322986_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
QAS75440.1\|5323016_5323550_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
QAS75441.1\|5323549_5324092_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
QAS75442.1\|5324110_5324899_+	molecular chaperone	NA	NA	NA	NA
QAS75443.1\|5324915_5327288_+	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
QAS75444.1\|5327284_5328232_+\|coat	spore coat U domain-containing protein	NA	NA	NA	NA
QAS75445.1\|5328233_5329607_-	MFS transporter	NA	NA	NA	NA
QAS75446.1\|5329886_5330909_-	ferrochelatase	NA	NA	NA	NA
QAS75447.1\|5330905_5331823_-	TIGR01777 family protein	NA	NA	NA	NA
QAS75448.1\|5332236_5333220_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAS75449.1\|5333372_5334329_+	DUF523 and DUF1722 domain-containing protein	NA	NA	NA	NA
QAS75450.1\|5334338_5335238_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	8.5e-17	39.1
QAS75451.1\|5335234_5336680_+	deoxyribodipyrimidine photo-lyase	A0A167RC11	Powai_lake_megavirus	3.1e-45	27.8
QAS75452.1\|5336805_5337327_-	lipid A deacylase PagL	A0A2H4J0I5	uncultured_Caudovirales_phage	1.4e-59	69.8
QAS75453.1\|5337460_5338258_-	glutamate racemase	NA	NA	NA	NA
QAS76550.1\|5338247_5339006_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
QAS75454.1\|5338999_5339830_-	protein-(glutamine-N5) methyltransferase, release factor-specific	NA	NA	NA	NA
QAS75455.1\|5339831_5340914_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	5.6e-07	48.3
QAS75456.1\|5340931_5342200_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
QAS75457.1\|5342343_5344116_+	tetratricopeptide repeat protein	NA	NA	NA	NA
QAS75458.1\|5344120_5344738_+	outer membrane lipoprotein LolB	NA	NA	NA	NA
QAS75459.1\|5344739_5345588_+	4-diphosphocytidyl-2C-methyl-D-erythritol kinase	NA	NA	NA	NA
QAS75460.1\|5345754_5346696_+	ribose-phosphate pyrophosphokinase	A0A1V0SHF7	Hokovirus	4.1e-46	35.4
QAS75461.1\|5346812_5347427_+	50S ribosomal protein L25	NA	NA	NA	NA
QAS75462.1\|5347468_5348053_+\|tRNA	peptidyl-tRNA hydrolase	NA	NA	NA	NA
QAS75463.1\|5348093_5349194_+	redox-regulated ATPase YchF	NA	NA	NA	NA
5349405:5349464	attL	NA	NA	NA	NA
QAS75464.1\|5349639_5350641_-\|integrase	integrase	F1BUS9	Erwinia_phage	7.6e-75	46.8
QAS75465.1\|5350637_5351930_-	hypothetical protein	Q56VN8	Pseudomonas_phage	1.8e-241	92.3
QAS75466.1\|5352159_5353434_-	hypothetical protein	Q56VN9	Pseudomonas_phage	2.8e-199	87.1
QAS75467.1\|5353437_5353794_-	DUF2523 domain-containing protein	Q56VP0	Pseudomonas_phage	7.9e-59	100.0
QAS75468.1\|5353798_5355058_-	attachment protein	Q56VP1	Pseudomonas_phage	2.7e-53	57.9
QAS75469.1\|5355193_5355442_-\|coat	phage coat protein B	Q56VP2	Pseudomonas_phage	2.0e-32	92.7
QAS75470.1\|5355454_5355706_-	hypothetical protein	NA	NA	NA	NA
QAS75471.1\|5355718_5355811_-	hypothetical protein	Q56VP4	Pseudomonas_phage	1.6e-08	96.7
QAS75472.1\|5355827_5356262_-	DNA-binding protein	Q56VP5	Pseudomonas_phage	1.2e-61	98.6
QAS75473.1\|5356428_5356773_-	hypothetical protein	Q56VP6	Pseudomonas_phage	9.7e-46	99.0
QAS75474.1\|5356776_5357067_-	hypothetical protein	Q56VP7	Pseudomonas_phage	8.7e-56	97.9
QAS75475.1\|5357070_5357286_-	hypothetical protein	Q56VP8	Pseudomonas_phage	2.9e-32	94.2
QAS75476.1\|5357278_5357551_-	DNA-binding protein	NA	NA	NA	NA
QAS75477.1\|5357676_5357946_+	hypothetical protein	NA	NA	NA	NA
QAS76551.1\|5358086_5359178_+	serine/threonine-protein phosphatase	NA	NA	NA	NA
QAS75478.1\|5359180_5360230_+	serine/threonine protein kinase	G9BWE0	Planktothrix_phage	1.0e-61	50.0
QAS75479.1\|5360226_5361300_+	serine/threonine protein kinase	A0A1V0SDC3	Indivirus	2.5e-15	29.0
QAS75480.1\|5361663_5361969_-	addiction module antidote protein, HigA family	A0A222YWD7	Escherichia_phage	1.8e-06	39.7
5361468:5361549	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage