CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035225	Lactobacillus plantarum strain SRCM103473 plasmid unnamed1	0 crisprs	NA	0	0	0	0
CP035224	Lactobacillus plantarum strain SRCM103473 chromosome, complete genome	1 crisprs	csa3,cas9,cas1,cas2,csn2,DinG,cas3,DEDDh,WYL,RT	0	26	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035224_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035224_1

118321-118545

TypeII

Consensus_repeat	Method
GGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACG	PILER-CR
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACA	CRT

3 spacers

csn2,cas2,cas1,cas9,csa3

The CRISPR arrays of CP035224_1

>merge|CP035224|1|118321-118545|PILER-CR,CRISPRCasFinder,CRT
GGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACTTGGAATATAAATGAGATTACGCACTCTTTGTCTTGAATAGTAGTCATATCAAACATGTTTAGAACGGTATGGAGTACAACAAGGAACAAGACACGGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACGATGCTGAGGAAACGAAGCATAGAACGTTTGTCTTGAATAGCGGCCACATCAAAAA

>CP035224|1|1|118321-118490|PILER-CR
GGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACT	TGGAATATAAATGAGATTACGCACTCTT
TGTCTTGAATAGTAGTCATATCAAACATGTTTAGAACG	GTATGGAGTACAACAAGGAACAAGACAC
GGTCTTGAATAGTAGTCATATCAAACAGGTTTAGAACG

>CP035224|1|1|118322-118489|CRISPRCasFinder
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC	TTGGAATATAAATGAGATTACGCACTCTTT
GTCTTGAATAGTAGTCATATCAAACATGTTTAGAAC	GGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACAGGTTTAGAAC

>CP035224|1|1|118322-118545|CRT
GTCTTGAATAGTAGTCATATCAAACA	GGTTTAGAACTTGGAATATAAATGAGATTACGCACTCTTT
GTCTTGAATAGTAGTCATATCAAACA	TGTTTAGAACGGTATGGAGTACAACAAGGAACAAGACACG
GTCTTGAATAGTAGTCATATCAAACA	GGTTTAGAACGATGCTGAGGAAACGAAGCATAGAACGTTT
GTCTTGAATAGCGGCCACATCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
CP035224.1\|QAT28780.1\|106485_108078_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|214906
CP035224.1\|QAT28789.1\|118619_121358_-\|cation-transporting-P-type-ATPase	unknown	unknown	gnl\|CDD\|319775
CP035224.1\|QAT28797.1\|126840_127206_+\|ArsR-family-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
CP035224.1\|QAT28786.1\|116434_117340_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
CP035224.1\|QAT28796.1\|125583_126816_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340949
CP035224.1\|QAT28798.1\|127270_128464_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340897
CP035224.1\|QAT28781.1\|108193_108664_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240033
CP035224.1\|QAT28779.1\|105502_106243_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|224982
CP035224.1\|QAT28784.1\|111092_111875_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
CP035224.1\|QAT28794.1\|124038_124461_+\|Hsp20/alpha-crystallin-family-protein	unknown	unknown	gnl\|CDD\|107228
CP035224.1\|QAT28792.1\|122703_123306_-\|NADPH-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
CP035224.1\|QAT28790.1\|121642_122401_+\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|350158
CP035224.1\|QAT28788.1\|117619_118297_+\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd12218_csn2_CAS-II-A	gnl\|CDD\|213411
CP035224.1\|QAT28785.1\|112163_116240_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	mkCas0193_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|374653
CP035224.1\|QAT28793.1\|123419_123893_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
CP035224.1\|QAT28791.1\|122443_122638_-\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
CP035224.1\|QAT28795.1\|124548_125004_-\|DUF3021-domain-containing-protein	unknown	unknown	gnl\|CDD\|378668
CP035224.1\|QAT28783.1\|110360_111068_+\|hypothetical-protein	unknown	unknown	unknown
CP035224.1\|QAT28787.1\|117317_117623_+\|CRISPR-associated-endonuclease-Cas2	cas2	mkCas0206_cas2_CAS-I:CAS-II:CAS-III	gnl\|CDD\|226043
CP035224.1\|QAT28782.1\|108896_110261_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182694

Protein	Function_ID	Function_description	E-value
CP035224.1\|QAT28780.1\|106485_108078_+\|DNA-binding-protein	gnl\|CDD\|214906	smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p. HIRAN is found as a standalone protein in several bacteria and prophages, or fused to other catalytic domains, such as a nuclease of the restriction endonuclease fold and TDP1-like DNA phosphoesterases, in the eukaryotes. It has been predicted that this protein functions as a DNA-binding domain that probably recognises features associated with damaged DNA or stalled replication forks.	2.36782e-17
CP035224.1\|QAT28789.1\|118619_121358_-\|cation-transporting-P-type-ATPase	gnl\|CDD\|319775	cd02080, P-type_ATPase_cation, P-type cation-transporting ATPase similar to Exiguobacterium aurantiacum Mna, an Na(+)-ATPase, and Synechocystis sp. PCC 6803 PMA1, a putative Ca(2+)-ATPase. This subfamily includes the P-type Na(+)-ATPase of an alkaliphilic bacterium Exiguobacterium aurantiacum Mna and cyanobacterium Synechocystis sp. PCC 6803 PMA1, a cation-transporting ATPase which may translocate calcium. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
CP035224.1\|QAT28797.1\|126840_127206_+\|ArsR-family-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	2.83673e-14
CP035224.1\|QAT28786.1\|116434_117340_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	1.76066e-89
CP035224.1\|QAT28796.1\|125583_126816_+\|MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.1962e-140
CP035224.1\|QAT28798.1\|127270_128464_+\|MFS-transporter	gnl\|CDD\|340897	cd17339, MFS_NIMT_CynX_like, 2-nitroimidazole and cyanate transporters and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Escherichia coli 2-nitroimidazole transporter (NIMT) and cyanate transport protein CynX, and similar proteins. NIMT, also called YeaN, confers resistance to 2-nitroimidazole, the antibacterial and antifungal antibiotic, by mediating the active efflux of this compound. CynX is part of an active transport system that transports exogenous cyanate into E. coli cells. The NIMT/CynX-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.6578e-118
CP035224.1\|QAT28781.1\|108193_108664_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240033	cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	8.22877e-58
CP035224.1\|QAT28779.1\|105502_106243_+\|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein	gnl\|CDD\|224982	COG2071, COG2071, Predicted glutamine amidotransferases [General function prediction only].	7.45143e-88
CP035224.1\|QAT28784.1\|111092_111875_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	1.39325e-25
CP035224.1\|QAT28794.1\|124038_124461_+\|Hsp20/alpha-crystallin-family-protein	gnl\|CDD\|107228	cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18. Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic membrane.	5.34709e-43
CP035224.1\|QAT28792.1\|122703_123306_-\|NADPH-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	6.97798e-30
CP035224.1\|QAT28790.1\|121642_122401_+\|purine-nucleoside-phosphorylase	gnl\|CDD\|350158	cd09007, NP-I_spr0068, uncharacterized subfamily of the nucleoside phosphorylase-I family. This subfamily is composed of uncharacterized members including Streptococcus pneumoniae hypothetical protein spr0068. The nucleoside phosphorylase-I (NP-I) family members accept a range of purine nucleosides as well as the pyrimidine nucleoside uridine. The NP-1 family includes phosphorolytic nucleosidases such as purine nucleoside phosphorylase (PNP, EC. 2.4.2.1), uridine phosphorylase (UP, EC 2.4.2.3), and 5'-deoxy-5'-methylthioadenosine phosphorylase (MTAP, EC 2.4.2.28), and hydrolytic nucleosidases such as AMP nucleosidase (AMN, EC 3.2.2.4) and 5'-methylthioadenosine/S-adenosylhomocysteine (MTA/SAH) nucleosidase (MTAN, EC 3.2.2.16). Members of the NP-I family display different physiologically relevant quaternary structures: hexameric (trimer-of-dimers arrangement of Shewanella oneidensis MR-1 UP); homotrimeric (human PNP and Escherichia coli PNPII or XapA); hexameric (with some evidence for co-existence of a trimeric form) such as E. coli PNPI (DeoD); or homodimeric such as human and Trypanosoma brucei UP. The NP-I family is distinct from nucleoside phosphorylase-II, which belongs to a different structural family.	7.37287e-90
CP035224.1\|QAT28788.1\|117619_118297_+\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213411	cd12218, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	2.57931e-80
CP035224.1\|QAT28785.1\|112163_116240_+\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|374653	pfam16592, Cas9_REC, REC lobe of CRISPR-associated endonuclease Cas9. The REC lobe of Cas9 - the CRISPR-associated endonuclease Cas9 - includes the REC1 and REC2 domains. REC1 forms an elongated, alpha-helical structure consisting of 25 alpha helices and two beta-sheets, whereas REC2 inserted within REC1 adopts a six-helix bundle structure. The REC lobe and the NUC lobe of Cas9 fold to present a positively charged groove at their interface which accommodates the negatively charged sgRNA:target DNA heteroduplex. CRISPR (clustered regularly interspaced short palindromic repeat)-Cas system occurs naturally in bacteria as a defense against invasion by phages or other mobile genetic elements. Cas9 is targeted to specific genomic locations by sgRNAs or single guide RNAs, in order to complex with invading DNA in order to cleave it and render it inactive.	1.64342e-128
CP035224.1\|QAT28793.1\|123419_123893_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	0.000122978
CP035224.1\|QAT28791.1\|122443_122638_-\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	2.12668e-17
CP035224.1\|QAT28795.1\|124548_125004_-\|DUF3021-domain-containing-protein	gnl\|CDD\|378668	pfam11457, DUF3021, Protein of unknown function (DUF3021). This is a bacterial family of uncharacterized proteins.	7.32604e-26
CP035224.1\|QAT28787.1\|117317_117623_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	2.01798e-25
CP035224.1\|QAT28782.1\|108896_110261_+\|amino-acid-permease	gnl\|CDD\|182694	PRK10746, PRK10746, putative transport protein YifK; Provisional.	0

>CP035224.1|QAT28788.1|117619_118297_+|type-II-A-CRISPR-associated-protein-Csn2
MNITYYPFPPFKIDAGKVNVLDLGNSNMYAEVCQGFRDRIDSVRISNDDLELQTISSQCNWYGDLMLSVDLNRLFLKKVQTQIIKLMADDRQVAVLDENRKVVSQVMEASFLLDLPLDVDESPSLEQILKFTGIHFPTALMNDPRAILEALVQTHVELGLKQKLVLTNISHYLDQKQWASFEQLVHDLGATVIVIEYSEINRMEKFKNSCYYYVDEDLVDWRDMN
>CP035224.1|QAT28787.1|117317_117623_+|CRISPR-associated-endonuclease-Cas2
MRLIVMFDVPMDTSEERRAYRHFHKALVREGFLMMQYSTYVRVCVNKKAAEFVEKRIAPLAPKGGKVQTMTVTEKQYQAMHYIQGTPSNDILNSAERTIVI
>CP035224.1|QAT28786.1|116434_117340_+|type-II-CRISPR-associated-endonuclease-Cas1
MGWRNVIITQHAKVSYSMNRILVQTSSDKYAVPISDIQLLLVGTTQAVITSAALCALAEAHVKVIFTDHQGEPISETNDYYPTRRTADLVRQQVTWPEARIATLWTKNVGSKILNQIQVIDFVGGDTQTLVDELDKLELNDVTNREAVVANKYFSLLFGDQFYRRDFSPINAALNYGYAVLLSMVNREIVLNGYLTCIGIHHENNENEFNLGSDLMEPFRPIVDQWVSQQRFKDFTPDIKIGLVSLLDLEIGFNGHQTIVSHAITEYVAACLHYLSGETEELKIEVKLPDEVSSDAINSHV
>CP035224.1|QAT28785.1|112163_116240_+|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKEPYGVGLDIGTNSVGWTVVDASGHVRKIKGQTGIGVRLFKEGAAAADRRGFRTTRRRLKRVKWRLRLLREFFDQPISKVDINFFARRKYSDISPRDPNYNGLEKTLFNDRSDQDFYHDYPTIYHLREALMTQHRKFDVREIYLAIHHIVKYRGNFLRNDAATAYRSGTLDLQQHFETLNHLFSQADLELNLNLTTDVALLDSIKQTLVRTDISRSDRQKLIMPLLAVLTGATTAEKKRQKAVVTEFAKALVGNKTKIDVLTLTDIDATEAKDWAFSLEKNQDKLPGIEDRFSEVGQQIIDEVIRLYASVNLAQLIPEGKRFSQSMVEKYKRHGEDLKLLKAYIRSQSDAKRGRAIRATYDQYIDGVKSKQVTQEAFQKALGKFVDADVDLNSWAAQIKQAIDSEQFMPKLRTKQNGAIPYQVQQNELDQIISNQKEYYPWLGEENPVIKRRGKFPYKLDELVGFRVPYYVGPLITKEMQAATANAGFAWMVRKADGPITPWNFDDKVDRVASATAFIQRMQTTDTYLIGEEVLPARSLIYQRFMVLNELNNIRVDDGQLTPRQKQRLYNQVFKKYKRVTAKNIQDNLVAAGEFPTAPRITGLADPKVFNSSLSTYHDLKQVLPEAMSDVRKQADIEKIILWSTIFEDSTIFKQKLTEISWLTAAQLKQLGQLRYRGWGQLSRKLLTGLKDDNNRSIMDGLWETNANFMQLRSQPAIENQIKSANQANLTTADLQDTINELYTSPQNKKAIREVMVVLADIKDAMHGQTPNWIFVEAARGGGVAGRRTQSRSKQIVAAYQGTAQAIVRDQVQRELKEKIKNKANFNTRLVLYFLQNGRDLYTGDAINIDRLSEYDIDHILPQSLVKDDSLDNRVLTNARINREKNDTFASEKFGKKMGAKWKEMHRMGLMTKRKLDHLLMRPDEISKYATGFINRQLVETRQVIKLVEELINAEYPSTAIVSVKANLTHQFRQTFDFPKIREVNDYHHAFDAALTAFIGTYLLKRYPKLERFFIYGKFAKQPVNLTRFNVIRKLAKTDTPITDIDTGEVLWDKLTDIKYFETLYDYKRLLVTREVSENYGAMFDQTLLKASDNGKRLIRKKQSFDTAIYGGYTGKTLAYMAIVKVSTKKDVQYQVVGVPTTMVTQIEQLEQQGMTNKQAVTKVIEPLIAANNKKMLTYEVLLPKVRFEQVVRDRIKGQTHRFALGTDTYYHNIQELYLPLTLQRAFLGKQNESEVQLNQNLLTVFDATLAQVNRYFPLYEMNKFKKILNSARDQIELLEAKNQFVKNKLVLGKQGILTNMFIGLHANASYGDLKVLGVKIDFGKLQVPGGIKLTGDAEIIYQSPTGLLERKISLKDL
>CP035224.1|QAT28784.1|111092_111875_+|alpha/beta-hydrolase
MHFITSDHVQLDYTDEGQGQPIVILTGFGGAKDIWRAQIPVLIQAGYRVINLDGRCQGLSEHTAKGLRMSRRAVDAHELIEKLQLEQPILLGNSMGAATWFAYVSLYGDTGIKALIDVDQTPRMINTPHWQYGFKQVQWQDIPDYFRMPLGHSTFKHIDDATYARVKAVEAQAPFDAKLMFPLLVNHAVQDWRDVIRQLTVPFLIIAGAKSPFFNPDFAAVTAQMALRGQSVVIPEAGHIVMAEQSAAFNKALLEFLATC
>CP035224.1|QAT28783.1|110360_111068_+|hypothetical-protein
MVKQGHYAKVSKQKRLRQLKQRRQAQEKRAIMPEMVSEFLQVRYHLTQAAKQRPAMRQMMQRFMAQWLAAGQAELSDNGQTTWSVVALTKQTLQTFNRQLPWQGYALVDQEMARWTAFLNKEVPAVPLSERITLTEALSPATWQACLSEQLAINALLALTGDSRQLGQITTEQVRQLQNSIQTATGIDWEKVAQLLDSTVIAQNTLSEAGLDDKTRQWLEKLQKLTPQDFNNYVE
>CP035224.1|QAT28782.1|108896_110261_+|amino-acid-permease
MQRKLSTGQMQMIALGGTIGVGLFMGSSSTIKWTGPSVLIAYIVSGAFLYLIMRALGEMLYVDPNTGSFAKFASEYIHPVFGYLTAWSNIFQFVVVGMSEMIALGGYCRYWWPNLPDWIPGLIAIVFLCAANLISVKMFGTLETWFSLIKVVTIILMIIAGLGLIIFGIGNGGHPIGISNLWTHGGFFTGGVKGFVFALAIVLASYQGIELIGVTAGEAENPQSTIVKAIRSTVARILIFYVGAIFVIVSIYPWDKLSQIGSPFVQTFAKIGITAAASIINFVVITASLSGTNSGIYSASRMTYTLAESHQLPRKMTLLNRHGVPFYSVIAIATGILIGVVLNVVLPMFFKDASEIFVMVYSSSVLPGMVPWFVILVSQIAFRKQNAAKMANHPFKMPLSPYSNYLTLAFLALTLVFMFINPETRYSILVGVVFLVIMTLIYFRKYAGNKEETL
>CP035224.1|QAT28781.1|108193_108664_-|NUDIX-domain-containing-protein
MANYIKEIRALVGHKPIILNTAAGILVNDQQQVLLNLRTDTHNWSLPGGYLEYGETYATACVREYKEDSGIDVEVVDRIGIFDKGETAYPNGDVAQTISALFLVKPIGGHVLTQATDETLKLDYFDFDNLPPLLNQQNADMIHAAQEYLQTHSATK
>CP035224.1|QAT28780.1|106485_108078_+|DNA-binding-protein
MERIEAGMSVMTLKKQTYRVIAVINQGQELLVRAHEPETADIEIIPVTTVVQVTEQNSTDDAVVALDTVTVVGERYVDDIVATLTTLRVGMAVLLQRESGNQYDDNAISVWTLQHAKLGYIARYQNQPYATLMDQGQRLYGIVTVLDQQKQHLELMLWRTTAVPSPIEALQIRQRLAKPRTNLGAVPTHSLQTPLGTIVMMCNGHPIKYQQVPLSPWLTPADELHVTKRYLLTPDWSQVPPDSLITCQVTAKADVVQRWQNEHISAAVLTNASSFYVVGISAQTKTGLNDNLVDDAAQPAVIYRVGQVSAHMQAGFMVSWAPFGDPRVQPALKLALHFSSQPLVPYHPVTPSRTNATFTQQELAALLVSALPNYQGGQRLEPSVTTITVEKLRQTLGDQTYHALANYQRHVQLVAGSTEGVNETLLQVLIHAVTYHELTTMHYYQPTVGMVDQVIYPIQLFSTTTKDEDDAQLVGCLALYNYETFEVQQVPLTAIARIAIIADPEHPQTTPETESPDWLRIFLHGWNDDF
>CP035224.1|QAT28779.1|105502_106243_+|gamma-glutamyl-gamma-aminobutyrate-hydrolase-family-protein
MVKPIIGIAPGVVTVNSQMFPGRVRDYVNRDYLKSVTDNGGVPLVLPVTTDATTIERYVGMIDGLLLCGGADVAPLTYGEEPQPKLGGVDPERDQYEIALIRATHAVGKPVLGICRGLQILNVCYGGNLYQDMSELPAGQGTLKHMQGQLAAYGMHHVKVVPGTTLAEYLGTTSDAIAINSFHHQAVKQVATGFQVVAQSADQVVEAIEATAGGLQLGVQWHPEMMQQVNSMQARLFAAFVRACVA
>CP035224.1|QAT28789.1|118619_121358_-|cation-transporting-P-type-ATPase
MIKDDNQSLTSNEEQNDTQNPPDADNLWQLDESALAAKYATDPENGLSTAEAAERLQHNGRNELETKRTSRFVQFIKQFNNSIIYILAAAAVLTFFMHHYSDSIVIGLVIIANAIIGYVQERQAGNALERIREMLISKNFVIRDGKKLEIDARELVVGDLVNLEAGDAVPADMRLISADNFNVQESVLTGETNPVEKQEEPITETTPALADRKNMVYASTAVTSGSAVGIVTATAEDTEIGHIQQSVSDVKQTTTPLMRNLNSLGVGLSIAIVVAAVLLFLLGMVMDTYSLPTLLIAVITMVVGSMPEGLPASTSVVLAMGTRQMTKKNVIVKSLPAVETLGAVDIVNTDKTGTLTKNEMTVTKVVTPEHTFDVTGVGYDDNGGVNFDGHLKLNGNKVDWHQDNAMEWLVKIAGQTTDAELHFENNRWELTGEPTDGALTTLYRKMTGHDPEVEEVDSLPFDSAFRFSARLADLDGQRLLMVKGSPATVLRLTDQANQTAYWDDAMDDLTADGLRVVALAYQEVDDDVTTIDAQAIGGLHLAGLVGIIDPPREEAATAIAELRQAGVQVKMITGDHPDTAMAIANKLNLAANVKAITGPEIDAMDDQQLQAHIDDYNVFARATPNNKLRIVRAQQANNHVVSMTGDGVNDAPALKQADIGVAMGIKGTEVAKESADMVLADDDFADIVAAVREGRHVFDNIRKTIRFLLPTSFAEGLVVIISILMGHELPLYPTQLLWINMVSALTIQFAFIFEPPEAGIMARGPRNVKSGLLSKLDYFEIGYVSFLISGLGIFAYNYLTALGLPNVVGSTMSLNIIIFGKIFYLFNLRNDHPVISKYFFQNKMAFYIIGILILLQLGIIYLPFMQSVFHTTSINFWYGWGIPIICGIVVLIVTEVGKFIRFRWMGKDGVID
>CP035224.1|QAT28790.1|121642_122401_+|purine-nucleoside-phosphorylase
MTDKLTLLQYDPNPTAMVGPDVDGRFTVPAKLLYIFSGDDYFQQFVTRYHGHRLGQFNTITKVSWVYQIGYRGQKLAVAQAPLGSPAATMYLEMLIDFGARTVIAVGSCGALTALPEEQLLIPTVALRDEGTSFHYLAAADWVPLDPKVIQVLGTTLTKACLPWQMVKTWTTDAFFRETVSKVKAARQQGCQVVEMECSALAACSAFRQVSFGQLLYTADTLAQLEHYDPRHWGAGGVLVAIELATESLAAY
>CP035224.1|QAT28791.1|122443_122638_-|PspC-domain-containing-protein
MKIDIHRSATDRVIAGVIGGIAEHFNWNTNVTRLLFVVLAITPMFPGIIAYLILWLLMKDPIKD
>CP035224.1|QAT28792.1|122703_123306_-|NADPH-dependent-oxidoreductase
MFKIAIILGSTRSQANGRALFNHLKLIIDQLPTHSPIHYQFLDLANYQLPFFDEPEPPMANPHRELPANQQQWLTDMASADGYIILTPEYNHAMPAGLKNAFDFLAFEGARKPAKIISYSDNMRGGQFGAAALVPVLQRLGIVVLPKPTPIGNVPQTLQSNGHFIDNAPLSKRYDHTLHQALTEITYYTTVLTTTPFPTD
>CP035224.1|QAT28793.1|123419_123893_+|MarR-family-transcriptional-regulator
MTTPLVSQLMTELNQFLTQDSVDDQEKRWAMQQTTDPQLQAALKQLSTTDIKIIAYLGRRGASRAKSLPAPTELSQATISRGLTKLSRLKLATKYRDLTNNKEILVRLTTLGEAVADLHTQLDAAIAAKAQAIADDYSDAELRRFVSLMRRIREIKI
>CP035224.1|QAT28794.1|124038_124461_+|Hsp20/alpha-crystallin-family-protein
MANTLMNRNDFGMLDPFERMARSFWAPLENMDQVLKTDINETDDQYQVKVDVPGIDKQDVKLDYRDNVLSIKVQKDSFVDHEDQDQNIVMNERHTGTLQRQYMLPNVAADKITASQADGVLTITLPKTQPSENDGQIEIQ
>CP035224.1|QAT28795.1|124548_125004_-|DUF3021-domain-containing-protein
MKRLWHTLLIGAIGGIVIGYLMALGFSTFFNTTYLFPSNPTFVSHWSSPLAATQLSTLLWILIGEVWAFSSWLFEIETWSITKQTIAHCLCSYLGMTPLAILCGWFPLNVRWFGFYTLVYTGAYIGLWLIEMALARIKVIQLNQQLTNQRS
>CP035224.1|QAT28796.1|125583_126816_+|MFS-transporter
MDDAERERGPWHRNLIVLWFCTFVAGMAFSEIMPFLSLFVSQLGDFTKAQITFYSGLAFAADYAISAISAPLWGIIADKKGRKIMLLRASLGMAVAMGLMGFVTNVWQLVALRALQGVFAGFISNAQALVASQTPRKYSGRALSTLITGAVSGQLFGPVIGGLLAQLFSIRNTFFITAGLLMVAFLLSLFFVQEHFKPVAHHREPGDSRNPLAAFQNPRLIIVMLCSTAIVQFGNASIAPIISLYVRELMHYRGPITVVAGIIAALPGISNIFSAPRLGRYGDQHGSGKVLLFGYIFAVIMYFPQGIVTSVVALGILRFAIGISDGALYPEIQTVLTKNTPVHLTSTIFSYNQSFQAIGNMFGALLGGLVAGWFNYNAVFIMTALLLLINLGLILWLVPDIWKNGKRAVS
>CP035224.1|QAT28797.1|126840_127206_+|ArsR-family-transcriptional-regulator
MASCLFCYLSLNMMLIQCIVSFMNIEISKQDQADQQRVAIFKALADANRLRIIRVLYQAQREMTCSEVGAQLNISKSTVSYHFKTLRLVGLTNTRREAQTKYLSLQLAIFDRFLPGFLATL
>CP035224.1|QAT28798.1|127270_128464_+|MFS-transporter
MTTTHQHSRYLTLGMMLAATNMRLPITMMPGLISSLKRTLGLPSSMAGLLTTIPLLTFAIMSPLIAHWGRRFGNELTIYVMLIFLAVGSYLRVIPTIAALFIGTLLVGIGADGGNVLIPAIIKDNFPTKIPVATSQYTLSMLLVGSLGTGLSGVLAAHWSLPLTMAVLSVIGLINLVVWLPNLKYNHRAPTVAMTASDGQSTATHGSVWRRPLAWVVTAFFGLQALVYYSLLTWLPTVFVAHGFSLIVAGNLVTVMQLSGLPMSYLVPATSGHRRGVWAMIMVVGVGFIAGIGGILLSGTNFWVAALSCVLLGLGSGAAFSLAVVFFTQKTTNGFETADLSGMAQSAGYLLAAVGPVLFGWLGGQLGWGPVLWLAIILSALLALSGSIIFQHATIYE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156550	1	0.964
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156442	1	0.964
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156442	1	0.964
CP035224_2	2.3\|1206425\|46\|CP035224\|CRT	1206425-1206470	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3514-3559	2	0.957
CP035224_2	2.13\|1207127\|28\|CP035224\|CRT	1207127-1207154	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152026-152053	2	0.929
CP035224_2	2.16\|1207325\|46\|CP035224\|CRT	1207325-1207370	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3346-3391	2	0.957
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1186-1213	2	0.929
CP035224_2	2.27\|1208093\|28\|CP035224\|CRT	1208093-1208120	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152026-152053	2	0.929
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1564-1591	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18545-18572	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19643-19670	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16067-16094	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16199-16226	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16331-16358	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17357-17384	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17453-17480	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17507-17534	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17573-17600	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18089-18116	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18233-18260	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18671-18698	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18767-18794	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18821-18848	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19571-19598	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19715-19742	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19775-19802	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19895-19922	2	0.929
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20081-20108	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153331-153358	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153937-153964	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154045-154072	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154741-154768	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154939-154966	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155137-155164	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155371-155398	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155518	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155905-155932	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156298	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156607-156634	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157195-157222	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151972-151999	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155851-155878	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156793-156820	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1618-1645	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3163	2	0.929
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3550-3577	2	0.929
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156433-156460	2	0.929
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156433-156460	2	0.929
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1240-1273	3	0.912
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2638-2671	3	0.912
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3346-3379	3	0.912
CP035224_2	2.13\|1207127\|28\|CP035224\|CRT	1207127-1207154	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16445-16472	3	0.893
CP035224_2	2.13\|1207127\|28\|CP035224\|CRT	1207127-1207154	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17123-17150	3	0.893
CP035224_2	2.16\|1207325\|46\|CP035224\|CRT	1207325-1207370	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1240-1285	3	0.935
CP035224_2	2.16\|1207325\|46\|CP035224\|CRT	1207325-1207370	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157285-157330	3	0.935
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151534-151561	3	0.893
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151570-151597	3	0.893
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155851-155878	3	0.893
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156793-156820	3	0.893
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156961-156988	3	0.893
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2242-2269	3	0.893
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3136-3163	3	0.893
CP035224_2	2.22\|1207727\|46\|CP035224\|CRT	1207727-1207772	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151480-151525	3	0.935
CP035224_2	2.27\|1208093\|28\|CP035224\|CRT	1208093-1208120	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16445-16472	3	0.893
CP035224_2	2.27\|1208093\|28\|CP035224\|CRT	1208093-1208120	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17123-17150	3	0.893
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2104-2131	3	0.893
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3490-3517	3	0.893
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155509-155536	3	0.893
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156289-156316	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16739-16766	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17735-17762	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18161-18188	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18497-18524	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19217-19244	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20021-20048	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	20105-20132	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151804-151831	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154081-154108	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154117-154144	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154489-154516	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154543-154570	3	0.893
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154813-154840	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151882-151909	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151534-151561	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151570-151597	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151642-151669	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151696-151723	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151846-151873	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152008-152035	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153049-153076	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154669-154696	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154885-154912	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155083-155110	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155317-155344	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156031-156058	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156133-156160	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156379-156406	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156559-156586	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156961-156988	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157357-157384	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157519-157546	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2674-2701	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3190-3217	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1258-1285	3	0.893
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3100-3127	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151642-151669	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151696-151723	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151882-151909	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153886	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153991-154018	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154408	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155518	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156298	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156721-156748	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156871-156898	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157357-157384	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157519-157546	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21235-21262	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15514-15541	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15640-15667	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15856-15883	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1564-1591	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9559-9586	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9577-9604	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9793-9820	3	0.893
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9937-9964	3	0.893
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151633	3	0.893
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153331-153358	3	0.893
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154036	3	0.893
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154180	3	0.893
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154651-154678	3	0.893
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157177-157204	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151642-151669	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151696-151723	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151882-151909	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153886	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153991-154018	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154381-154408	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155518	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156298	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156721-156748	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156871-156898	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157357-157384	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157519-157546	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21235-21262	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15514-15541	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15640-15667	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15856-15883	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1564-1591	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9559-9586	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9577-9604	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9793-9820	3	0.893
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9937-9964	3	0.893
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153049-153082	4	0.882
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156643-156676	4	0.882
CP035224_2	2.10\|1206899\|46\|CP035224\|CRT	1206899-1206944	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157285-157330	4	0.913
CP035224_2	2.10\|1206899\|46\|CP035224\|CRT	1206899-1206944	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157456	4	0.913
CP035224_2	2.14\|1207181\|46\|CP035224\|CRT	1207181-1207226	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157177-157222	4	0.913
CP035224_2	2.16\|1207325\|46\|CP035224\|CRT	1207325-1207370	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157456	4	0.913
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151606-151633	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153175-153202	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154009-154036	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154153-154180	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155554	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156550	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1870-1897	4	0.857
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2806-2833	4	0.857
CP035224_2	2.22\|1207727\|46\|CP035224\|CRT	1207727-1207772	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157456	4	0.913
CP035224_2	2.28\|1208147\|46\|CP035224\|CRT	1208147-1208192	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157177-157222	4	0.913
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155833-155860	4	0.857
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1114-1141	4	0.857
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16553-16580	4	0.857
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17231-17258	4	0.857
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18035-18062	4	0.857
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18977-19004	4	0.857
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19517-19544	4	0.857
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155779-155806	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151828-151855	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153085-153112	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153601-153628	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153619-153646	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153859-153886	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156415-156442	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157672	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1492-1519	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1573	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2638-2665	4	0.857
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3364-3391	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154741-154768	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154939-154966	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155137-155164	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155371-155398	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156133-156160	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156607-156634	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21037-21064	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15532-15559	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15658-15685	4	0.857
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3244-3271	4	0.857
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151462-151489	4	0.857
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151936-151963	4	0.857
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155527-155554	4	0.857
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156523-156550	4	0.857
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3109	4	0.857
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3316-3343	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154741-154768	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154939-154966	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155137-155164	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155371-155398	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156133-156160	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156607-156634	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21037-21064	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15532-15559	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15658-15685	4	0.857
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3244-3271	4	0.857
CP035224_1	1.1\|118359\|28\|CP035224\|PILER-CR	118359-118386	28	NZ_CP044084	Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence	229220-229247	5	0.821
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2260-2293	5	0.853
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3061	5	0.853
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1132-1165	5	0.853
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153841-153874	5	0.853
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156115-156148	5	0.853
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156589-156622	5	0.853
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3109	5	0.821
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3172-3199	5	0.821
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157303-157330	5	0.821
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157591-157618	5	0.821
CP035224_2	2.22\|1207727\|46\|CP035224\|CRT	1207727-1207772	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3028-3073	5	0.891
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16163-16190	5	0.821
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16181-16208	5	0.821
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16295-16322	5	0.821
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16313-16340	5	0.821
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16427-16454	5	0.821
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17105-17132	5	0.821
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	19757-19784	5	0.821
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	67-94	5	0.821
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	31-58	5	0.821
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157672	5	0.821
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157645-157672	5	0.821
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3514-3547	5	0.853
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155995-156028	5	0.853
CP035224_1	1.3\|118358\|30\|CP035224\|CRISPRCasFinder	118358-118387	30	NZ_CP044084	Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence	229219-229248	6	0.8
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153013-153046	6	0.824
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155713-155746	6	0.824
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156340	6	0.824
CP035224_2	2.16\|1207325\|46\|CP035224\|CRT	1207325-1207370	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3127	6	0.87
CP035224_2	2.19\|1207541\|28\|CP035224\|CRT	1207541-1207568	28	MN693980	Marine virus AFVG_250M1182, complete genome	40458-40485	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1546-1573	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1960-1987	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	152959-152986	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21253-21280	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	988-1015	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	NZ_CP047808	Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence	15874-15901	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	NZ_LT009691	Staphylococcus aureus strain NZAK3 plasmid 2	9811-9838	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	514822-514849	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	NZ_CP013515	Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence	488291-488318	6	0.786
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	NZ_CP013605	Rhizobium sp. N731 plasmid pRspN731d, complete sequence	488285-488312	6	0.786
CP035224_2	2.38\|1208939\|34\|CP035224\|CRT	1208939-1208972	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155731-155764	6	0.824
CP035224_2	2.38\|1208939\|34\|CP035224\|CRT	1208939-1208972	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156643-156676	6	0.824
CP035224_2	2.39\|1208999\|28\|CP035224\|CRT	1208999-1209026	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154507-154534	6	0.786
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18617-18644	6	0.786
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1186-1213	6	0.786
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	KP790010	Gordonia phage GordDuk1, complete genome	63281-63308	6	0.786
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	316861-316888	6	0.786
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155488	6	0.786
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156268	6	0.786
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	6	0.786
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1195	6	0.786
CP035224_2	2.54\|1210199\|28\|CP035224\|CRT	1210199-1210226	28	JQ067084	Pseudomonas phage PaMx25, complete genome	24081-24108	6	0.786
CP035224_2	2.56\|1210325\|28\|CP035224\|CRT	1210325-1210352	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3226-3253	6	0.786
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155461-155488	6	0.786
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156241-156268	6	0.786
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1-28	6	0.786
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	1168-1195	6	0.786
CP035224_2	2.57\|1210379\|28\|CP035224\|CRT	1210379-1210406	28	JQ067084	Pseudomonas phage PaMx25, complete genome	24081-24108	6	0.786
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	988-1021	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1582-1615	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1924-1957	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2224-2257	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2788-2821	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3592-3625	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3766-3799	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156775-156808	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157159-157192	6	0.824
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157609-157642	6	0.824
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153211-153244	7	0.794
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153691-153724	7	0.794
CP035224_2	2.14\|1207181\|46\|CP035224\|CRT	1207181-1207226	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3127	7	0.848
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1618-1645	7	0.75
CP035224_2	2.20\|1207595\|28\|CP035224\|CRT	1207595-1207622	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3550-3577	7	0.75
CP035224_2	2.28\|1208147\|46\|CP035224\|CRT	1208147-1208192	46	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3127	7	0.848
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	17339-17366	7	0.75
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	18653-18680	7	0.75
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP017943	Phyllobacterium zundukense strain Tri-48 plasmid unnamed2, complete sequence	448378-448405	7	0.75
CP035224_2	2.41\|1209101\|28\|CP035224\|CRT	1209101-1209128	28	NZ_CP032314	Pannonibacter phragmitetus BB plasmid p.BB_2, complete sequence	41458-41485	7	0.75
CP035224_2	2.42\|1209155\|28\|CP035224\|CRT	1209155-1209182	28	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3082-3109	7	0.75
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1240-1273	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1528-1561	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1942-1975	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3118-3151	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3280-3313	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	3346-3379	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153241-153274	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153721-153754	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154345-154378	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155443-155476	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156223-156256	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156307-156340	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157285-157318	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	157411-157444	7	0.794
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	CP052430	Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence	970-1003	7	0.794
CP035224_2	2.43\|1209209\|40\|CP035224\|CRT	1209209-1209248	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16163-16202	8	0.8
CP035224_2	2.43\|1209209\|40\|CP035224\|CRT	1209209-1209248	40	NZ_CP035292	Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence	16295-16334	8	0.8
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	154279-154312	8	0.765
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2332-2365	9	0.735
CP035224_2	2.4\|1206497\|34\|CP035224\|CRT	1206497-1206530	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	2620-2653	9	0.735
CP035224_2	2.9\|1206839\|34\|CP035224\|CRT	1206839-1206872	34	CP052500	Klebsiella pneumoniae strain B17KP0021 plasmid unnamed	1174-1207	9	0.735
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153841-153874	9	0.735
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156115-156148	9	0.735
CP035224_2	2.58\|1210433\|34\|CP035224\|CRT	1210433-1210466	34	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156589-156622	9	0.735
CP035224_2	2.30\|1208291\|46\|CP035224\|CRT	1208291-1208336	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	151882-151927	10	0.783
CP035224_2	2.30\|1208291\|46\|CP035224\|CRT	1208291-1208336	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	155491-155536	11	0.761
CP035224_2	2.30\|1208291\|46\|CP035224\|CRT	1208291-1208336	46	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	156271-156316	11	0.761
CP035224_2	2.51\|1209971\|46\|CP035224\|CRT	1209971-1210016	46	NZ_CP023562	Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence	21343-21388	11	0.761
CP035224_2	2.25\|1207937\|64\|CP035224\|CRT	1207937-1208000	64	LR134125	Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5	153895-153958	17	0.734

1. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattccgattct	Protospacer
***************.************

2. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgattccgattcc	Protospacer
********* ******************

3. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 1, identity: 0.964

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgattccgattcc	Protospacer
********* ******************

4. spacer 2.3|1206425|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.957

ttcggattccgatagcgattcggactcggacagcgactccgactcc	CRISPR spacer
ttcggattctgacagcgattcggactcggacagcgactccgactcc	Protospacer
*********.**.*********************************

5. spacer 2.13|1207127|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggatagcgacagtgactcagattcg	CRISPR spacer
ttcggatagcgacagcgactcggattcg	Protospacer
***************.*****.******

6. spacer 2.16|1207325|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.957

ttcggactccgacagtgattcggactcggacagcgactccgattcc	CRISPR spacer
ttcggactccgacagtgattcggattcggacagcgactccgactcc	Protospacer
************************.*****************.***

7. spacer 2.20|1207595|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ctcagattccgatagtgattcggacagc	CRISPR spacer
ctctgattccgacagtgattcggacagc	Protospacer
*** ********.***************

8. spacer 2.27|1208093|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttcggatagcgacagtgactcagattcg	CRISPR spacer
ttcggatagcgacagcgactcggattcg	Protospacer
***************.*****.******

9. spacer 2.39|1208999|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ctccgactctgatagtgattcggattcc	CRISPR spacer
ctccgactccgacagtgattcggattcc	Protospacer
*********.**.***************

10. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagactct	Protospacer
********************* *****

11. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ctcagatagcgacagcgattcagactca	Protospacer
.******************** ******

12. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

13. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

14. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

15. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

16. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagacagcgacagcgattcagactca	Protospacer
******.************** ******

17. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

18. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

19. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

20. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

21. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

22. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagacagcgacagcgattcagactca	Protospacer
******.************** ******

23. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

24. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

25. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

26. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

27. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

28. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.929

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactca	Protospacer
***************.***** ******

29. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattcggacagtgattccgattcc	Protospacer
********* *****************.

30. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagtgactccgattcg	Protospacer
******************.********

31. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagtgactccgattcg	Protospacer
******************.********

32. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
******.********************

33. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
******.********************

34. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
******.********************

35. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
******.********************

36. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
.*****.*********************

37. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagtgactccgattcg	Protospacer
******************.********

38. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
.*****.*********************

39. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattccgattca	Protospacer
******.********************

40. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattctgacagtgattccgattcg	Protospacer
*********.*****************

41. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattcggattct	Protospacer
***************.***** ******

42. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattccgactct	Protospacer
***************.********.***

43. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattccgactct	Protospacer
***************.********.***

44. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagtgattcggattct	Protospacer
.******************** ******

45. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagtgattccgactct	Protospacer
.***********************.***

46. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 2, identity: 0.929

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagtgattcggattct	Protospacer
.******************** ******

47. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgattccgactcc	Protospacer
********* **************.***

48. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 2, identity: 0.929

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgattccgactcc	Protospacer
********* **************.***

49. spacer 2.9|1206839|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattcggattcggacagcgactccgactcc	Protospacer
.**************.*****.************

50. spacer 2.9|1206839|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagcgattcggattccgacagtgactccgactcc	Protospacer
.**.*********** ******************

51. spacer 2.9|1206839|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.912

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattcggattcggacagcgactccgactcc	Protospacer
.**************.*****.************

52. spacer 2.13|1207127|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggatagcgacagtgactcagattcg	CRISPR spacer
ttcagatagcgacagtgattcagattca	Protospacer
***.**************.********.

53. spacer 2.13|1207127|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggatagcgacagtgactcagattcg	CRISPR spacer
ttcagatagcgacagtgattcagattca	Protospacer
***.**************.********.

54. spacer 2.16|1207325|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.935

ttcggactccgacagtgattcggactcggacagcgactccgattcc	CRISPR spacer
ctcggactccgacagtgattcggattcggacagcgactccgactcc	Protospacer
.***********************.*****************.***

55. spacer 2.16|1207325|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

ttcggactccgacagtgattcggactcggacagcgactccgattcc	CRISPR spacer
ctccgattccgacagtgattcggactcggacagcgactccgattcc	Protospacer
.** **.***************************************

56. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattccgactcc	Protospacer
.***********.**************

57. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattccgactcc	Protospacer
.***********.**************

58. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattccgactct	Protospacer
.***********.**************

59. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattccgactct	Protospacer
.***********.**************

60. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattccgactcc	Protospacer
.***********.**************

61. spacer 2.19|1207541|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ttcggattctgacagcgattccgactcc	Protospacer
*********.**.**************

62. spacer 2.19|1207541|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttcggattccgatagcgattccgactcg	CRISPR spacer
ttcggattccgacagtgattccgactct	Protospacer
************.**.***********

63. spacer 2.22|1207727|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.935

ttcggactcggacagtgattcggactcggacagcgactcggattcg	CRISPR spacer
ctcggattcggacagcgattcggactcggacagcgactcggattcg	Protospacer
.*****.********.******************************

64. spacer 2.27|1208093|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggatagcgacagtgactcagattcg	CRISPR spacer
ttcagatagcgacagtgattcagattca	Protospacer
***.**************.********.

65. spacer 2.27|1208093|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcggatagcgacagtgactcagattcg	CRISPR spacer
ttcagatagcgacagtgattcagattca	Protospacer
***.**************.********.

66. spacer 2.39|1208999|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ctccgactctgatagtgattcggattcc	CRISPR spacer
ctccgactctgacagtgactcggattct	Protospacer
************.*****.********.

67. spacer 2.39|1208999|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ctccgactctgatagtgattcggattcc	CRISPR spacer
ctccgactctgacagtgactcggattct	Protospacer
************.*****.********.

68. spacer 2.39|1208999|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctccgactctgatagtgattcggattcc	CRISPR spacer
ttccgactctgacagtgattcggactcc	Protospacer
.***********.***********.***

69. spacer 2.39|1208999|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctccgactctgatagtgattcggattcc	CRISPR spacer
ttccgactctgacagtgattcggactcc	Protospacer
.***********.***********.***

70. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactct	Protospacer
***************.***** *****

71. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactct	Protospacer
***************.***** *****

72. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ctcagatagcgatagcgattcagactca	Protospacer
.***********.******** ******

73. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactct	Protospacer
***************.***** *****

74. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagtgattcagactct	Protospacer
***************.***** *****

75. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ctcagacagcgacagcgattcagactca	Protospacer
.*****.************** ******

76. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ctcagacagcgacagcgattcagactca	Protospacer
.*****.************** ******

77. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagcgacagcgattcggactct	Protospacer
***.***************** *****

78. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagtgacagcgattccgactcc	Protospacer
***.*****.*****************

79. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagtgacagcgattccgactcc	Protospacer
***.*****.*****************

80. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagtgacagcgattccgactcc	Protospacer
***.*****.*****************

81. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagcgacagcgattcggactct	Protospacer
***.***************** *****

82. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagcgacagcgattcggactct	Protospacer
***.***************** *****

83. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactccgacagtgattccgattcg	Protospacer
.*****.********************

84. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattccgactcc	Protospacer
***************.********.**.

85. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattccgactcc	Protospacer
***************.********.**.

86. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
******.**.*****************.

87. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
******.**.*****************.

88. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
***************.***** *****

89. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattcggacagtgactccgattcg	Protospacer
********* ********.********

90. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattcggacagtgactccgattct	Protospacer
.******** ********.*********

91. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
***************.***** *****

92. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
***************.***** *****

93. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
***************.***** *****

94. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattcggattcg	Protospacer
***************.***** *****

95. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgactccgattcg	Protospacer
******.***********.********

96. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactctgacagtgattccgattca	Protospacer
******.**.*****************

97. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgactccgattcg	Protospacer
******.***********.********

98. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattctgacagtgattcggattct	Protospacer
.********.*********** ******

99. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggattccgacagcgattccgactcc	Protospacer
***************.********.**.

100. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
******.**.*****************.

101. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
******.**.*****************.

102. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattctgacagtgattccgattcc	Protospacer
.********.*****************.

103. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagtgactccgattcc	Protospacer
.*****************.********.

104. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattcggattcg	Protospacer
******.************** *****

105. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggactccgacagtgattcggattcg	Protospacer
******.************** *****

106. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

107. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

108. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactccgacagtgattccgattcg	Protospacer
*** ***** *****************

109. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactctgacagtgattccgattca	Protospacer
*** ***** *****************

110. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgactccgattct	Protospacer
********* ********.********.

111. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactctgacagcgattccgattct	Protospacer
********* *****.***********.

112. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
*** ***** *****************.

113. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
*** ***** *****************.

114. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgactccgattcg	Protospacer
********* ********.********

115. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgactccgattcg	Protospacer
********* ********.********

116. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

117. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

118. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

119. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgattcagatagtgattccgattca	Protospacer
******.*****.**************

120. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgattcagatagtgattccgattca	Protospacer
******.*****.**************

121. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

122. spacer 2.54|1210199|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctccgactccgacagtgattcggattcc	Protospacer
.******** *********** ******

123. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgattcagatagtgattccgattca	Protospacer
******.*****.**************

124. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcagactcagatagtgattccgattca	Protospacer
*** ********.**************

125. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

126. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

127. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgattccgactcc	Protospacer
.***********.***********.***

128. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagtgattccgattcc	Protospacer
.***********.**.************

129. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgattccgactcc	Protospacer
.***********.***********.***

130. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgattccgactcc	Protospacer
.***********.***********.***

131. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattcggatagcgattccgattcc	CRISPR spacer
ttcggattcggacagcgattcggattcg	Protospacer
************.******** *****

132. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttcggattcggatagcgattccgattcc	CRISPR spacer
ttccgattcggacagcgattccgattcg	Protospacer
*** ********.**************

133. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

134. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

135. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactccgacagtgattccgattcg	Protospacer
*** ***** *****************

136. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactctgacagtgattccgattca	Protospacer
*** ***** *****************

137. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgactccgattct	Protospacer
********* ********.********.

138. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactctgacagcgattccgattct	Protospacer
********* *****.***********.

139. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
*** ***** *****************.

140. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactccgacagtgattccgattct	Protospacer
*** ***** *****************.

141. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgactccgattcg	Protospacer
********* ********.********

142. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgactccgacagtgactccgattcg	Protospacer
********* ********.********

143. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

144. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattcc	Protospacer
.** ***** ******************

145. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

146. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgattcagatagtgattccgattca	Protospacer
******.*****.**************

147. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgattcagatagtgattccgattca	Protospacer
******.*****.**************

148. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

149. spacer 2.57|1210379|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctccgactccgacagtgattcggattcc	Protospacer
.******** *********** ******

150. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttccgattcagatagtgattccgattca	Protospacer
******.*****.**************

151. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcagactcagatagtgattccgattca	Protospacer
*** ********.**************

152. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

153. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 3, identity: 0.893

ttccgactcagacagtgattccgattcc	CRISPR spacer
ttcggactcagacagtgattcagattca	Protospacer
*** ***************** *****

154. spacer 2.9|1206839|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattcggattcggacagtgactccgattct	Protospacer
.**************.**************.**.

155. spacer 2.9|1206839|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.882

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattcggactccgacagtgactccgactct	Protospacer
.***********.** *****************.

156. spacer 2.10|1206899|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.913

ttccgactccgacagtgattcggactcggacagcgactcggattcg	CRISPR spacer
ctccgattccgacagtgattcggactcggacagcgactccgattcc	Protospacer
.*****.******************************** *****

157. spacer 2.10|1206899|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.913

ttccgactccgacagtgattcggactcggacagcgactcggattcg	CRISPR spacer
ctcggactccgacagtgattcggactcggacagcgactcggactct	Protospacer
.** **************************************.**

158. spacer 2.14|1207181|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.913

ttcggactcggacagtgattccgattcggacagcgattccgattct	CRISPR spacer
ctcggattctgacagtgattccgattcggacagcgattccgattcg	Protospacer
.*****.** ***********************************

159. spacer 2.16|1207325|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.913

ttcggactccgacagtgattcggactcggacagcgactccgattcc	CRISPR spacer
ctcggactccgacagtgattcggactcggacagcgactcggactct	Protospacer
.************************************** **.**.

160. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattcggacagcgattccgactcc	Protospacer
.******** **.**************

161. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattcggactcc	Protospacer
.***********.******** *****

162. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattcggacagcgattccgactcc	Protospacer
.******** **.**************

163. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattcggacagcgattccgactcc	Protospacer
.******** **.**************

164. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattcggacagcgattccgactct	Protospacer
.******** **.**************

165. spacer 2.19|1207541|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattccgacagcgattccgattct	Protospacer
.***********.***********.**

166. spacer 2.19|1207541|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggattctgacagcgattccgactcc	Protospacer
.********.**.**************

167. spacer 2.19|1207541|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggattccgatagcgattccgactcg	CRISPR spacer
ctcggactccgacagcgattccgactct	Protospacer
.*****.*****.**************

168. spacer 2.22|1207727|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.913

ttcggactcggacagtgattcggactcggacagcgactcggattcg	CRISPR spacer
ctcggactccgacagtgattcggactcggacagcgactcggactct	Protospacer
.******** ********************************.**

169. spacer 2.28|1208147|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.913

ttcggactcggacagtgattccgattcggacagcgattccgattct	CRISPR spacer
ctcggattctgacagtgattccgattcggacagcgattccgattcg	Protospacer
.*****.** ***********************************

170. spacer 2.39|1208999|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctccgactctgatagtgattcggattcc	CRISPR spacer
ttccgactctgacagcgattcggattcg	Protospacer
.***********.**.***********

171. spacer 2.39|1208999|28|CP035224|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 4, identity: 0.857

ctccgactctgatagtgattcggattcc	CRISPR spacer
ttccgactctgacagcgattcggattct	Protospacer
.***********.**.***********.

172. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagacagc	Protospacer
********************* ***

173. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagacagc	Protospacer
********************* ***

174. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagacagc	Protospacer
********************* ***

175. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagacagc	Protospacer
********************* ***

176. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.857

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagacagc	Protospacer
********************* ***

177. spacer 2.41|1209101|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcggatagcgacagcgattctgacgcc	Protospacer
***.*****************.*** *

178. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattcggacagtgactccgattcg	Protospacer
.******** ********.********

179. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactccgacagtgactccgattcg	Protospacer
.*****.***********.********

180. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattcggacagtgactccgattcg	Protospacer
.******** ********.********

181. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagcgattcggattcg	Protospacer
.**************.***** *****

182. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactctgacagtgattccgattca	Protospacer
.*****.**.*****************

183. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttccgactccgacagtgattccgattcc	Protospacer
.** **.********************.

184. spacer 2.42|1209155|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
tgcggactccgacagcgattccgattct	Protospacer
. ****.********.************

185. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactccgacagtgattcggattcg	Protospacer
.*****.************** *****

186. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagtgattcggactcg	Protospacer
.******************** **.**

187. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattccgacagtgactccgactcc	Protospacer
.*****************.*****.**.

188. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggactccgacagtgattcggattcg	Protospacer
.*****.************** *****

189. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

190. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

191. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

192. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

193. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattca	Protospacer
.** ***** *****************

194. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattca	Protospacer
.** ***** *****************

195. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcagactcagatagtgattccgattca	Protospacer
.** ********.**************

196. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcagactcagatagtgattccgattca	Protospacer
.** ********.**************

197. spacer 2.54|1210199|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcagactcagatagtgattccgattca	Protospacer
.** ********.**************

198. spacer 2.54|1210199|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctccgactccgacagtgactccgattcg	Protospacer
.******** ********.********

199. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgattcggattcg	Protospacer
.***********.******** *****

200. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgattcggattct	Protospacer
.***********.******** *****.

201. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgattccgactct	Protospacer
.***********.***********.**.

202. spacer 2.56|1210325|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattccgacagcgattccgattct	Protospacer
.******** **.**************.

203. spacer 2.56|1210325|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggattcggatagcgattccgattcc	CRISPR spacer
ttcggattcggacagcgattccgacagc	Protospacer
************.***********.  *

204. spacer 2.56|1210325|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctcggattcggacagcgactccgattct	Protospacer
.***********.*****.********.

205. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

206. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

207. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

208. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattcg	Protospacer
.** ***** *****************

209. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactctgacagtgattccgattca	Protospacer
.** ***** *****************

210. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcggactccgacagtgattccgattca	Protospacer
.** ***** *****************

211. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcagactcagatagtgattccgattca	Protospacer
.** ********.**************

212. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcagactcagatagtgattccgattca	Protospacer
.** ********.**************

213. spacer 2.57|1210379|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctcagactcagatagtgattccgattca	Protospacer
.** ********.**************

214. spacer 2.57|1210379|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 4, identity: 0.857

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctccgactccgacagtgactccgattcg	Protospacer
.******** ********.********

215. spacer 1.1|118359|28|CP035224|PILER-CR matches to NZ_CP044084 (Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

tggaatataaatgagattacgcactctt	CRISPR spacer
tggaatataaatgcgatcacgcaggcat	Protospacer
************* ***.*****  * *

216. spacer 2.4|1206497|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgattcggactcggacagcgattcggattct	Protospacer
******.********************.***  .

217. spacer 2.4|1206497|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgattcggactcggacagcgattcggatgct	Protospacer
******.********************.***. .

218. spacer 2.4|1206497|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgactcggactctgacagcgattcggactcc	Protospacer
*************** ***********.**.  *

219. spacer 2.9|1206839|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattccgattcagacagcgactccgacagc	Protospacer
.******** ***********.*********  *

220. spacer 2.9|1206839|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattccgattcagacagcgactccgacagc	Protospacer
.******** ***********.*********  *

221. spacer 2.9|1206839|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
cagtgattccgattcagacagcgactccgacagc	Protospacer
.******** ***********.*********  *

222. spacer 2.19|1207541|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

ttcggattccgatagcgattccgactcg	CRISPR spacer
ttcggattcggacagcgattccgacagc	Protospacer
********* **.************

223. spacer 2.20|1207595|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

ctcagattccgatagtgattcggacagc	CRISPR spacer
ctccgattccgacagtgattcggactct	Protospacer
*** ********.************  .

224. spacer 2.20|1207595|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

ctcagattccgatagtgattcggacagc	CRISPR spacer
ctccgattccgacagtgattcggactcg	Protospacer
*** ********.************

225. spacer 2.20|1207595|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

ctcagattccgatagtgattcggacagc	CRISPR spacer
ctccgattccgacagtgattcggactct	Protospacer
*** ********.************  .

226. spacer 2.22|1207727|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.891

ttcggactcggacagtgattcggactcggacagcgactcggattcg	CRISPR spacer
ctcggattcggacagtgattcggactcggacagcgattcggatgct	Protospacer
.*****.*****************************.****** *

227. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

228. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

229. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

230. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

231. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

232. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

233. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.821

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagatagcgacagcgattcagatagc	Protospacer
********************* **.

234. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.821

ctcggattccgacagtgattccgattct	CRISPR spacer
tgcagattccgacagcgactccgattct	Protospacer
. *.***********.**.*********

235. spacer 2.42|1209155|28|CP035224|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 5, identity: 0.821

ctcggattccgacagtgattccgattct	CRISPR spacer
tgcagattccgacagcgactccgattct	Protospacer
. *.***********.**.*********

236. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

ttccgactcagacagtgattccgattcc	CRISPR spacer
tgcggactccgacagcgattccgattct	Protospacer
* * ***** *****.***********.

237. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.821

ttccgactcagacagtgattccgattcc	CRISPR spacer
tgcggactccgacagcgattccgattct	Protospacer
* * ***** *****.***********.

238. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 5, identity: 0.853

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattcggactcggacagcgactccgactcc	Protospacer
.  ****** ***********************

239. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 5, identity: 0.853

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgactcagacagcgactcggactca	Protospacer
.  ************.*********** ******

240. spacer 1.3|118358|30|CP035224|CRISPRCasFinder matches to NZ_CP044084 (Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

ttggaatataaatgagattacgcactcttt	CRISPR spacer
ctggaatataaatgcgatcacgcaggcatt	Protospacer
.************* ***.*****  * **

241. spacer 2.4|1206497|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgactcggattcggacagcgattcggactct	Protospacer
************.**************.**.  .

242. spacer 2.4|1206497|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgactccgactccgacagcgattcagactcg	Protospacer
********* ***** **************.

243. spacer 2.4|1206497|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgattcggactcggacagcgattccgactct	Protospacer
******.******************** **.  .

244. spacer 2.16|1207325|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.87

ttcggactccgacagtgattcggactcggacagcgactccgattcc	CRISPR spacer
ctcggactccgacagtgattcggattcggacagcgattccgacagc	Protospacer
.***********************.***********.*****.  *

245. spacer 2.19|1207541|28|CP035224|CRT matches to MN693980 (Marine virus AFVG_250M1182, complete genome) position: , mismatch: 6, identity: 0.786

ttcggattccgatagcgattccgactcg	CRISPR spacer
ggcagattccgataggtattccgactct	Protospacer
  *.***********  **********

246. spacer 2.20|1207595|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcggattccgacagtgattcggactcg	Protospacer
.**.********.************

247. spacer 2.20|1207595|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttccgattccgacagtgattcggactct	Protospacer
.** ********.************  .

248. spacer 2.20|1207595|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattccgatagcgattcagattcc	Protospacer
.**************.*****.**.  *

249. spacer 2.20|1207595|28|CP035224|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattcagatagcgattcggactca	Protospacer
.******** *****.*********

250. spacer 2.20|1207595|28|CP035224|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttccgattccgacagtgattcggactct	Protospacer
.** ********.************  .

251. spacer 2.20|1207595|28|CP035224|CRT matches to NZ_CP047808 (Staphylococcus aureus strain UP_1612 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattcagatagcgattcggactca	Protospacer
.******** *****.*********

252. spacer 2.20|1207595|28|CP035224|CRT matches to NZ_LT009691 (Staphylococcus aureus strain NZAK3 plasmid 2) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattcagatagcgattcggactca	Protospacer
.******** *****.*********

253. spacer 2.20|1207595|28|CP035224|CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattcagatagggattcggaattc	Protospacer
.******** ***** ********   *

254. spacer 2.20|1207595|28|CP035224|CRT matches to NZ_CP013515 (Rhizobium sp. N1314 plasmid pRspN1314d, complete sequence) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattcagatagggattcggagttc	Protospacer
.******** ***** ********   *

255. spacer 2.20|1207595|28|CP035224|CRT matches to NZ_CP013605 (Rhizobium sp. N731 plasmid pRspN731d, complete sequence) position: , mismatch: 6, identity: 0.786

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcagattcagatagggattcggagttc	Protospacer
.******** ***** ********   *

256. spacer 2.38|1208939|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

ctcggattcggacagcgacagtgactccgactcg	CRISPR spacer
cagcgattcggactccgacagtgactccgactcc	Protospacer
*   *********  ******************

257. spacer 2.38|1208939|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

ctcggattcggacagcgacagtgactccgactcg	CRISPR spacer
cagtgattcggactccgacagtgactccgactct	Protospacer
*   *********  ******************

258. spacer 2.39|1208999|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ctccgactctgatagtgattcggattcc	CRISPR spacer
ttccgactctgacagcgattcggatagt	Protospacer
.***********.**.*********  .

259. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.786

ttcagatagcgacagcgattccgactca	CRISPR spacer
ttcagacagcgacagcgattcagatagc	Protospacer
******.************** **.

260. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ctcggattccgacagtgattccgattct	CRISPR spacer
ctctgattccgacagtgattcggacagc	Protospacer
*** ***************** **.  .

261. spacer 2.42|1209155|28|CP035224|CRT matches to KP790010 (Gordonia phage GordDuk1, complete genome) position: , mismatch: 6, identity: 0.786

ctcggattccgacagtgattccgattct	CRISPR spacer
gcaggattccgacgatgattccgattcc	Protospacer
 . **********..************.

262. spacer 2.42|1209155|28|CP035224|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.786

ctcggattccgacagtgattccgattct	CRISPR spacer
ctcggatcccgacagtaattccggctgg	Protospacer
*******.********.******..*

263. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgattccgactct	Protospacer
.  ****** **************.**.

264. spacer 2.54|1210199|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgattccgactct	Protospacer
.  ****** **************.**.

265. spacer 2.54|1210199|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgactccgattct	Protospacer
.  ****** ********.********.

266. spacer 2.54|1210199|28|CP035224|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgactccgattct	Protospacer
.  ****** ********.********.

267. spacer 2.54|1210199|28|CP035224|CRT matches to JQ067084 (Pseudomonas phage PaMx25, complete genome) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctccgaaccagacagtgattccgatcag	Protospacer
.***** .*****************.

268. spacer 2.56|1210325|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ttcggattcggatagcgattccgattcc	CRISPR spacer
ctccgattcggacagcgattccgacagc	Protospacer
.** ********.***********.  *

269. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgattccgactct	Protospacer
.  ****** **************.**.

270. spacer 2.57|1210379|28|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgattccgactct	Protospacer
.  ****** **************.**.

271. spacer 2.57|1210379|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgactccgattct	Protospacer
.  ****** ********.********.

272. spacer 2.57|1210379|28|CP035224|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
cagcgactctgacagtgactccgattct	Protospacer
.  ****** ********.********.

273. spacer 2.57|1210379|28|CP035224|CRT matches to JQ067084 (Pseudomonas phage PaMx25, complete genome) position: , mismatch: 6, identity: 0.786

ttccgactcagacagtgattccgattcc	CRISPR spacer
ctccgaaccagacagtgattccgatcag	Protospacer
.***** .*****************.

274. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgactccgacagcgactcggactct	Protospacer
.  ************ *********** *****

275. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattcggactctgacagcgactccgactcc	Protospacer
.  ****** ***** *****************

276. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgactccgactcggacagcgactcggactct	Protospacer
.  ***.******************** *****

277. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgactccgacagcgactcagactcc	Protospacer
.  ************ *********** *****

278. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgactctgacagtgactccgactcc	Protospacer
.  ************ *****.***********

279. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgactccgactcggacagcgactctgactcc	Protospacer
.  ***.********************.*****

280. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgactctgactcggacagcgactccgactcg	Protospacer
.  ***.**.***********************.

281. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgactctgacagcgactcggactcc	Protospacer
.  ************ *********** *****

282. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgattcggacagcgattccgactct	Protospacer
.  *********.***********.********

283. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 6, identity: 0.824

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagcgattccgactctgacagcgactccgattcc	Protospacer
.  ************ **************.**

284. spacer 2.4|1206497|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
ctctgactcggactccgacagcgattcggattcg	Protospacer
*  ************ ***********.***

285. spacer 2.4|1206497|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
ctctgactcggactccgacagcgattcggactcc	Protospacer
*  ************ ***********.**.  *

286. spacer 2.14|1207181|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.848

ttcggactcggacagtgattccgattcggacagcgattccgattct	CRISPR spacer
ctcggactccgacagtgattcggattcggacagcgattccgacagc	Protospacer
.******** *********** ********************.  .

287. spacer 2.20|1207595|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcggattccgacagtgattcggattct	Protospacer
.**.********.***********.  .

288. spacer 2.20|1207595|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

ctcagattccgatagtgattcggacagc	CRISPR spacer
ttcggattccgacagtgattcggattct	Protospacer
.**.********.***********.  .

289. spacer 2.28|1208147|46|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.848

ttcggactcggacagtgattccgattcggacagcgattccgattct	CRISPR spacer
ctcggactccgacagtgattcggattcggacagcgattccgacagc	Protospacer
.******** *********** ********************.  .

290. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

ttcagatagcgacagcgattccgactca	CRISPR spacer
ctcagacagcgacagcgattcagatagc	Protospacer
.*****.************** **.

291. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.75

ttcagatagcgacagcgattccgactca	CRISPR spacer
ctcagacagcgacagcgattcagatagc	Protospacer
.*****.************** **.

292. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP017943 (Phyllobacterium zundukense strain Tri-48 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.75

ttcagatagcgacagcgattccgactca	CRISPR spacer
ccgagattgcgacagcgactccgactat	Protospacer
.. **** **********.*******

293. spacer 2.41|1209101|28|CP035224|CRT matches to NZ_CP032314 (Pannonibacter phragmitetus BB plasmid p.BB_2, complete sequence) position: , mismatch: 7, identity: 0.75

ttcagatagcgacagcgattccgactca	CRISPR spacer
accagatcgcaacagcgattccgacaat	Protospacer
 .***** **.**************

294. spacer 2.42|1209155|28|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.75

ctcggattccgacagtgattccgattct	CRISPR spacer
ttcggattcggacagcgattccgacagc	Protospacer
.******** *****.********.  .

295. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggattcggacagcgactccgactcc	Protospacer
.  .***** **.********************

296. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggactcggacagcgactctgactcg	Protospacer
.  .***** *****************.*****.

297. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggactctgacagcgactccgactcg	Protospacer
.  .***** ***** *****************.

298. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactctgacagcgactcggactcc	Protospacer
.  .*********** *********** *****

299. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactccgacagcgactcggactct	Protospacer
.  .*********** *********** *****

300. spacer 2.58|1210433|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggattcggacagcgactccgactcc	Protospacer
.  .***** **.********************

301. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactctgacagcgattccgactct	Protospacer
.  .*********** ********.********

302. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactctgacagcgattccgactct	Protospacer
.  .*********** ********.********

303. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactctgacagcgactcggactct	Protospacer
.  .*********** *********** *****

304. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactctgacagcgactcggactct	Protospacer
.  .*********** *********** *****

305. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgactctgacagcgactcggactcc	Protospacer
.  .*********** *********** *****

306. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggactcggacagcgattccgactct	Protospacer
.  .***** **************.********

307. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggactcggacagcgactccgattcc	Protospacer
.  .***** ********************.**

308. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggactcggacagcgactcggactct	Protospacer
.  .***** ***************** *****

309. spacer 2.58|1210433|34|CP035224|CRT matches to CP052430 (Klebsiella pneumoniae strain C16KP0129 plasmid pC16KP0129-3, complete sequence) position: , mismatch: 7, identity: 0.794

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattcggactctgacagcgactccgactcc	Protospacer
.  .***** ***** *****************

310. spacer 2.43|1209209|40|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.8

ttctgactcagacagtgattcggatagcgacagcgattcc	CRISPR spacer
ttcagatagcgacagcgattcagatagcgacagcgattca	Protospacer
*** **.   *****.*****.*****************

311. spacer 2.43|1209209|40|CP035224|CRT matches to NZ_CP035292 (Staphylococcus haemolyticus strain ATCC 29970 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.8

ttctgactcagacagtgattcggatagcgacagcgattcc	CRISPR spacer
ttcagatagcgacagcgattcagatagcgacagcgattca	Protospacer
*** **.   *****.*****.*****************

312. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 8, identity: 0.765

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
ctctgacagcgactccgacagtgactccgactct	Protospacer
.**.**.  ****** *****.***********

313. spacer 2.4|1206497|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
ctcggactcggactcggacagcgactcggactct	Protospacer
*   ********************.**.**.  .

314. spacer 2.4|1206497|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

cagtgactcggactcggacagcgattcagatagc	CRISPR spacer
cagtgactccgactccgacagcgacagtgattcg	Protospacer
********* ***** ********.   ***

315. spacer 2.9|1206839|34|CP035224|CRT matches to CP052500 (Klebsiella pneumoniae strain B17KP0021 plasmid unnamed) position: , mismatch: 9, identity: 0.735

tagtgattcggattcagacagtgactccgactcc	CRISPR spacer
ttccgacagtgattcggacagcgactccgactcc	Protospacer
*  .**.   *****.*****.************

316. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgattcagacagcgactccgacagc	Protospacer
.  .********.**.***************

317. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgattcagacagcgactccgacagc	Protospacer
.  .********.**.***************

318. spacer 2.58|1210433|34|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 9, identity: 0.735

ttccgattccgactcggacagcgactccgactca	CRISPR spacer
cagtgattccgattcagacagcgactccgacagc	Protospacer
.  .********.**.***************

319. spacer 2.30|1208291|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 10, identity: 0.783

ctcggatagcgacagtgattcggactcggacagtgattcagatagc	CRISPR spacer
ctctgactcggacagtgattcggactccgacagtgattccgattcg	Protospacer
*** **.   ***************** *********** ***

320. spacer 2.30|1208291|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.761

ctcggatagcgacagtgattcggactcggacagtgattcagatagc	CRISPR spacer
ttccgactctgacagtgattcggactccgacagtgattccgattct	Protospacer
.** **.  .***************** *********** ***  .

321. spacer 2.30|1208291|46|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 11, identity: 0.761

ctcggatagcgacagtgattcggactcggacagtgattcagatagc	CRISPR spacer
ttccgactctgacagtgattcggactccgacagtgattccgattct	Protospacer
.** **.  .***************** *********** ***  .

322. spacer 2.51|1209971|46|CP035224|CRT matches to NZ_CP023562 (Staphylococcus aureus strain TF3198 plasmid pTF3198, complete sequence) position: , mismatch: 11, identity: 0.761

ttcggatagcgacagcgactcagactcggacagtgactcagatagc	CRISPR spacer
ctcagactcagacagcgactcagactcagacagcgactcagattca	Protospacer
.**.**.   *****************.*****.*********

323. spacer 2.25|1207937|64|CP035224|CRT matches to LR134125 (Klebsiella aerogenes strain NCTC10006 genome assembly, plasmid: 5) position: , mismatch: 17, identity: 0.734

ctcggattccgacagt------gattcggattcagacagtgattcggactccgacagcga	CRISPR spacer
------ttccgacagtgactccgattcggattctgacagtgattcggactccgacagcga	Protospacer
      **********      *********** **************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

339531 : 430756

Staphylococcus_virus(14.29%)

transposase,tRNA,protease,bacteriocin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT28983.1\|339531_340095_-\|protease	matrixin family metalloprotease	NA	NA	NA	NA
QAT28984.1\|340288_340957_+	ribose 5-phosphate isomerase A	NA	NA	NA	NA
QAT28985.1\|341114_342620_+	copper oxidase	NA	NA	NA	NA
QAT28986.1\|342884_343253_+	DUF1304 domain-containing protein	NA	NA	NA	NA
QAT28987.1\|343286_344942_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.6e-93	41.5
QAT28988.1\|345133_345643_-	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
QAT28989.1\|345673_346870_-	DUF2075 domain-containing protein	NA	NA	NA	NA
QAT28990.1\|346979_347450_+	transcriptional regulator	NA	NA	NA	NA
QAT28991.1\|347468_347924_+	hypothetical protein	NA	NA	NA	NA
QAT28992.1\|348027_348600_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
QAT28993.1\|348765_349686_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
QAT28994.1\|349822_350734_+	oxidoreductase	NA	NA	NA	NA
QAT31554.1\|350979_351246_+	hypothetical protein	NA	NA	NA	NA
QAT28995.1\|351740_352187_-	ribonuclease H	NA	NA	NA	NA
QAT28996.1\|352424_353951_+	ABC transporter permease/substrate-binding protein	NA	NA	NA	NA
QAT28997.1\|353951_354923_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
QAT28998.1\|355000_356332_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAT28999.1\|356797_358315_+	glycerol kinase	NA	NA	NA	NA
QAT29000.1\|358329_360159_+	type 1 glycerol-3-phosphate oxidase	NA	NA	NA	NA
QAT29001.1\|360173_360896_+	aquaporin family protein	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
QAT29002.1\|361483_365179_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAT29003.1\|367056_367560_+	hypothetical protein	NA	NA	NA	NA
QAT29004.1\|368331_368595_+	hypothetical protein	NA	NA	NA	NA
QAT29005.1\|368706_368985_+	hypothetical protein	NA	NA	NA	NA
QAT29006.1\|369523_369796_+	hypothetical protein	NA	NA	NA	NA
QAT29007.1\|369998_370253_+	hypothetical protein	NA	NA	NA	NA
QAT29008.1\|371256_371565_+	hypothetical protein	NA	NA	NA	NA
QAT29009.1\|371981_372260_+	hypothetical protein	NA	NA	NA	NA
QAT31555.1\|372324_372441_+	hypothetical protein	NA	NA	NA	NA
QAT29010.1\|372564_373482_+	hypothetical protein	NA	NA	NA	NA
QAT29011.1\|374206_374749_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
QAT29012.1\|374763_375027_+	hypothetical protein	NA	NA	NA	NA
QAT29013.1\|375614_376001_+	hypothetical protein	NA	NA	NA	NA
QAT29014.1\|376226_376382_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
QAT29015.1\|376450_376642_+	hypothetical protein	NA	NA	NA	NA
QAT29016.1\|377033_377279_+	hypothetical protein	NA	NA	NA	NA
QAT29017.1\|377853_378273_+	hypothetical protein	NA	NA	NA	NA
QAT29018.1\|378554_379028_+	hypothetical protein	NA	NA	NA	NA
QAT29019.1\|379363_379981_-	sugar O-acetyltransferase	NA	NA	NA	NA
QAT29020.1\|379984_381139_-	MFS transporter	NA	NA	NA	NA
QAT29021.1\|381142_381934_-	HAD family hydrolase	NA	NA	NA	NA
QAT29022.1\|382004_382877_-	AraC family transcriptional regulator	NA	NA	NA	NA
QAT29023.1\|383036_383852_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
QAT29024.1\|384377_385754_+	branched-chain amino acid transport system II carrier protein	NA	NA	NA	NA
QAT29025.1\|385798_386983_+	cation:proton antiporter	NA	NA	NA	NA
QAT29026.1\|387367_387571_+	hypothetical protein	NA	NA	NA	NA
QAT29027.1\|387805_387958_-	hypothetical protein	NA	NA	NA	NA
QAT29028.1\|387982_388651_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
QAT29029.1\|388647_388821_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnK	NA	NA	NA	NA
QAT29030.1\|388851_389019_-\|bacteriocin	two-peptide bacteriocin plantaricin JK subunit PlnJ	NA	NA	NA	NA
QAT29031.1\|389880_390081_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
QAT29032.1\|390208_390376_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
QAT29033.1\|390493_391693_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
QAT29034.1\|391723_392470_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT29035.1\|392824_393013_+	pirin	NA	NA	NA	NA
QAT29036.1\|393348_393495_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
QAT29037.1\|393685_395014_+	GHKL domain-containing protein	NA	NA	NA	NA
QAT29038.1\|395014_395758_+	response regulator transcription factor	NA	NA	NA	NA
QAT29039.1\|395876_396620_+	response regulator transcription factor	NA	NA	NA	NA
QAT29040.1\|396925_397699_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT29041.1\|397797_397956_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnF	NA	NA	NA	NA
QAT29042.1\|397980_398151_-\|bacteriocin	two-peptide bacteriocin plantaricin EF subunit PlnE	NA	NA	NA	NA
QAT29043.1\|398417_400568_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.6e-45	28.1
QAT29044.1\|400583_401960_+	HlyD family secretion protein	NA	NA	NA	NA
QAT29045.1\|402049_402739_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT29046.1\|402806_403475_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT29047.1\|403561_404242_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT29048.1\|404335_405022_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT31556.1\|405172_405460_+	hypothetical protein	NA	NA	NA	NA
QAT29049.1\|405471_405765_+	addiction module antidote protein, HigA family	M9MUN2	Rhodococcus_phage	1.3e-06	48.3
QAT29050.1\|406054_408364_-	ATP-dependent DNA helicase	NA	NA	NA	NA
QAT29051.1\|408622_409399_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
QAT29052.1\|409837_410854_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAT29053.1\|411261_411972_+	GntR family transcriptional regulator	NA	NA	NA	NA
QAT29054.1\|412044_413406_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
QAT29055.1\|413412_413601_+	hypothetical protein	NA	NA	NA	NA
QAT29056.1\|413590_414013_+	DUF3284 domain-containing protein	NA	NA	NA	NA
QAT31557.1\|414235_415591_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
QAT29057.1\|415608_417045_+	glycosyl hydrolase family protein	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
QAT29058.1\|417165_418062_+	ROK family protein	NA	NA	NA	NA
QAT29059.1\|418211_418958_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
QAT29060.1\|419070_420084_+\|tRNA	tRNA-dihydrouridine synthase family protein	NA	NA	NA	NA
QAT29061.1\|420538_421672_+	hypothetical protein	NA	NA	NA	NA
QAT29062.1\|421676_422471_+	hypothetical protein	NA	NA	NA	NA
QAT29063.1\|422639_423557_+	Ppx/GppA family phosphatase	NA	NA	NA	NA
QAT29064.1\|423602_424877_+	hydroxymethylglutaryl-CoA reductase, degradative	NA	NA	NA	NA
QAT29065.1\|424869_425829_+	IpaB/EvcA family protein	NA	NA	NA	NA
QAT29066.1\|425850_426555_+	NAD-dependent protein deacylase	NA	NA	NA	NA
QAT29067.1\|426554_427397_+	DUF72 domain-containing protein	NA	NA	NA	NA
QAT29068.1\|427993_428383_+	NUDIX domain-containing protein	NA	NA	NA	NA
QAT29069.1\|428704_430756_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

559425 : 604340

Lactobacillus_phage(62.5%)

tRNA,portal,protease,capsid,terminase,integrase

attL 577132:577147|attR 599874:599889

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT29175.1\|559425_560118_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
QAT29176.1\|560307_561639_-	aminopeptidase	R4TV59	Phaeocystis_globosa_virus	5.4e-68	33.3
QAT29177.1\|561714_562398_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
QAT29178.1\|562406_562703_-	N-acetyltransferase	NA	NA	NA	NA
QAT29179.1\|562841_563378_+	dUTP diphosphatase	J9PV85	Bacillus_phage	1.1e-35	46.4
QAT29180.1\|563791_563974_+	hypothetical protein	NA	NA	NA	NA
QAT29181.1\|564257_565637_+	DNA repair protein RadA	NA	NA	NA	NA
QAT29182.1\|565652_566828_+	PIN/TRAM domain-containing protein	NA	NA	NA	NA
QAT29183.1\|567153_568644_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
QAT29184.1\|568921_570334_+\|tRNA	cysteine--tRNA ligase	F1C979	Terra1_virus	1.5e-44	27.7
QAT29185.1\|570335_570746_+	Mini-ribonuclease 3	NA	NA	NA	NA
QAT29186.1\|571503_572049_+	NYN domain-containing protein	NA	NA	NA	NA
QAT29187.1\|572555_573158_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
QAT29188.1\|573219_573369_+	50S ribosomal protein L33	NA	NA	NA	NA
QAT29189.1\|573380_573566_+	preprotein translocase subunit SecE	NA	NA	NA	NA
QAT29190.1\|573670_574219_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
QAT29191.1\|574246_575134_+	alpha/beta hydrolase	NA	NA	NA	NA
QAT29192.1\|575235_575661_+	50S ribosomal protein L11	NA	NA	NA	NA
QAT29193.1\|575761_576451_+	50S ribosomal protein L1	NA	NA	NA	NA
QAT29194.1\|576649_577153_+	50S ribosomal protein L10	NA	NA	NA	NA
577132:577147	attL	NA	NA	NA	NA
QAT29195.1\|577214_577583_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
QAT29196.1\|577734_578937_-\|integrase	integrase	A0A126GGK4	Streptococcus_phage	2.0e-37	29.2
QAT29197.1\|579167_580892_-	DUF2326 domain-containing protein	NA	NA	NA	NA
QAT29198.1\|580863_581130_-	hypothetical protein	NA	NA	NA	NA
QAT29199.1\|581126_581672_-	hypothetical protein	NA	NA	NA	NA
QAT29200.1\|582263_582797_-	hypothetical protein	NA	NA	NA	NA
QAT29201.1\|582863_583295_-	hypothetical protein	O03904	Lactobacillus_phage	1.8e-73	90.9
QAT29202.1\|583303_583690_-	helix-turn-helix domain-containing protein	O03970	Lactobacillus_phage	4.9e-46	70.1
QAT29203.1\|583831_584101_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT29204.1\|584257_584539_-	hypothetical protein	NA	NA	NA	NA
QAT29205.1\|584618_584801_+	hypothetical protein	NA	NA	NA	NA
QAT29206.1\|584861_585416_+	hypothetical protein	O03909	Lactobacillus_phage	2.5e-96	97.8
QAT29207.1\|585421_585706_+	DNA-binding protein	NA	NA	NA	NA
QAT29208.1\|585773_585944_+	hypothetical protein	NA	NA	NA	NA
QAT29209.1\|586075_586189_+	hypothetical protein	NA	NA	NA	NA
QAT29210.1\|586206_586737_+	hypothetical protein	E9LUU0	Lactobacillus_phage	6.1e-55	59.2
QAT29211.1\|586748_587714_+	hypothetical protein	A6M982	Geobacillus_virus	2.2e-63	53.6
QAT29212.1\|587795_588680_+	DNA replication protein DnaD	NA	NA	NA	NA
QAT29213.1\|588676_588964_+	hypothetical protein	NA	NA	NA	NA
QAT29214.1\|588960_589494_+	hypothetical protein	O03915	Lactobacillus_phage	2.4e-35	51.7
QAT29215.1\|589486_589906_+	RusA family crossover junction endodeoxyribonuclease	A8YQM5	Lactobacillus_phage	2.2e-23	42.3
QAT29216.1\|589902_590133_+	hypothetical protein	O03916	Lactobacillus_phage	5.9e-23	61.8
QAT29217.1\|590135_590270_+	hypothetical protein	O03917	Lactobacillus_phage	4.8e-17	97.7
QAT29218.1\|590266_590743_+	methyltransferase domain-containing protein	O03918	Lactobacillus_phage	3.6e-83	89.2
QAT29219.1\|590743_591814_+	DNA cytosine methyltransferase	A0A1I9KKE7	Lactobacillus_phage	3.3e-124	60.8
QAT29220.1\|592237_592996_-	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	6.0e-40	39.6
QAT29221.1\|593068_593518_+	hypothetical protein	B8R690	Lactobacillus_phage	4.1e-12	37.0
QAT29222.1\|594299_594971_+	hypothetical protein	NA	NA	NA	NA
QAT29223.1\|595008_595929_+\|terminase	terminase	Q6SE85	Lactobacillus_prophage	2.1e-71	55.4
QAT29224.1\|595925_597230_+\|terminase	PBSX family phage terminase large subunit	U3PBE8	Lactobacillus_phage	3.5e-112	46.9
QAT29225.1\|597242_598859_+\|portal	phage portal protein	O03928	Lactobacillus_phage	1.6e-90	38.8
QAT29226.1\|598872_600000_+	hypothetical protein	U3PFU0	Lactobacillus_phage	6.4e-46	31.0
599874:599889	attR	NA	NA	NA	NA
QAT29227.1\|600014_600731_+	hypothetical protein	A0A0H4IP83	Staphylococcus_phage	2.2e-15	37.4
QAT29228.1\|600743_601787_+	replication protein	O03966	Lactobacillus_phage	2.0e-134	70.4
QAT29229.1\|601953_602349_+	hypothetical protein	NA	NA	NA	NA
QAT29230.1\|602349_602742_+	hypothetical protein	NA	NA	NA	NA
QAT29231.1\|602741_603128_+\|capsid	capsid protein	NA	NA	NA	NA
QAT29232.1\|603117_603534_+	hypothetical protein	NA	NA	NA	NA
QAT29233.1\|603554_604340_+	Ig-like domain-containing protein	A0A288TYH2	Enterococcus_phage	5.2e-10	41.0

DBSCAN-SWA_3

615837 : 622962

Lactobacillus_phage(100.0%)

tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT29238.1\|615837_618411_+\|tail	phage tail protein	A0A2K9VCB6	Lactobacillus_phage	1.7e-280	51.8
QAT29239.1\|618403_618655_+	hypothetical protein	A0A2K9VDF6	Lactobacillus_phage	1.2e-29	95.8
QAT31561.1\|618879_620034_+	LysM peptidoglycan-binding domain-containing protein	A0A2K9VDG6	Lactobacillus_phage	5.0e-54	35.2
QAT29240.1\|620033_620297_+\|holin	holin	E9LUR9	Lactobacillus_phage	4.1e-36	95.4
QAT29241.1\|620308_620842_+\|holin	holin	E9LUS0	Lactobacillus_phage	2.5e-40	97.9
QAT29242.1\|621326_621926_-	hypothetical protein	NA	NA	NA	NA
QAT29243.1\|622045_622639_-	DUF1643 domain-containing protein	NA	NA	NA	NA
QAT31562.1\|622842_622962_+	LysM domain-containing protein	A0A0A7DMK9	Lactobacillus_phage	2.2e-05	60.0

DBSCAN-SWA_4

634311 : 642935

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT29253.1\|634311_636009_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.9e-55	37.0
QAT29254.1\|636030_636339_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
QAT29255.1\|636354_636954_+	recombination protein RecR	NA	NA	NA	NA
QAT29256.1\|636968_637220_+	DUF2508 family protein	NA	NA	NA	NA
QAT29257.1\|637617_638283_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
QAT29258.1\|638279_638609_+	hypothetical protein	NA	NA	NA	NA
QAT29259.1\|638625_639645_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
QAT29260.1\|639669_640017_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.4e-12	33.3
QAT29261.1\|640115_641012_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.3e-81	55.7
QAT29262.1\|641015_641801_+	acyl-ACP thioesterase	NA	NA	NA	NA
QAT29263.1\|641939_642935_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-50	37.9

DBSCAN-SWA_5

1311985 : 1319257

Lactobacillus_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT29809.1\|1311985_1312933_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.9e-177	99.7
QAT29810.1\|1313275_1313890_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
QAT29811.1\|1313892_1316331_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.6
QAT29812.1\|1316418_1316979_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
QAT29813.1\|1317049_1317490_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
QAT29814.1\|1317585_1317723_+	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
QAT29815.1\|1317880_1319257_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	3.4e-25	31.0

DBSCAN-SWA_6

2146505 : 2186089

Lactobacillus_phage(41.18%)

tail,head,holin,portal,protease,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT30564.1\|2146505_2146889_-\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	1.1e-13	67.6
QAT30565.1\|2146875_2147172_-	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	77.6
QAT31625.1\|2147172_2148306_-	LysM peptidoglycan-binding domain-containing protein	O03950	Lactobacillus_phage	2.4e-32	77.4
QAT30566.1\|2148466_2148901_-	hypothetical protein	NA	NA	NA	NA
QAT30567.1\|2148903_2149353_-	DUF1617 family protein	A0A2P0ZLE0	Lactobacillus_phage	6.8e-23	40.5
QAT30568.1\|2149359_2154720_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	8.4e-144	59.4
QAT31626.1\|2154734_2155067_-	hypothetical protein	V5UQS8	Oenococcus_phage	2.2e-42	73.4
QAT30569.1\|2155110_2160942_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	2.8e-225	40.8
QAT31627.1\|2160957_2161221_-	hypothetical protein	V9QKH3	Oenococcus_phage	2.3e-23	65.4
QAT30570.1\|2161328_2161727_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
QAT31628.1\|2161826_2162210_-\|tail	phage tail protein	V5USQ9	Oenococcus_phage	1.8e-37	58.4
QAT30571.1\|2162311_2162677_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
QAT30572.1\|2162676_2163228_-	HK97 gp10 family phage protein	V5URV0	Oenococcus_phage	3.3e-64	61.7
QAT30573.1\|2163229_2163577_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
QAT30574.1\|2163576_2163909_-	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
QAT30575.1\|2163920_2164097_-	conjugal transfer protein	NA	NA	NA	NA
QAT30576.1\|2164109_2165132_-\|capsid	major capsid protein	V5US24	Oenococcus_phage	3.7e-117	62.5
QAT30577.1\|2165151_2165499_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.4e-30	63.8
QAT30578.1\|2165513_2166191_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	6.0e-15	32.1
QAT30579.1\|2166362_2166569_-	hypothetical protein	NA	NA	NA	NA
QAT30580.1\|2166620_2166899_-	hypothetical protein	NA	NA	NA	NA
QAT30581.1\|2166873_2168559_-\|head	phage head morphogenesis protein	V5US81	Oenococcus_phage	3.8e-119	58.3
QAT30582.1\|2168705_2169002_-\|protease	ribosomal-processing cysteine protease Prp	D2J003	Enterococcus_phage	1.1e-10	40.2
QAT30583.1\|2168931_2170440_-\|portal	phage portal protein	V5US18	Oenococcus_phage	1.8e-136	52.0
QAT30584.1\|2170451_2171690_-\|terminase	PBSX family phage terminase large subunit	M1PG09	Streptococcus_phage	5.4e-139	61.0
QAT30585.1\|2171679_2172558_-\|terminase	terminase	V5URT8	Oenococcus_phage	7.0e-56	48.9
QAT30586.1\|2172611_2172806_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.7e-07	58.0
QAT30587.1\|2172846_2173329_-	hypothetical protein	NA	NA	NA	NA
QAT30588.1\|2174061_2174523_-	transcriptional regulator	D6PSV8	Lactobacillus_phage	1.2e-38	56.3
QAT30589.1\|2174733_2174928_-	hypothetical protein	A0A2P0ZLB7	Lactobacillus_phage	4.5e-16	71.4
QAT30590.1\|2174931_2175243_-	hypothetical protein	A0A2P0ZLB4	Lactobacillus_phage	8.5e-49	91.3
QAT30591.1\|2175245_2175620_-	hypothetical protein	NA	NA	NA	NA
QAT30592.1\|2175616_2176135_-	hypothetical protein	O03915	Lactobacillus_phage	7.7e-55	68.4
QAT30593.1\|2176131_2176419_-	hypothetical protein	NA	NA	NA	NA
QAT30594.1\|2176415_2177324_-	DnaD domain protein	NA	NA	NA	NA
QAT30595.1\|2177770_2177977_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAT30596.1\|2178058_2178919_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	1.6e-76	52.1
QAT30597.1\|2178842_2179730_-	recombinase RecT	E9LUM3	Lactobacillus_phage	4.7e-60	47.0
QAT30598.1\|2179726_2180113_-	hypothetical protein	NA	NA	NA	NA
QAT30599.1\|2180245_2180416_-	hypothetical protein	NA	NA	NA	NA
QAT30600.1\|2180483_2180996_-	XRE family transcriptional regulator	D6PST4	Lactobacillus_phage	8.0e-28	43.5
QAT30601.1\|2181063_2181369_-	DUF771 domain-containing protein	NA	NA	NA	NA
QAT30602.1\|2181575_2181872_-	hypothetical protein	NA	NA	NA	NA
QAT30603.1\|2181871_2182078_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAT30604.1\|2182219_2182450_+	XRE family transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
QAT30605.1\|2182487_2182802_+	hypothetical protein	NA	NA	NA	NA
QAT30606.1\|2182878_2183115_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAT30607.1\|2183264_2183633_+	XRE family transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
QAT30608.1\|2183644_2184058_+	ImmA/IrrE family metallo-endopeptidase	A0A0M4RD70	Bacillus_phage	3.4e-05	31.3
QAT30609.1\|2184080_2185016_+	hypothetical protein	NA	NA	NA	NA
QAT30610.1\|2185025_2185280_+	hypothetical protein	NA	NA	NA	NA
QAT30611.1\|2185387_2186089_+	DUF3862 domain-containing protein	A0A0P0IXE0	Lactobacillus_phage	2.0e-05	80.8

DBSCAN-SWA_7

2394463 : 2402977

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT30789.1\|2394463_2395042_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
QAT30790.1\|2395034_2396060_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	4.2e-60	40.7
QAT30791.1\|2396056_2397511_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
QAT30792.1\|2397495_2399715_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	5.9e-144	39.5
QAT30793.1\|2399707_2400388_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAT30794.1\|2400387_2400642_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
QAT30795.1\|2400643_2401375_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	2.1e-37	37.3
QAT30796.1\|2401377_2402508_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
QAT30797.1\|2402491_2402977_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage