CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035223	Lactobacillus plantarum strain SRCM103472 chromosome, complete genome	1 crisprs	RT,csa3,cas3,DEDDh,DinG,WYL,csn2,cas2,cas1,cas9	0	1	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035223_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035223_1

3183263-3183487

TypeII

Consensus_repeat	Method
TGTTTGATATGACTACTATTCAAGAC	CRT
CGTTCTAAACCTGTTTGATATGACTACTATTCAAGACC	PILER-CR

3 spacers

csa3,csn2,cas2,cas1,cas9

The CRISPR arrays of CP035223_1

>merge|CP035223|1|3183263-3183487|CRT,PILER-CR
TTTTTGATGTGGCCGCTATTCAAGACAAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACCTGTTTGATATGACTACTATTCAAGACCGTGTCTTGTTCCTTGTTGTACTCCATACCGTTCTAAACATGTTTGATATGACTACTATTCAAGACAAAGAGTGCGTAATCTCATTTATATTCCAAGTTCTAAACCTGTTTGATATGACTACTATTCAAGACC

>CP035223|1|1|3183263-3183486|CRT
TTTTTGATGTGGCCGCTATTCAAGAC	AAACGTTCTATGCTTCGTTTCCTCAGCATCGTTCTAAACC
TGTTTGATATGACTACTATTCAAGAC	CGTGTCTTGTTCCTTGTTGTACTCCATACCGTTCTAAACA
TGTTTGATATGACTACTATTCAAGAC	AAAGAGTGCGTAATCTCATTTATATTCCAAGTTCTAAACC
TGTTTGATATGACTACTATTCAAGAC

>CP035223|1|1|3183318-3183487|PILER-CR
CGTTCTAAACCTGTTTGATATGACTACTATTCAAGACC	GTGTCTTGTTCCTTGTTGTACTCCATAC
CGTTCTAAACATGTTTGATATGACTACTATTCAAGACA	AAGAGTGCGTAATCTCATTTATATTCCA
AGTTCTAAACCTGTTTGATATGACTACTATTCAAGACC

Protein	Signature genes	Signature genes Name	Protein_function
CP035223.1\|QAT34478.1\|3173343_3174537_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
CP035223.1\|QAT34479.1\|3174601_3174967_-\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP035223.1\|QAT34481.1\|3176803_3177259_+\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
CP035223.1\|QAT34496.1\|3195564_3196305_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
CP035223.1\|QAT34485.1\|3179169_3179364_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
CP035223.1\|QAT34486.1\|3179406_3180165_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
CP035223.1\|QAT34494.1\|3193143_3193614_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240033
CP035223.1\|QAT34482.1\|3177346_3177769_-\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
CP035223.1\|QAT34480.1\|3174991_3176224_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
CP035223.1\|QAT34487.1\|3180449_3183188_+\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
CP035223.1\|QAT34710.1\|3184184_3184490_-\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
CP035223.1\|QAT34488.1\|3183510_3184188_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
CP035223.1\|QAT34495.1\|3193729_3195322_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|214906
CP035223.1\|QAT34489.1\|3184467_3185373_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
CP035223.1\|QAT34493.1\|3191546_3192911_-\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694
CP035223.1\|QAT34491.1\|3189932_3190715_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP035223.1\|QAT34490.1\|3185567_3189644_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
CP035223.1\|QAT34484.1\|3178501_3179104_+\|NADPH-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
CP035223.1\|QAT34483.1\|3177914_3178388_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP035223.1\|QAT34492.1\|3190739_3191447_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP035223.1\|QAT34478.1\|3173343_3174537_-\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6578e-118
CP035223.1\|QAT34479.1\|3174601_3174967_-\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.83673e-14
CP035223.1\|QAT34481.1\|3176803_3177259_+\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.32604e-26
CP035223.1\|QAT34496.1\|3195564_3196305_-\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	7.45143e-88
CP035223.1\|QAT34485.1\|3179169_3179364_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
CP035223.1\|QAT34486.1\|3179406_3180165_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.37287e-90
CP035223.1\|QAT34494.1\|3193143_3193614_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
CP035223.1\|QAT34482.1\|3177346_3177769_-\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	5.34709e-43
CP035223.1\|QAT34480.1\|3174991_3176224_-\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
CP035223.1\|QAT34487.1\|3180449_3183188_+\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
CP035223.1\|QAT34710.1\|3184184_3184490_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
CP035223.1\|QAT34488.1\|3183510_3184188_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	2.57931e-80
CP035223.1\|QAT34495.1\|3193729_3195322_-\|DNA-binding-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	2.36782e-17
CP035223.1\|QAT34489.1\|3184467_3185373_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.76066e-89
CP035223.1\|QAT34491.1\|3189932_3190715_-\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.39325e-25
CP035223.1\|QAT34490.1\|3185567_3189644_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	1.64342e-128
CP035223.1\|QAT34484.1\|3178501_3179104_+\|NADPH-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	6.97798e-30
CP035223.1\|QAT34483.1\|3177914_3178388_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000122978
CP035223.1\|QAT34493.1\|3191546_3192911_-\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0

>CP035223.1|QAT34487.1|3180449_3183188_+|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>CP035223.1|QAT34486.1|3179406_3180165_-|purine-nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLVAIELATESLAAY
>CP035223.1|QAT34485.1|3179169_3179364_+|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>CP035223.1|QAT34484.1|3178501_3179104_+|NADPH-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>CP035223.1|QAT34483.1|3177914_3178388_-|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>CP035223.1|QAT34482.1|3177346_3177769_-|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSENDGQIEIQ
>CP035223.1|QAT34481.1|3176803_3177259_+|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>CP035223.1|QAT34480.1|3174991_3176224_-|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>CP035223.1|QAT34479.1|3174601_3174967_-|ArsR-family-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRREAQTKYLSLQLAIFDRFLPGFLATL
>CP035223.1|QAT34478.1|3173343_3174537_-|MFS-transporter
MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSSMAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGTLLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPLTMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFGLQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMIMVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADLSGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE
>CP035223.1|QAT34488.1|3183510_3184188_-|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNISHYLDQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>CP035223.1|QAT34710.1|3184184_3184490_-|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>CP035223.1|QAT34489.1|3184467_3185373_-|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPDEVSSDAINSHV
>CP035223.1|QAT34490.1|3185567_3189644_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEKNQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKYKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFIYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKIDFGKLQVPGGIKLTGDAEIIYQSPTGLLERKISLKDL
>CP035223.1|QAT34491.1|3189932_3190715_-|alpha/beta-hydrolase
MHFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>CP035223.1|QAT34492.1|3190739_3191447_-|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQNSIQTATGIDWEKVAQLLDSTVIAQNTLSEAGLDDKTRQWLEKLQKLTPQDFNNYVE
>CP035223.1|QAT34493.1|3191546_3192911_-|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>CP035223.1|QAT34494.1|3193143_3193614_+|NUDIX-domain-containing-protein
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>CP035223.1|QAT34495.1|3193729_3195322_-|DNA-binding-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTDDAVVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTTITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQVLIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEVQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>CP035223.1|QAT34496.1|3195564_3196305_-|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAIAINSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSMQARLFAAFVRACVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035223_1	1.5\|3183422\|28\|CP035223\|PILER-CR	3183422-3183449	28	NZ_CP044084	Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence	229220-229247	5	0.821

1. spacer 1.5|3183422|28|CP035223|PILER-CR matches to NZ_CP044084 (Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

aagagtgcgtaatctcatttatattcca	CRISPR spacer
atgcctgcgtgatcgcatttatattcca	Protospacer
* *  *****.*** *************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

898801 : 907315

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT32459.1\|898801_899287_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0
QAT32460.1\|899270_900401_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
QAT32461.1\|900403_901135_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
QAT32462.1\|901136_901391_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
QAT32463.1\|901390_902071_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAT32464.1\|902063_904283_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.9e-144	39.5
QAT32465.1\|904267_905722_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
QAT32466.1\|905718_906744_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	4.2e-60	40.7
QAT32467.1\|906736_907315_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9

DBSCAN-SWA_2

1107243 : 1155276

Lactobacillus_phage(41.67%)

portal,terminase,tail,integrase,transposase,capsid,holin,head,protease

attL 1110318:1110334|attR 1157025:1157041

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT32635.1\|1107243_1108899_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.6e-93	41.5
QAT32636.1\|1109057_1109330_-	hypothetical protein	NA	NA	NA	NA
QAT32637.1\|1109354_1109588_-	hypothetical protein	NA	NA	NA	NA
QAT32638.1\|1110000_1110207_+	hypothetical protein	NA	NA	NA	NA
1110318:1110334	attL	NA	NA	NA	NA
QAT32639.1\|1110558_1111680_-\|integrase	site-specific integrase	D6PSS4	Lactobacillus_phage	5.8e-47	32.4
QAT32640.1\|1111799_1112627_-	DUF3037 domain-containing protein	NA	NA	NA	NA
QAT32641.1\|1112629_1113424_-	hypothetical protein	NA	NA	NA	NA
QAT32642.1\|1114175_1114457_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
QAT32643.1\|1114487_1114847_-	hypothetical protein	NA	NA	NA	NA
QAT32644.1\|1114873_1115251_-	large-conductance mechanosensitive channel protein MscL	NA	NA	NA	NA
QAT32645.1\|1115692_1116394_-	DUF3862 domain-containing protein	A0A0P0IXE0	Lactobacillus_phage	2.0e-05	80.8
QAT32646.1\|1116501_1116756_-	hypothetical protein	NA	NA	NA	NA
QAT32647.1\|1116765_1117701_-	hypothetical protein	NA	NA	NA	NA
QAT32648.1\|1117723_1118137_-	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
QAT32649.1\|1118148_1118517_-	XRE family transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
QAT32650.1\|1118666_1118903_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT32651.1\|1118979_1119294_-	hypothetical protein	NA	NA	NA	NA
QAT32652.1\|1119331_1119562_-	XRE family transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
QAT32653.1\|1119703_1119910_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT32654.1\|1119909_1120206_+	hypothetical protein	NA	NA	NA	NA
QAT32655.1\|1120412_1120718_+	DUF771 domain-containing protein	NA	NA	NA	NA
QAT32656.1\|1120785_1121298_+	XRE family transcriptional regulator	D6PST4	Lactobacillus_phage	8.0e-28	43.5
QAT32657.1\|1121365_1121536_+	hypothetical protein	NA	NA	NA	NA
QAT32658.1\|1121668_1122055_+	hypothetical protein	NA	NA	NA	NA
QAT32659.1\|1122051_1122939_+	recombinase RecT	E9LUM3	Lactobacillus_phage	4.7e-60	47.0
QAT32660.1\|1122862_1123723_+	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	1.6e-76	52.1
QAT32661.1\|1123804_1124011_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT32662.1\|1124457_1125366_+	DnaD domain protein	NA	NA	NA	NA
QAT32663.1\|1125362_1125650_+	hypothetical protein	NA	NA	NA	NA
QAT32664.1\|1125646_1126165_+	hypothetical protein	O03915	Lactobacillus_phage	7.7e-55	68.4
QAT32665.1\|1126161_1126536_+	hypothetical protein	NA	NA	NA	NA
QAT32666.1\|1126538_1126850_+	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	8.5e-49	91.3
QAT32667.1\|1126853_1127048_+	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	4.5e-16	71.4
QAT32668.1\|1127258_1127720_+	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.2e-38	56.3
QAT32669.1\|1128452_1128935_+	hypothetical protein	NA	NA	NA	NA
QAT32670.1\|1128975_1129170_+	hypothetical protein	E9LUP6	Lactobacillus_phage	1.7e-07	58.0
QAT32671.1\|1129223_1130102_+\|terminase	terminase	V5URT8	Oenococcus_phage	7.0e-56	48.9
QAT32672.1\|1130091_1131330_+\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	5.4e-139	61.0
QAT32673.1\|1131341_1132850_+\|portal	phage portal protein	V5US18	Oenococcus_phage	1.8e-136	52.0
QAT32674.1\|1132779_1133076_+\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
QAT32675.1\|1133222_1134908_+\|head	phage head morphogenesis protein	V5US81	Oenococcus_phage	3.8e-119	58.3
QAT32676.1\|1134882_1135161_+	hypothetical protein	NA	NA	NA	NA
QAT32677.1\|1135212_1135419_+	hypothetical protein	NA	NA	NA	NA
QAT32678.1\|1135590_1136268_+	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
QAT32679.1\|1136282_1136630_+	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
QAT32680.1\|1136649_1137672_+\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
QAT32681.1\|1137684_1137861_+	conjugal transfer protein	NA	NA	NA	NA
QAT32682.1\|1137872_1138205_+	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
QAT32683.1\|1138204_1138552_+	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
QAT32684.1\|1138553_1139105_+	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	3.3e-64	61.7
QAT32685.1\|1139104_1139470_+	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
QAT34637.1\|1139571_1139955_+\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
QAT32686.1\|1140054_1140453_+	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
QAT34638.1\|1140560_1140824_+	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
QAT32687.1\|1140839_1146671_+\|tail	phage tail protein	V5URV5	Oenococcus_phage	2.8e-225	40.8
QAT34639.1\|1146714_1147047_+	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
QAT32688.1\|1147061_1152422_+	hypothetical protein	Q6SE68	Lactobacillus_prophage	8.4e-144	59.4
QAT32689.1\|1152428_1152878_+	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.8e-23	40.5
QAT32690.1\|1152880_1153315_+	hypothetical protein	NA	NA	NA	NA
QAT34640.1\|1153475_1154609_+	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.4e-32	77.4
QAT32691.1\|1154609_1154906_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
QAT32692.1\|1154892_1155276_+\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	1.1e-13	67.6
1157025:1157041	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1982525 : 1989797

Lactobacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT33441.1\|1982525_1983902_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0
QAT33442.1\|1984059_1984197_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAT33443.1\|1984292_1984733_+	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
QAT33444.1\|1984803_1985364_-	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
QAT33445.1\|1985451_1987890_-	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
QAT33446.1\|1987892_1988507_-	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
QAT33447.1\|1988849_1989797_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.9e-177	99.7

DBSCAN-SWA_4

2645694 : 2718938

Lactobacillus_phage(56.1%)

portal,tail,terminase,capsid,holin,protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT33993.1\|2645694_2646339_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT33994.1\|2646503_2647181_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
QAT33995.1\|2647349_2649332_+	ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	2.0e-50	28.7
QAT33996.1\|2650218_2651265_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.5e-62	41.7
QAT33997.1\|2651269_2651725_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
QAT33998.1\|2651717_2652296_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
QAT33999.1\|2652279_2653005_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
QAT34000.1\|2653284_2654337_+	phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
QAT34001.1\|2654374_2655145_+	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
QAT34696.1\|2655149_2655938_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
QAT34002.1\|2655934_2656789_+	ABC transporter permease subunit	NA	NA	NA	NA
QAT34003.1\|2656813_2657611_+	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
QAT34004.1\|2657632_2658733_+	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
QAT34005.1\|2658866_2659862_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9
QAT34006.1\|2660000_2660786_-	acyl-ACP thioesterase	NA	NA	NA	NA
QAT34007.1\|2660789_2661686_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.3e-81	55.7
QAT34008.1\|2661784_2662132_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
QAT34009.1\|2662156_2663176_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
QAT34010.1\|2663192_2663522_-	hypothetical protein	NA	NA	NA	NA
QAT34011.1\|2663518_2664184_-	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
QAT34012.1\|2664581_2664833_-	DUF2508 family protein	NA	NA	NA	NA
QAT34013.1\|2664847_2665447_-	recombination protein RecR	NA	NA	NA	NA
QAT34014.1\|2665462_2665771_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
QAT34015.1\|2665792_2667490_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
QAT34016.1\|2668015_2668522_-	nucleoside deaminase	NA	NA	NA	NA
QAT34017.1\|2668524_2669133_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
QAT34018.1\|2669355_2669586_+	redoxin NrdH	X2KRY7	Enterococcus_phage	2.8e-09	40.0
QAT34019.1\|2669724_2671890_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.7e-269	63.5
QAT34020.1\|2671917_2672928_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
QAT34021.1\|2673009_2673585_+	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	6.4e-26	41.7
QAT34022.1\|2673759_2676363_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
QAT34023.1\|2676666_2677335_+	cell surface protein	NA	NA	NA	NA
QAT34024.1\|2677347_2678325_+	hydroxyacid dehydrogenase	NA	NA	NA	NA
QAT34697.1\|2678839_2678959_-	LysM domain-containing protein	A0A0A7DMK9	Lactobacillus_phage	2.2e-05	60.0
QAT34025.1\|2679162_2679756_+	DUF1643 domain-containing protein	NA	NA	NA	NA
QAT34026.1\|2679875_2680475_+	hypothetical protein	NA	NA	NA	NA
QAT34027.1\|2680959_2681493_-\|holin	holin	E9LUS0	Lactobacillus_phage	2.5e-40	97.9
QAT34028.1\|2681504_2681768_-\|holin	holin	E9LUR9	Lactobacillus_phage	4.1e-36	95.4
QAT34698.1\|2681767_2682922_-	LysM peptidoglycan-binding domain-containing protein	A0A2K9VDG6	Lactobacillus_phage	5.0e-54	35.2
QAT34029.1\|2683146_2683398_-	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.2e-29	95.8
QAT34030.1\|2683390_2685964_-\|tail	phage tail protein	A0A2K9VCB6	Lactobacillus_phage	1.7e-280	51.8
QAT34031.1\|2688435_2690658_-	hypothetical protein	NA	NA	NA	NA
QAT34032.1\|2690630_2696234_-	hypothetical protein	O03937	Lactobacillus_phage	1.2e-119	59.8
QAT34033.1\|2696209_2696956_-	hypothetical protein	O03936	Lactobacillus_phage	1.6e-21	38.3
QAT34034.1\|2696849_2697383_-	hypothetical protein	NA	NA	NA	NA
QAT34035.1\|2697461_2698247_-	Ig-like domain-containing protein	A0A288TYH2	Enterococcus_phage	5.2e-10	41.0
QAT34036.1\|2698267_2698684_-	hypothetical protein	NA	NA	NA	NA
QAT34037.1\|2698673_2699060_-\|capsid	capsid protein	NA	NA	NA	NA
QAT34038.1\|2699059_2699452_-	hypothetical protein	NA	NA	NA	NA
QAT34039.1\|2699452_2699848_-	hypothetical protein	NA	NA	NA	NA
QAT34040.1\|2700014_2701058_-	replication protein	O03966	Lactobacillus_phage	2.0e-134	70.4
QAT34041.1\|2701070_2701787_-	hypothetical protein	A0A0H4IP83	Staphylococcus_phage	2.2e-15	37.4
QAT34042.1\|2701801_2702929_-	hypothetical protein	U3PFU0	Lactobacillus_phage	6.4e-46	31.0
QAT34043.1\|2702942_2704559_-\|portal	phage portal protein	O03928	Lactobacillus_phage	1.6e-90	38.8
QAT34044.1\|2704571_2705876_-\|terminase	PBSX family phage terminase large subunit	U3PBE8	Lactobacillus_phage	3.5e-112	46.9
QAT34045.1\|2705872_2706793_-\|terminase	terminase	Q6SE85	Lactobacillus_prophage	2.1e-71	55.4
QAT34046.1\|2706830_2707502_-	hypothetical protein	NA	NA	NA	NA
QAT34047.1\|2708283_2708733_-	hypothetical protein	B8R690	Lactobacillus_phage	4.1e-12	37.0
QAT34048.1\|2708805_2709564_+	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	6.0e-40	39.6
QAT34049.1\|2709987_2711058_-	DNA cytosine methyltransferase	A0A1I9KKE7	Lactobacillus_phage	3.3e-124	60.8
QAT34050.1\|2711058_2711535_-	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	3.6e-83	89.2
QAT34051.1\|2711531_2711666_-	hypothetical protein	O03917	Lactobacillus_phage	4.8e-17	97.7
QAT34052.1\|2711668_2711899_-	hypothetical protein	O03916	Lactobacillus_phage	5.9e-23	61.8
QAT34053.1\|2711895_2712315_-	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	2.2e-23	42.3
QAT34054.1\|2712307_2712841_-	hypothetical protein	O03915	Lactobacillus_phage	2.4e-35	51.7
QAT34055.1\|2712837_2713125_-	hypothetical protein	NA	NA	NA	NA
QAT34056.1\|2713121_2714006_-	DNA replication protein DnaD	NA	NA	NA	NA
QAT34057.1\|2714087_2715053_-	hypothetical protein	A6M982	Geobacillus_virus	2.2e-63	53.6
QAT34058.1\|2715064_2715595_-	hypothetical protein	E9LUU0	Lactobacillus_phage	6.1e-55	59.2
QAT34059.1\|2715612_2715726_-	hypothetical protein	NA	NA	NA	NA
QAT34060.1\|2715857_2716028_-	hypothetical protein	NA	NA	NA	NA
QAT34061.1\|2716095_2716380_-	DNA-binding protein	NA	NA	NA	NA
QAT34062.1\|2716385_2716940_-	hypothetical protein	O03909	Lactobacillus_phage	2.5e-96	97.8
QAT34063.1\|2717000_2717183_-	hypothetical protein	NA	NA	NA	NA
QAT34064.1\|2717262_2717544_+	hypothetical protein	NA	NA	NA	NA
QAT34065.1\|2717700_2717970_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAT34066.1\|2718111_2718498_+	helix-turn-helix domain-containing protein	O03970	Lactobacillus_phage	4.9e-46	70.1
QAT34067.1\|2718506_2718938_+	hypothetical protein	O03904	Lactobacillus_phage	1.8e-73	90.9

DBSCAN-SWA_5

2847220 : 2962271

114

uncultured_Mediterranean_phage(15.38%)

bacteriocin,protease,transposase,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT34177.1\|2847220_2848492_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.4e-95	43.4
QAT34178.1\|2848960_2850574_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.1e-143	49.9
QAT34179.1\|2850746_2851355_-	DNA-directed RNA polymerase subunit delta	NA	NA	NA	NA
QAT34180.1\|2851399_2851840_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QAT34181.1\|2852202_2853135_+	lipoate--protein ligase family protein	NA	NA	NA	NA
QAT34182.1\|2853149_2854502_+	HD domain-containing protein	A0A1B1ISR1	uncultured_Mediterranean_phage	5.2e-26	32.9
QAT34183.1\|2854521_2855331_+	sugar-phosphatase	NA	NA	NA	NA
QAT34702.1\|2855500_2856487_-	lipoprotein	NA	NA	NA	NA
QAT34184.1\|2856569_2857592_-	YdcF family protein	NA	NA	NA	NA
QAT34185.1\|2857880_2858861_-	ribose-phosphate diphosphokinase	A0A2K9L8D8	Tupanvirus	4.9e-42	36.3
QAT34186.1\|2859226_2860051_-	serine hydrolase	NA	NA	NA	NA
QAT34187.1\|2860286_2861669_-	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A2K9L140	Tupanvirus	5.7e-28	33.2
QAT34188.1\|2861737_2862574_-	pur operon repressor	NA	NA	NA	NA
QAT34189.1\|2862929_2863733_-	metal ABC transporter permease	NA	NA	NA	NA
QAT34190.1\|2863719_2864418_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	1.2e-15	27.8
QAT34191.1\|2864684_2865629_-	alpha/beta hydrolase	NA	NA	NA	NA
QAT34192.1\|2865674_2865857_+	hypothetical protein	NA	NA	NA	NA
QAT34193.1\|2865938_2866805_-	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
QAT34194.1\|2866937_2867189_-	hypothetical protein	NA	NA	NA	NA
QAT34195.1\|2867293_2868184_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
QAT34196.1\|2868180_2868744_-	ribonuclease M5	NA	NA	NA	NA
QAT34197.1\|2868730_2869507_-	TatD family deoxyribonuclease	NA	NA	NA	NA
QAT34198.1\|2869629_2870814_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
QAT34199.1\|2871046_2873098_-\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8
QAT34200.1\|2873419_2873809_-	NUDIX domain-containing protein	NA	NA	NA	NA
QAT34201.1\|2874405_2875248_-	DUF72 domain-containing protein	NA	NA	NA	NA
QAT34202.1\|2875247_2875952_-	NAD-dependent protein deacylase	NA	NA	NA	NA
QAT34203.1\|2875973_2876933_-	IpaB/EvcA family protein	NA	NA	NA	NA
QAT34204.1\|2876925_2878200_-	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
QAT34205.1\|2878245_2879163_-	Ppx/GppA family phosphatase	NA	NA	NA	NA
QAT34206.1\|2879331_2880126_-	hypothetical protein	NA	NA	NA	NA
QAT34207.1\|2880130_2881264_-	hypothetical protein	NA	NA	NA	NA
QAT34208.1\|2881718_2882732_-\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
QAT34209.1\|2882844_2883591_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
QAT34210.1\|2883740_2884637_-	ROK family protein	NA	NA	NA	NA
QAT34211.1\|2884757_2886194_-	glycosyl hydrolase family protein	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
QAT34703.1\|2886211_2887567_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
QAT34212.1\|2887789_2888212_-	DUF3284 domain-containing protein	NA	NA	NA	NA
QAT34213.1\|2888201_2888390_-	hypothetical protein	NA	NA	NA	NA
QAT34214.1\|2888396_2889758_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
QAT34215.1\|2889830_2890541_-	GntR family transcriptional regulator	NA	NA	NA	NA
QAT34216.1\|2890948_2891965_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAT34217.1\|2892403_2893180_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
QAT34218.1\|2893438_2895748_+	ATP-dependent DNA helicase	NA	NA	NA	NA
QAT34219.1\|2896037_2896331_-	addiction module antidote protein, HigA family	M9MUN2	Rhodococcus_phage	1.3e-06	48.3
QAT34704.1\|2896342_2896630_-	hypothetical protein	NA	NA	NA	NA
QAT34220.1\|2896780_2897467_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT34221.1\|2897560_2898241_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT34222.1\|2898327_2898996_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT34223.1\|2899063_2899753_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT34224.1\|2899842_2901219_-	HlyD family secretion protein	NA	NA	NA	NA
QAT34225.1\|2901234_2903385_-	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.6e-45	28.1
QAT34226.1\|2903651_2903822_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
QAT34227.1\|2903846_2904005_+\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
QAT34228.1\|2904103_2904877_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT34229.1\|2905182_2905926_-	response regulator transcription factor	NA	NA	NA	NA
QAT34230.1\|2906044_2906788_-	response regulator transcription factor	NA	NA	NA	NA
QAT34231.1\|2906788_2908117_-	GHKL domain-containing protein	NA	NA	NA	NA
QAT34232.1\|2908307_2908454_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
QAT34233.1\|2908789_2908978_-	pirin	NA	NA	NA	NA
QAT34234.1\|2909332_2910079_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT34235.1\|2910109_2911309_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
QAT34236.1\|2911426_2911594_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
QAT34237.1\|2911721_2911922_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
QAT34238.1\|2912783_2912951_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
QAT34239.1\|2912981_2913155_+\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
QAT34240.1\|2913151_2913820_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
QAT34241.1\|2913844_2913997_+	hypothetical protein	NA	NA	NA	NA
QAT34242.1\|2914231_2914435_-	hypothetical protein	NA	NA	NA	NA
QAT34243.1\|2914819_2916004_-	cation:proton antiporter	NA	NA	NA	NA
QAT34244.1\|2916048_2917425_-	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
QAT34245.1\|2917950_2918766_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
QAT34246.1\|2918925_2919798_+	AraC family transcriptional regulator	NA	NA	NA	NA
QAT34247.1\|2919868_2920660_+	HAD family hydrolase	NA	NA	NA	NA
QAT34248.1\|2920663_2921818_+	MFS transporter	NA	NA	NA	NA
QAT34249.1\|2921821_2922439_+	sugar O-acetyltransferase	NA	NA	NA	NA
QAT34250.1\|2922774_2923248_-	hypothetical protein	NA	NA	NA	NA
QAT34251.1\|2923529_2923949_-	hypothetical protein	NA	NA	NA	NA
QAT34252.1\|2924523_2924769_-	hypothetical protein	NA	NA	NA	NA
QAT34253.1\|2925160_2925352_-	hypothetical protein	NA	NA	NA	NA
QAT34254.1\|2925420_2925576_-	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
QAT34255.1\|2925801_2926188_-	hypothetical protein	NA	NA	NA	NA
QAT34256.1\|2926775_2927039_-	hypothetical protein	NA	NA	NA	NA
QAT34257.1\|2927053_2927596_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
QAT34258.1\|2928320_2929238_-	hypothetical protein	NA	NA	NA	NA
QAT34705.1\|2929361_2929478_-	hypothetical protein	NA	NA	NA	NA
QAT34259.1\|2929542_2929821_-	hypothetical protein	NA	NA	NA	NA
QAT34260.1\|2930237_2930546_-	hypothetical protein	NA	NA	NA	NA
QAT34261.1\|2931549_2931804_-	hypothetical protein	NA	NA	NA	NA
QAT34262.1\|2932006_2932279_-	hypothetical protein	NA	NA	NA	NA
QAT34263.1\|2932817_2933096_-	hypothetical protein	NA	NA	NA	NA
QAT34264.1\|2933207_2933471_-	hypothetical protein	NA	NA	NA	NA
QAT34265.1\|2934242_2934746_-	hypothetical protein	NA	NA	NA	NA
QAT34266.1\|2936623_2940319_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAT34267.1\|2940906_2941629_-	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
QAT34268.1\|2941643_2943473_-	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
QAT34269.1\|2943487_2945005_-	glycerol kinase	NA	NA	NA	NA
QAT34270.1\|2945470_2946802_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAT34271.1\|2946879_2947851_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
QAT34272.1\|2947851_2949378_-	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
QAT34273.1\|2949615_2950062_+	ribonuclease H	NA	NA	NA	NA
QAT34706.1\|2950556_2950823_-	hypothetical protein	NA	NA	NA	NA
QAT34274.1\|2951068_2951980_-	oxidoreductase	NA	NA	NA	NA
QAT34275.1\|2952116_2953037_+	ribonucleoside hydrolase RihC	NA	NA	NA	NA
QAT34276.1\|2953202_2953775_-	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
QAT34277.1\|2953878_2954334_-	hypothetical protein	NA	NA	NA	NA
QAT34278.1\|2954352_2954823_-	transcriptional regulator	NA	NA	NA	NA
QAT34279.1\|2954932_2956129_+	DUF2075 domain-containing protein	NA	NA	NA	NA
QAT34280.1\|2956159_2956669_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
QAT34281.1\|2956860_2958516_+\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.6e-93	41.5
QAT34282.1\|2958549_2958918_-	DUF1304 domain-containing protein	NA	NA	NA	NA
QAT34283.1\|2959182_2960688_-	copper oxidase	NA	NA	NA	NA
QAT34284.1\|2960845_2961514_-	ribose 5-phosphate isomerase A	NA	NA	NA	NA
QAT34285.1\|2961707_2962271_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage