CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035233	Bacillus glycinifermentans strain SRCM103574 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0
CP035232	Bacillus glycinifermentans strain SRCM103574 chromosome, complete genome	1 crisprs	csa3,WYL,DinG,DEDDh,cas3	0	1	19	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035232_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035232_1

3539248-3539355

Orphan

Consensus_repeat	Method
GCGGGTGATGGGAATCGAACCCACGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035232_1

>merge|CP035232|1|3539248-3539355|CRISPRCasFinder
GCGGGTGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCATCTCGCATGGGGCGGTTGATGGGAATCGAACCCACGA

>CP035232|1|1|3539248-3539355|CRISPRCasFinder
GCGGGTGATGGGAATCGAACCCACGA	CATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCATCTCGCATGGG
GCGGTTGATGGGAATCGAACCCACGA

Protein	Signature genes	Signature genes Name	Protein_function
CP035232.1\|QAT66634.1\|3529173_3530283_-\|o-succinylbenzoate-synthase	unknown	unknown	gnl\|CDD\|239433
CP035232.1\|QAT66645.1\|3551518_3552514_-\|processed-acidic-surface-protein	unknown	unknown	gnl\|CDD\|275176
CP035232.1\|QAT66640.1\|3536877_3537813_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	unknown	unknown	gnl\|CDD\|235695
CP035232.1\|QAT66641.1\|3537911_3538670_+\|yteA-family-sporulation-protein	unknown	unknown	gnl\|CDD\|274340
CP035232.1\|QAT66643.1\|3548810_3549914_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380483
CP035232.1\|QAT66647.1\|3553094_3554207_+\|aspartate-phosphatase	unknown	unknown	gnl\|CDD\|376220
CP035232.1\|QAT66642.1\|3541081_3541384_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|275393
CP035232.1\|QAT66637.1\|3532640_3533462_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	unknown	unknown	gnl\|CDD\|274729
CP035232.1\|QAT66635.1\|3530295_3531732_-\|o-succinylbenzoate--CoA-ligase	unknown	unknown	gnl\|CDD\|235146
CP035232.1\|QAT66632.1\|3526990_3527488_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
CP035232.1\|QAT66639.1\|3535185_3536610_-\|isochorismate-synthase	unknown	unknown	gnl\|CDD\|224091
CP035232.1\|QAT66633.1\|3527504_3528818_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274819
CP035232.1\|QAT67941.1\|3550879_3551452_-\|class-D-sortase	unknown	unknown	gnl\|CDD\|320677
CP035232.1\|QAT66636.1\|3531809_3532628_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	unknown	unknown	gnl\|CDD\|180958
CP035232.1\|QAT66648.1\|3554444_3555092_+\|pyroglutamyl-peptidase-I	unknown	unknown	gnl\|CDD\|237299
CP035232.1\|QAT66638.1\|3533449_3535189_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	unknown	unknown	gnl\|CDD\|236020
CP035232.1\|QAT66644.1\|3550279_3550864_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|370542
CP035232.1\|QAT66646.1\|3552672_3552861_+\|hypothetical-protein	unknown	unknown	unknown
CP035232.1\|QAT66649.1\|3555757_3556339_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP035232.1\|QAT67942.1\|3555221_3555704_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981

Protein	Function_ID	Function_description	E-value
CP035232.1\|QAT66634.1\|3529173_3530283_-\|o-succinylbenzoate-synthase	gnl\|CDD\|239433	cd03317, NAAAR, N-acylamino acid racemase (NAAAR), an octameric enzyme that catalyzes the racemization of N-acylamino acids. NAAARs act on a broad range of N-acylamino acids rather than amino acids. Enantiopure amino acids are of industrial interest as chiral building blocks for antibiotics, herbicides, and drugs. NAAAR is a member of the enolase superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion.	0
CP035232.1\|QAT66645.1\|3551518_3552514_-\|processed-acidic-surface-protein	gnl\|CDD\|275176	TIGR04383, hypothetical_protein_HMPREF1015_01194, processed acidic surface protein. Members of this family are acidic surface proteins with an N-terminal signal peptide and a variant C-terminal sortase recognition sequence, LPXTA rather than LPXTG. The N-terminal region past the signal peptide is repeated a second or third time in many members of this family. Members occur in Firmicutes, encoded next to a dedicated sortase related to SrtC that assembles pilins, suggesting that this protein serves a structural rather than enzymatic role. Processing by the neighboring sortase may result in polymerization as well as surface attachment. [Cell envelope, Surface structures].	1.48972e-111
CP035232.1\|QAT66640.1\|3536877_3537813_+\|1,4-dihydroxy-2-naphthoate-polyprenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	2.26582e-131
CP035232.1\|QAT66641.1\|3537911_3538670_+\|yteA-family-sporulation-protein	gnl\|CDD\|274340	TIGR02890, conserved_hypothetical_protein, regulatory protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to Pfam family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. Smaller proteins from the proteobacteria with just the N-terminal domain, including DksA and DksA2 are RNA polymerase-binding regulatory proteins even if the Zn-binding site is not conserved. [Unknown function, General].	5.35886e-64
CP035232.1\|QAT66643.1\|3548810_3549914_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|380483	cd01541, PBP1_AraR, ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators. Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of AraR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type 1 periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type 1 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	5.98977e-132
CP035232.1\|QAT66647.1\|3553094_3554207_+\|aspartate-phosphatase	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	5.66547e-22
CP035232.1\|QAT66642.1\|3541081_3541384_-\|hypothetical-protein	gnl\|CDD\|275393	cd10570, PH-GRAM, Pleckstrin Homology-Glucosyltransferases, Rab-like GTPase activators and Myotubularins (PH-GRAM) domain. Myotubularin-related proteins are a subfamily of protein tyrosine phosphatases (PTPs) that dephosphorylate D3-phosphorylated inositol lipids. Mutations in this family cause the human neuromuscular disorders myotubular myopathy and type 4B Charcot-Marie-Tooth syndrome. 6 of the 13 MTMRs (MTMRs 5, 9-13) contain naturally occurring substitutions of residues required for catalysis by PTP family enzymes. Although these proteins are predicted to be enzymatically inactive, they are thought to function as antagonists of endogenous phosphatase activity or interaction modules. Most MTMRs contain a N-terminal PH-GRAM domain, a Rac-induced recruitment domain (RID) domain, a PTP domain (which may be active or inactive), a SET-interaction domain, and a C-terminal coiled-coil region. In addition some members contain DENN domain N-terminal to the PH-GRAM domain and FYVE, PDZ, and PH domains C-terminal to the coiled-coil region. The GRAM domain, found in myotubularins, glucosyltransferases, and other putative membrane-associated proteins, is part of a larger motif with a pleckstrin homology (PH) domain fold.	4.74703e-05
CP035232.1\|QAT66637.1\|3532640_3533462_-\|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase	gnl\|CDD\|274729	TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. This protein catalyzes the formation of SHCHC, or (1 R,6 R)-2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate, by elmination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate (SEPHCHC). Note that SHCHC synthase activity previously was attributed to MenD, which in fact is SEPHCHC synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].	3.09878e-124
CP035232.1\|QAT66635.1\|3530295_3531732_-\|o-succinylbenzoate--CoA-ligase	gnl\|CDD\|235146	PRK03640, PRK03640, o-succinylbenzoate--CoA ligase.	0
CP035232.1\|QAT66632.1\|3526990_3527488_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	4.20239e-10
CP035232.1\|QAT66639.1\|3535185_3536610_-\|isochorismate-synthase	gnl\|CDD\|224091	COG1169, MenF, Isochorismate synthase [Coenzyme metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	3.21918e-141
CP035232.1\|QAT66633.1\|3527504_3528818_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	0
CP035232.1\|QAT67941.1\|3550879_3551452_-\|class-D-sortase	gnl\|CDD\|320677	cd05828, Sortase_D_1, Sortase domain found in subfamily 1 of the class D family of sortases. Class D sortases are cysteine transpeptidases distributed in Gram-positive bacteria (mainly present in Firmicutes). The prototypical subfamily 1 of class D sortase from Bacillus anthracis (named Ba-SrtC) covalently attaches proteins bearing a noncanonical LPNTA sorting signal, such as the BasH and BasI proteins, to the peptidoglycan of the cell wall that facilitate sporulation. BasH is exclusively anchored to the forespore cell wall envelope, while BasI is attached to the diaminopimelic acid moiety of the peptidoglycan of predivisional cells. Ba-SrtC lacks the N-terminal signal peptide and membrane anchor. The family also includes many class D sortase homologs from Gram-negative bacteria, but the functions of these enzymes are unknown.	6.94793e-61
CP035232.1\|QAT66636.1\|3531809_3532628_-\|1,4-dihydroxy-2-naphthoyl-CoA-synthase	gnl\|CDD\|180958	PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated.	0
CP035232.1\|QAT66648.1\|3554444_3555092_+\|pyroglutamyl-peptidase-I	gnl\|CDD\|237299	PRK13197, PRK13197, pyrrolidone-carboxylate peptidase; Provisional.	4.99104e-129
CP035232.1\|QAT66638.1\|3533449_3535189_-\|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase	gnl\|CDD\|236020	PRK07449, PRK07449, 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated.	0
CP035232.1\|QAT66644.1\|3550279_3550864_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|370542	pfam09515, Thia_YuaJ, Thiamine transporter protein (Thia_YuaJ). Members of this protein family have been assigned as thiamine transporters by a phylogenetic analysis of families of genes regulated by the THI element, a broadly conserved RNA secondary structure element through which thiamine pyrophosphate (TPP) levels can regulate transcription of many genes related to thiamine transport, salvage, and de novo biosynthesis. Species with this protein always lack the ThiBPQ ABC transporter. In some species (e.g. Streptococcus mutans and Streptococcus pyogenes), yuaJ is the only THI-regulated gene. Evidence from Bacillus cereus indicates thiamine uptake is coupled to proton translocation.	3.59491e-65
CP035232.1\|QAT66649.1\|3555757_3556339_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	4.01252e-09
CP035232.1\|QAT67942.1\|3555221_3555704_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	8.82032e-14

>CP035232.1|QAT66641.1|3537911_3538670_+|yteA-family-sporulation-protein
MHVLTKEQLTKLENELKAGKEQIISRFKANGHFGIDVTFPFNSTGDLSSYDNHPGDEGTELYEREKDLALYEHEREHLHDIEHALSLIEKGTYGRCEVCGKEIPYERLSVLPTATTCSEHSSNISVSKDRPIEEEVLTPPYGRFEQDERDENVAYDAEDAYQDVERYGDSDTPQDMEFPPQSYSQTYMEYEERLGNVEDYENFVATDITGKEITVYPTIEHEQYEELLDEEGIMTSFGDLPPAEKEPYTEDD
>CP035232.1|QAT66640.1|3536877_3537813_+|1,4-dihydroxy-2-naphthoate-polyprenyltransferase
MQHQSLSGSVSGIKPEKSWRVWWMLTRPHTLTAAFVPVTLGTVLALQTGRIDIWLFIAMLVASILIQIGTNLFNEYFDFVRGLDNENSVGIGGAIVRHGMKPKTVLYTAYGLFAVSVLLGVYICMSSSWWLALIGLVCMAVGYLYTGGPLPISYTPFGEIMSGVFMGMIIILISYYIQTGELTWNVFLISLPITILVGGINLSNNIRDLAGDKENGRKTLPILAGRKNAVHILSWAFIISYLLIGLYIVMGIVTVWSAIVLLSLPKPVKAIKEFKAKEKPAELMIAMKSTAQTNTFFGLLLAIGVLIHHFV
>CP035232.1|QAT66639.1|3535185_3536610_-|isochorismate-synthase
MVTTVQRTSLREASEALNIVKKVNHAVLISYSRKIKNIDALSFFKSGEEAFAGKRFFWSDPDGEMTLVGLGRELTISTSGKDAGRYREIDQQWARVKEKAYHFHEGEDLHQAAVGPLLFGGFSFDPLETREQHWEGYPEGAFFVPSAMLTKAGEEAFLTVNKWKSPDEDASKVLAELKAASLHLTNISAFKEDEKAGARIEAKEELHVSEWLDAIRRATNDIKKGAYDKVVLARDILLTFDKPVKLHEVLFKLMSEQKTSYIFAVEENGKSFVGASPERLIKKDGMKVLSTCLAGSIKRGETEQEDRMLGLELLNDEKNLIEHDIVVGMIHQAFLANCSRVKKPAKPGLYKTKNVQHLYTPVVGQMNDQASLFDLIEQLHPTPALGGSPQHKAVEVIRNSEPMSRGWYAAPVGWIDIAGNGEFAVAIRSGLIESNEARLFAGCGIVADSDPLLEYEETQIKFKPMLSAFGGDTL
>CP035232.1|QAT66638.1|3533449_3535189_-|2-succinyl-5-enolpyruvyl-6-hydroxy-3--cyclohexene-1-carboxylic-acid-synthase
MTENPITTYIGNFIDELSLAGVTEAVICPGSRSTPLAILAAAHPDINVHVHIDERSAGYFALGIAKAKRGPVALICTSGTAAANFYPAVVEAHYSRIPLIVLTADRPHELREVGAPQAIDQQFLFGNFVKYFTDSALPDAHPDMLAYIRSVASRAAGEASRAPNGPVHINFPLREPLMPNLNADPFQRTERGRHVSVSNAAAAADQKELEAVMALISDTEEGIIVCGELPNDDVKRDILSLAEMTGYPILADPLSNLRNGAHSKKSVIAAYDSLLRDEELKASLMPKLVIRFGPMPVSKPLFQLLKQNPGIWQIVVDPDGGWRDPTQRSSWMMHCSEREFAKAAAASIREKRAGRWLEKWQFADSRFRRHLKNLEAEDLTFEGNVYRNLQHIIPENSSLFVGNSMPIRDADTFFENQDRPFRIFANRGANGIDGVVSTALGVYAATKEPVTLVIGDLSFYHDLNGLLVTKTLDIPLTVVLVNNDGGGIFSFLPQSAEERYFEQLFGTPTGLEFEHAAKLYGGRYACPESSAEFADAYLSSVNRCGLDIIEVKTRRETRVELHRRLLDTVLYEIRKEWPF
>CP035232.1|QAT66637.1|3532640_3533462_-|2-succinyl-6-hydroxy-2,-4-cyclohexadiene-1-carboxylate-synthase
MAVLRLTLRDGIGYEIEDNGASAEKTAVFLHGFTGSAKTWDETDEHFRGIRLIKLNLLGHGKTDSPADNQRYTTEQQAADLLEIFDLLKLKKVDLVGYSMGGRLALSFAMTHPERVSGLVLESSSPGLQTEEERRSRRDQDARLGERIINEGIESFVDYWEQIPLFASQLSLEASKRKKIREERLSNNPTGLAGSLTGMGTGSQPSWWDKLGDITFPVLLIAGSLDKKFVAINQNMHRKIPGSRLVIAEQTGHAVHVEEPDFFGKIVSEFIFK
>CP035232.1|QAT66636.1|3531809_3532628_-|1,4-dihydroxy-2-naphthoyl-CoA-synthase
MTVEWKSERQYEDILYETYNGIAKITINRPEVHNAFRPKTVTELIDAFAYARDDADIGVIILAGAGDKAFCSGGDQKVRGHGGYVGEDQIPRLNVLDLQRLIRVIPKPVVAMVSGYAIGGGHVLHIVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAEEALEMGLVNTVVPLEKLEEETIKWCEEMLEKSPTALRFLKAAFNADTDGLAGIQQFAGDATLLYYTTDEAKEGRDAFKEKRRPDFGQFPRFP
>CP035232.1|QAT66635.1|3530295_3531732_-|o-succinylbenzoate--CoA-ligase
MLMDQPNWLKQRAELTPDRLALIQGNQQLTFLELYEEAKKMAAQLKNCSIGKGDTAAVLLTNRTEMVIAVHACFLLGVRLVLLNTKLSKAERMYQIEHSEAKLLITEQPFAEEHSQDLSIRTVQIEDIQAIKAEPLIKEADIHLDDTATIMYTSGTTGRPKGVMQTFANHYFSAVSSALNLGLAENERWLIALPLFHISGLSALFKSVIYGMAVVLHQKFDADDVLRSINDHQVTVISVVQTMLSRLAARVDNCPESLRCLLLGGGPAPYSLLEECKRKRLPVVQSYGMTETCSQVATLAPEYSMTKLGSAGKPLFASGIRIEKNGAPAETGEHGEICVKGPTVMKGYLKNEAANEESFNDGWFRTGDIGYLDDDGFLYVLDRRSDLIISGGENIYPAEVEAVLLSHPAVDEAGVRGADDETWGKVPHAYLVVNEHVEEQELIRFCKERLASYKVPKAFHVVRQLPRNASNKLMRHKL
>CP035232.1|QAT66634.1|3529173_3530283_-|o-succinylbenzoate-synthase
MIQIKQLTLYHLSMRLKKPFTSSLETFQERKFIIIEAKDKDGVTGWGEVSAFSSPWYTEETTETCYHMLKDFFIPAVLHESFTHPSDIPEKLRGFKGNRMAKAGLEAAFWDIHAQKNGITLSEALGGIKTEVPAGVVVGLAPLEDMLREIDQYVKEGYQRIKLKIQPGQDIELLKEIRRHFPRVPLMADANSSYDIKDISRIKSLDEFKLMMIEQPLADDDIVDHRHLQKHIKTSICLDESIRSADDARKAIELGSCKIINIKPSRVGGLTEALKIHDLCKQHNMPVWCGGMFETGISRAHNIALSSLPQFVIPGDISSSSRYWEEDIVKPEIRIEDGFIQVPDRPGMGFEVDANTLRKHSFKMDVFRP
>CP035232.1|QAT66633.1|3527504_3528818_-|LLM-class-flavin-dependent-oxidoreductase
MKQIKLGVFLAGTGHHVASWRHPSAPEDASMNLDYFKELAKTAERGKLDMLFLADSLSIDSKSHPNVLTRFEPFTLLSALAQVTSKIGLAATASTTYSEPFHIARQFASLDHISGGRAGWNVVTSSIESTALNFSGEKHLEHHLRYQRAEEFVEVVKGLWDSWEEDAFIRNKETGEFFDKEKMHELNHKGTYFSVRGPLNVARTPQGQPVIIQAGSSGDGQALAAKTAEVIFTAQNHLESAQAFYQSIKEQAAELGRDPEKIAIMPGIFPVIADTEEEAQAKYQELQDLIIPSVGLQILQNYLGGIDLSAYPLDGPLPQLDADASNAVKSRFKLVQEMAERDNMTIRQLYQYVAGSRGHHIFVGTPGQLADKMQEWVDKKACDGFNIMPPLLPEGLELFVDKVVPILQERGLFRKEYEGATLRDHFGLDKPANRYSK
>CP035232.1|QAT66632.1|3526990_3527488_-|GNAT-family-N-acetyltransferase
MTRRYRMADESDAKELLALTERAYEPIRKLGIHFAAAHADLDLVLNNIRKNACYVMEEDGRIIATISIRMPWGQQPGPYGVPHIWWFAVDPASGKKGVGSELLEWLEQTILRDTLKVPFVSLGTADKHPWLIDMYERKGYVRSGEQDLGKGHITVYMKKQLRTDL
>CP035232.1|QAT66642.1|3541081_3541384_-|hypothetical-protein
MQSVEHEGFIMDVPANLFRGIESVGGRLKLTSESLFFTSHGVNIQNKPLDIKIQDIAKVEKRNTFLVVPNGLKVVLKNQQEYKFVVAKRQEFFNHLENLL
>CP035232.1|QAT66643.1|3548810_3549914_-|GntR-family-transcriptional-regulator
MSEHTKYSMVKNQIKSWIYEGKVKPGEKIHSENELMKIFDVSRHTIRQAIGDLVHEGLLYREQGSGTYCSQRLRPSEKGRERHKMIGVITTYLSDYIFPHIIRGIESTLSNEGYTLIVASTNNDIEKEKQCLVNMLDKDIDGLIVEPTKTGSINPNLNYYLTLEQHHIPYLMINQFYQELNPPHFILDDEYGGFIATDHLIKLGHERVFGLFKQDDMQGVNRMKGFIRAFRENGLSFYPEMVVTYETENKEEKTITEVRKRLSSQEPPTAIFCYNDQIALLVLDVIREFGLKIPEDISIVGYDDSHLSQASEVKLTSVTHPKMQMGIEAAKWMIAKVEGRNMDQLEHSKVYKPELIVRQSTAKLKNG
>CP035232.1|QAT66644.1|3550279_3550864_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAVMTGIAIVLDIASGMFLKMPQGGSIAIMMIPLFLISFRWGLKAGLITGFLAGLLQFVTGGLYAVHPVQFLLDYFIAPTAAGIGGLFAGPIRKAAAAKAKGKLVSYVTVAVFFGSGLKFLAHVISGAVFFGNYAPKGTPVWIYTLTYNATYMLPSFIICAIVLCLLLLTAPRLLERSIDKR
>CP035232.1|QAT67941.1|3550879_3551452_-|class-D-sortase
MITAGLYVAATNAFKLFQGRTLSAQQPAEKKPAEKPSVQTGKKQKAETVRTFETGEKIGDLVIPKMKARLPIYHGTDEDELQKGVGHFAGSVLPGEDDNSVLSGHRDTVFRRLGEVGKGDRLIVEAEYGTFTYKVKKVRIVDADDRTVIVPKPRATLTVSTCYPFDFIGSAPERYVLVAELIKTQKKRNL
>CP035232.1|QAT66645.1|3551518_3552514_-|processed-acidic-surface-protein
MKKRMMAFLICALFLVPSAEAFAAPKQSELNEYLGEIGMTEKELEAYLQDTYDESLKGFESAEELRDFLGERLDEKRLASYLKDYGLNEKEAVKLLVDNGYMEEGQSILDAFMFEYELDDALWNVTTDEGDAAIENPFQELGVDDQEWERLIKHLRSVREKNPNLEDELMAIGERLEAVADFETVTELKAKDIAQMLSILHDLQQTLEVKTKYYLVKDGKKKEVSLTTPVSADELKGASLLVQVYDLEGNFILDVLLTPDMIGSDLFHETGAKVKQTQTAVQHDTKKQHVKKTVRGAKLPKTAGHYAEWSILGFVLILSGFFLIRRLRKAA
>CP035232.1|QAT66646.1|3552672_3552861_+|hypothetical-protein
MNPYYMMLFCYVLSIIHFLIGYREALKISGADGLVDGTVMISCIPLGVVFAFFSHFFWKMTI
>CP035232.1|QAT66647.1|3553094_3554207_+|aspartate-phosphatase
MGKAVASQEVANMLNDWYILMKKRDISRSIEMKDDIDKAIEEMEEDQDVLVYYQMLDFRLRLLLEDISQSATEKLEAIEFHDNDPKSTDDKLNYYFYLFKGIYEDYKQNHTEALNFFRIAEKRLGAIQNEIEKAEFHYKIGVLYYNLKATWLSIHHINIAAGIFQGYEGYTKRVINCKMLIGLNYIDQFKFSESEALLNEAIDRTEKIGDQFLLPYTYYNMGFLKSKEEKHEEALKYYNKAFAIKDFESKAQYAYLLCVYETVRSLLKTNSQDKAFQWIDVGFKKSREMNSKIFELKFKILHTLYTSPPNKMEMIKDFVHQLETEKAWVDLEELLMDVANYYREKKLYEEAIYFYIKTDKASKLAGRGGE
>CP035232.1|QAT66648.1|3554444_3555092_+|pyroglutamyl-peptidase-I
MKKKVLLTGFDPFGGESVNPAWEAVKRLHGETAGDISIAAEKIPTVFGKSAVVLEKAIEKHQPDIIICTGQAGGRPHITPERVAINIDDARIADNEGMMPIDENIAQDGPAAYWSTLPIKRIVQNLRHNGIPASVSNSAGTFVCNHLFYRLMHHLALSSSGARGGFIHIPYLPEQTIDKKEPSLSLDVIVEALRIAALTAANHETDIREQGGSLD
>CP035232.1|QAT67942.1|3555221_3555704_+|DinB-family-protein
MSIFNEARKETWSEIRELSDDDINKRPEKDEWSIQEVLDHLKKLDLQAARLFRERIRSAPFRTIEAKPVHVSEDRSVKRKAPDSLEPERKTTDLLAIKAELDHARSQLTTVIATLQEEDFERVLPHSVFKELTVRQWIDFIGHHEKRHVKQIQEIKKKLS
>CP035232.1|QAT66649.1|3555757_3556339_-|MOSC-domain-containing-protein
MWERRKATAENVYIADTPSFVTEKKEEISIDYGGIPGDLHFGLTKTAGAREPMYKKGTEIFNRRQISIVSVEECLAIAERLNIPAVLPEWLGANIALSGLPQLTHVREGSRLIFPSGAALLCEGENEPCIQPGEVIQKQFPDKPKLASRFVRHAMGRRGIVCVVERPGVIAQGDQVDVWSYSPNAVKDARSFA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP015439	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_1, complete sequence	255884-255939	6	0.893
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10424-10479	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70771-70826	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	835-890	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75822-75877	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1967-2022	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64780-64835	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1325-1380	7	0.875
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483788-483843	8	0.857
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NC_004604	Bacillus megaterium QM B1551 plasmid pBM400, complete sequence	46417-46472	9	0.839
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	CP031730	Stenotrophomonas rhizophila strain GA1 plasmid unnamed1, complete sequence	5220-5275	11	0.804
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP041068	Bacillus megaterium strain KNU-01 plasmid pKNU_01_4, complete sequence	36188-36243	11	0.804
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NZ_CP032535	Bacillus megaterium NCT-2 plasmid pNCT2_7, complete sequence	36096-36151	11	0.804
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	CP041516	Bacillus aryabhattai strain KNU10 plasmid unnamed, complete sequence	17877-17932	11	0.804
CP035232_1	1.1\|3539274\|56\|CP035232\|CRISPRCasFinder	3539274-3539329	56	NC_048753	Lactobacillus phage 3-521, complete genome	13552-13607	11	0.804

1. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP015439 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_1, complete sequence) position: , mismatch: 6, identity: 0.893

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatattatatacg	Protospacer
********************************************** *...**. *

2. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagt	Protospacer
********************************************** *. .* .*

3. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagt	Protospacer
********************************************** *. .* .*

4. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagt	Protospacer
********************************************** *. .* .*

5. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagt	Protospacer
********************************************** *. .* .*

6. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcattttagttatg	Protospacer
**********************************************.*..  *. *

7. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcat-ctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcataataatatat-	Protospacer
**********************************************  * ..**.

8. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.875

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatattttaaagt	Protospacer
********************************************** *. .* .*

9. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.857

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagt	Protospacer
**********************************************  .  * .*

10. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NC_004604 (Bacillus megaterium QM B1551 plasmid pBM400, complete sequence) position: , mismatch: 9, identity: 0.839

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccattaaactacacccgcatgttttcttaa	Protospacer
*****************************.**************** *. . * ..

11. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to CP031730 (Stenotrophomonas rhizophila strain GA1 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.804

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccattaaactacacccgctttatttttaaa	Protospacer
*****************************.************** *. . . *...

12. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP041068 (Bacillus megaterium strain KNU-01 plasmid pKNU_01_4, complete sequence) position: , mismatch: 11, identity: 0.804

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccattaaactacacccgcttatttttaaaa	Protospacer
*****************************.************** * *. .  ...

13. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NZ_CP032535 (Bacillus megaterium NCT-2 plasmid pNCT2_7, complete sequence) position: , mismatch: 11, identity: 0.804

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccattaaactacacccgcttatttttaaaa	Protospacer
*****************************.************** * *. .  ...

14. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to CP041516 (Bacillus aryabhattai strain KNU10 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.804

catcagcttggaaggctgaggttttaccactaaactacacccgcatctcgcatggg	CRISPR spacer
catcagcttggaaggctgaggttttaccattaaactacacccgcttatttttaaaa	Protospacer
*****************************.************** * *. .  ...

15. spacer 1.1|3539274|56|CP035232|CRISPRCasFinder matches to NC_048753 (Lactobacillus phage 3-521, complete genome) position: , mismatch: 11, identity: 0.804

catcagcttggaaggctgaggttttaccactaaactacacccgcat------ctcgcatg	CRISPR spacer
ctacagcttggaaggctgtggttttaccactaaactatacccgcgtgaactactcg----	Protospacer
*  *************** ******************.******.*      ****

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

354020 : 360425

Caulobacter_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT63829.1\|354020_354623_+	TerD family protein	K4JRX3	Caulobacter_phage	3.7e-24	30.9
QAT63830.1\|354652_355234_+	TerD family protein	K4JRX3	Caulobacter_phage	4.8e-29	39.9
QAT63831.1\|355299_355878_+	TerD family protein	K4JRX3	Caulobacter_phage	8.1e-29	37.2
QAT63832.1\|355946_356720_+	DUF475 domain-containing protein	S5MAL1	Bacillus_phage	3.3e-78	63.5
QAT63833.1\|356823_358011_+	citrate lyase subunit beta	NA	NA	NA	NA
QAT67731.1\|358000_359323_+	hypothetical protein	A0A172Q0Y1	Acinetobacter_phage	3.9e-10	28.1
QAT63834.1\|359315_360425_+	hypothetical protein	A0A172Q0S8	Acinetobacter_phage	6.1e-41	34.5

DBSCAN-SWA_2

655596 : 749802

100

Bacillus_phage(53.19%)

protease,holin,integrase,transposase,head,portal,tail,capsid,plate,terminase,tRNA

attL 655589:655622|attR 749777:749810

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
655589:655622	attL	NA	NA	NA	NA
QAT67758.1\|655596_656955_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	4.2e-84	40.3
QAT64042.1\|657079_658039_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
QAT64043.1\|658041_658722_-	response regulator	NA	NA	NA	NA
QAT64044.1\|658718_660329_-	sensor histidine kinase	NA	NA	NA	NA
QAT64045.1\|660930_662352_+	sugar porter family MFS transporter	NA	NA	NA	NA
QAT64046.1\|662496_663912_+	sugar porter family MFS transporter	NA	NA	NA	NA
QAT64047.1\|669970_670954_+	thiamine-phosphate kinase	NA	NA	NA	NA
QAT64048.1\|670961_671438_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
QAT64049.1\|671418_672111_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
QAT67759.1\|672122_672581_+	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
QAT64050.1\|672570_673596_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	3.3e-65	42.6
QAT64051.1\|673830_675759_-	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.4e-61	31.5
QAT67760.1\|675911_676424_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
QAT64052.1\|676420_677068_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
QAT64053.1\|677089_677266_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
QAT64054.1\|677272_678037_+	twin-arginine translocase subunit TatC	NA	NA	NA	NA
QAT67761.1\|678073_678253_-	DUF4305 domain-containing protein	NA	NA	NA	NA
QAT64055.1\|678252_678987_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
QAT64056.1\|679211_679496_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	2.9e-19	52.7
QAT64057.1\|679541_681173_+	chaperonin GroEL	A0A240F779	uncultured_virus	1.3e-159	55.2
QAT64058.1\|681254_682472_-\|integrase	site-specific integrase	A0A0C5AN64	Paenibacillus_phage	3.4e-141	64.1
QAT64059.1\|682485_683118_-	XRE family transcriptional regulator	A0A1B2APZ3	Phage_Wrath	2.1e-70	61.0
QAT64060.1\|683282_683531_+	XRE family transcriptional regulator	A0A1B2APZ4	Phage_Wrath	5.0e-20	67.1
QAT64061.1\|683553_683754_+	DNA-binding protein	NA	NA	NA	NA
QAT67762.1\|683765_684512_+	phage antirepressor Ant	A0A0C5AFE7	Paenibacillus_phage	1.3e-100	74.6
QAT64062.1\|684525_684756_+	hypothetical protein	NA	NA	NA	NA
QAT64063.1\|685257_685638_-	DUF2513 domain-containing protein	A0A2I7SCV0	Paenibacillus_phage	2.0e-20	41.6
QAT64064.1\|685697_685964_+	hypothetical protein	Q9ZXC9	Bacillus_phage	7.8e-19	53.5
QAT64065.1\|686051_686294_+	hypothetical protein	NA	NA	NA	NA
QAT64066.1\|686386_686944_+	hypothetical protein	Q9ZXC8	Bacillus_phage	7.0e-70	71.9
QAT64067.1\|686947_687880_+	hypothetical protein	Q9ZXC7	Bacillus_phage	3.6e-151	88.1
QAT64068.1\|687879_688317_+	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	8.2e-74	91.0
QAT64069.1\|688377_690810_+	DNA primase	D6R422	Bacillus_phage	0.0e+00	81.4
QAT64070.1\|691070_691433_+	hypothetical protein	NA	NA	NA	NA
QAT64071.1\|691410_691848_+	hypothetical protein	Q9ZXC3	Bacillus_phage	9.4e-62	75.9
QAT64072.1\|691844_692384_+	nuclease	Q9ZXC2	Bacillus_phage	1.3e-89	90.5
QAT64073.1\|692380_692551_+	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	3.0e-08	56.6
QAT64074.1\|692554_693070_+	hypothetical protein	D6R425	Bacillus_phage	3.3e-82	83.0
QAT64075.1\|693085_693484_+	hypothetical protein	NA	NA	NA	NA
QAT64076.1\|693596_693977_+	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	3.0e-48	84.6
QAT64077.1\|694629_694869_+	hypothetical protein	NA	NA	NA	NA
QAT64078.1\|694855_695113_+	DUF2829 domain-containing protein	F8WPN8	Bacillus_phage	9.8e-27	62.7
QAT64079.1\|695109_695418_+	hypothetical protein	NA	NA	NA	NA
QAT64080.1\|695645_696206_+	hypothetical protein	NA	NA	NA	NA
QAT64081.1\|696192_696507_+	hypothetical protein	NA	NA	NA	NA
QAT64082.1\|696533_696908_+	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	2.4e-29	51.7
QAT64083.1\|697136_697652_+\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	1.7e-33	45.8
QAT64084.1\|697648_699358_+\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	2.5e-206	62.4
QAT64085.1\|699369_699561_+	DUF1056 family protein	NA	NA	NA	NA
QAT64086.1\|699561_700872_+\|portal	phage portal protein	D6R3Y6	Bacillus_phage	1.1e-105	46.9
QAT64087.1\|700816_701548_+\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	8.9e-57	56.4
QAT64088.1\|701587_702871_+\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	7.7e-80	44.8
QAT64089.1\|702894_703323_+	collagen-like protein	D6R3Z0	Bacillus_phage	6.5e-15	59.0
QAT64090.1\|703343_703646_+\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	9.5e-13	46.3
QAT64091.1\|703635_703944_+\|head,tail	head-tail adaptor protein	A0A2H4JCB1	uncultured_Caudovirales_phage	8.2e-12	37.6
QAT64092.1\|703943_704342_+	hypothetical protein	NA	NA	NA	NA
QAT64093.1\|704338_704722_+	hypothetical protein	NA	NA	NA	NA
QAT64094.1\|704736_705354_+\|tail	phage tail protein	NA	NA	NA	NA
QAT64095.1\|705410_705776_+	hypothetical protein	NA	NA	NA	NA
QAT64096.1\|705984_710454_+\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.2e-71	42.6
QAT64097.1\|710453_711290_+\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	7.5e-108	68.2
QAT64098.1\|711302_713015_+	alkaline phosphatase	D6R400	Bacillus_phage	5.8e-224	69.9
QAT64099.1\|713049_715614_+	peptidase G2	D6R401	Bacillus_phage	1.7e-307	60.7
QAT64100.1\|715626_716967_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	3.1e-63	50.6
QAT64101.1\|716981_717284_+	hypothetical protein	O64053	Bacillus_phage	2.0e-07	34.8
QAT64102.1\|717280_717457_+	XkdX family protein	A0EWM9	Staphylococcus_virus	8.5e-06	45.8
QAT64103.1\|717491_717902_+\|holin	holin	A0A0N7GFE6	Paenibacillus_phage	3.9e-25	50.0
QAT64104.1\|717953_718796_+	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	8.7e-48	56.7
QAT64105.1\|718830_719247_-	hypothetical protein	A0A2H4J4V0	uncultured_Caudovirales_phage	3.5e-42	58.0
QAT64106.1\|719258_720908_-	hypothetical protein	A0A1P8CWI7	Bacillus_phage	2.6e-56	49.2
QAT64107.1\|721160_722282_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	2.4e-53	35.1
QAT67763.1\|722504_722825_-	YolD-like family protein	O64030	Bacillus_phage	6.5e-12	36.9
QAT64108.1\|722963_723776_-	hypothetical protein	NA	NA	NA	NA
QAT64109.1\|723846_724065_-	hypothetical protein	NA	NA	NA	NA
QAT64110.1\|724672_725062_-	hypothetical protein	NA	NA	NA	NA
QAT64111.1\|725079_726678_-\|transposase	transposase	NA	NA	NA	NA
QAT64112.1\|727281_727488_+	DUF1657 domain-containing protein	NA	NA	NA	NA
QAT64113.1\|727534_728008_+	hypothetical protein	NA	NA	NA	NA
QAT64114.1\|728025_728505_+	stage V sporulation protein AC	NA	NA	NA	NA
QAT64115.1\|728504_729518_+	stage V sporulation protein AD	NA	NA	NA	NA
QAT64116.1\|729518_729869_+	stage V sporulation protein AE	NA	NA	NA	NA
QAT64117.1\|729884_730091_+	DUF1657 domain-containing protein	NA	NA	NA	NA
QAT67764.1\|730167_730986_+	DUF421 domain-containing protein	NA	NA	NA	NA
QAT64118.1\|731007_731691_-	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	5.1e-54	68.8
QAT64119.1\|731744_732116_-	VOC family protein	NA	NA	NA	NA
QAT64120.1\|732183_733569_-	amino acid permease	NA	NA	NA	NA
QAT64121.1\|734032_734902_-	peptidase	NA	NA	NA	NA
QAT64122.1\|735186_735648_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAT64123.1\|735757_736210_+	hypothetical protein	NA	NA	NA	NA
QAT67765.1\|736316_736934_-	hypothetical protein	NA	NA	NA	NA
QAT64124.1\|737399_738011_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
QAT64125.1\|738025_740650_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	3.8e-41	35.2
QAT64126.1\|741032_741392_-	DUF488 family protein	NA	NA	NA	NA
QAT64127.1\|741481_742246_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
QAT64128.1\|742378_743833_+	carboxylesterase/lipase family protein	A0A140E1D0	Samba_virus	2.8e-33	36.7
QAT64129.1\|743867_745136_-	MFS transporter	NA	NA	NA	NA
QAT64130.1\|745625_746675_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
QAT64131.1\|746705_747533_-	TrmB family transcriptional regulator	NA	NA	NA	NA
QAT64132.1\|747683_748316_+	hypothetical protein	NA	NA	NA	NA
QAT64133.1\|748443_749802_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	4.2e-84	40.3
749777:749810	attR	NA	NA	NA	NA

DBSCAN-SWA_3

792714 : 802639

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT64168.1\|792714_794010_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.5e-19	27.0
QAT64169.1\|794085_794802_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A1D8KNF0	Synechococcus_phage	9.7e-48	43.7
QAT64170.1\|794803_795058_+	phosphoribosylformylglycinamidine synthase, purS protein	M4QPE7	Synechococcus_phage	4.7e-05	33.3
QAT64171.1\|795054_795738_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAT64172.1\|795721_797950_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	9.7e-163	41.5
QAT64173.1\|797925_799356_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.7e-51	32.7
QAT64174.1\|799479_800520_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.7e-62	46.3
QAT64175.1\|800516_801104_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	8.3e-29	39.5
QAT64176.1\|801100_802639_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	9.6e-77	52.0

DBSCAN-SWA_4

1321252 : 1353654

Planktothrix_phage(40.0%)

coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT64610.1\|1321252_1322242_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAT64611.1\|1322973_1324602_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAT64612.1\|1324703_1325639_+	ABC transporter permease	NA	NA	NA	NA
QAT64613.1\|1325643_1326561_+	ABC transporter permease	NA	NA	NA	NA
QAT64614.1\|1326574_1327642_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.8
QAT64615.1\|1327643_1328567_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.6e-23	35.0
QAT64616.1\|1328757_1329336_+	N-acetyltransferase	NA	NA	NA	NA
QAT64617.1\|1329512_1329908_+	transcriptional regulator Spx	NA	NA	NA	NA
QAT64618.1\|1329956_1330619_-	TerC family protein	A0A0S4KZH7	Pseudomonas_phage	7.1e-29	39.9
QAT64619.1\|1330877_1331516_+	adaptor protein MecA	NA	NA	NA	NA
QAT64620.1\|1331637_1332786_+	competence protein CoiA	NA	NA	NA	NA
QAT64621.1\|1332782_1334816_+	oligoendopeptidase F	NA	NA	NA	NA
QAT64622.1\|1335444_1336338_-	DsbA family protein	NA	NA	NA	NA
QAT64623.1\|1336334_1336733_-	thiol management oxidoreductase	NA	NA	NA	NA
QAT64624.1\|1337017_1337683_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	2.2e-38	60.5
QAT64625.1\|1337695_1338268_-	CYTH domain-containing protein	NA	NA	NA	NA
QAT64626.1\|1338396_1338762_+	hypothetical protein	NA	NA	NA	NA
QAT64627.1\|1338792_1339428_+	GTP pyrophosphokinase family protein	NA	NA	NA	NA
QAT64628.1\|1339445_1340246_+	NAD kinase	NA	NA	NA	NA
QAT64629.1\|1340257_1341148_+	RluA family pseudouridine synthase	NA	NA	NA	NA
QAT64630.1\|1341163_1341904_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	A0A7D9	Microcystis_virus	2.5e-14	28.4
QAT64631.1\|1342203_1344048_+	sodium:proton antiporter	NA	NA	NA	NA
QAT64632.1\|1344303_1345005_+	thiaminase II	NA	NA	NA	NA
QAT64633.1\|1344979_1345597_+	thiazole tautomerase TenI	NA	NA	NA	NA
QAT64634.1\|1345580_1346693_+	glycine oxidase ThiO	NA	NA	NA	NA
QAT64635.1\|1346689_1346893_+	sulfur carrier protein ThiS	NA	NA	NA	NA
QAT64636.1\|1346896_1347664_+	thiazole synthase	NA	NA	NA	NA
QAT64637.1\|1347660_1348671_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
QAT64638.1\|1348697_1349510_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAT64639.1\|1349666_1350443_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QAT64640.1\|1350549_1351029_+\|coat	spore coat protein CotO	NA	NA	NA	NA
QAT64641.1\|1351061_1351514_-\|coat	spore coat protein	NA	NA	NA	NA
QAT64642.1\|1351675_1352158_-\|coat	spore coat protein	NA	NA	NA	NA
QAT64643.1\|1352289_1352796_-\|coat	spore coat protein	NA	NA	NA	NA
QAT64644.1\|1352863_1353220_-\|coat	spore coat protein	NA	NA	NA	NA
QAT64645.1\|1353267_1353654_-\|coat	spore coat protein	NA	NA	NA	NA

DBSCAN-SWA_5

1367268 : 1433250

Bacillus_phage(50.0%)

holin,integrase,portal,tail,capsid,plate

attL 1360376:1360390|attR 1410601:1410613

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1360376:1360390	attL	NA	NA	NA	NA
QAT67803.1\|1367268_1368315_+\|integrase	integrase	F1BUS9	Erwinia_phage	5.1e-13	31.2
1360376:1360390	attL	NA	NA	NA	NA
QAT64661.1\|1368638_1369508_+	hypothetical protein	A0A1P8CWU6	Bacillus_phage	8.5e-38	59.2
QAT64662.1\|1369521_1370013_+	hypothetical protein	NA	NA	NA	NA
QAT64663.1\|1370085_1370274_+	hypothetical protein	NA	NA	NA	NA
1370117:1370131	attR	NA	NA	NA	NA
QAT64664.1\|1370270_1370621_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
1370117:1370131	attR	NA	NA	NA	NA
QAT64665.1\|1370833_1371313_+	hypothetical protein	A0A109ZVT6	Bacillus_phage	5.5e-15	31.4
QAT67804.1\|1371484_1371814_+	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	2.5e-06	33.9
QAT64666.1\|1372013_1372220_+	hypothetical protein	NA	NA	NA	NA
QAT64667.1\|1372766_1373123_+	hypothetical protein	R4JGJ3	Bacillus_phage	5.0e-13	39.3
QAT64668.1\|1373122_1373530_+	hypothetical protein	NA	NA	NA	NA
QAT64669.1\|1373513_1373888_+	hypothetical protein	NA	NA	NA	NA
QAT67805.1\|1373904_1374927_+	hypothetical protein	R4JEY6	Bacillus_phage	3.5e-75	51.2
QAT64670.1\|1374923_1375127_+	hypothetical protein	A0A1P8CX62	Bacillus_phage	2.3e-15	64.7
QAT64671.1\|1375144_1375324_+	hypothetical protein	A0A1P8CX65	Bacillus_phage	4.0e-11	66.7
QAT64672.1\|1375316_1376144_+	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	3.1e-74	53.4
QAT64673.1\|1376140_1376629_+	hypothetical protein	NA	NA	NA	NA
QAT67806.1\|1376628_1377060_+	hypothetical protein	R4JMS5	Bacillus_phage	3.0e-36	57.4
QAT64674.1\|1377059_1377263_+	hypothetical protein	NA	NA	NA	NA
QAT64675.1\|1377259_1378624_+	DNA helicase	A0A2H4IZL9	uncultured_Caudovirales_phage	1.5e-121	51.2
QAT64676.1\|1378758_1379772_+	DNA primase	A0A2H4J6E6	uncultured_Caudovirales_phage	2.9e-74	46.3
QAT64677.1\|1379861_1380290_-	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	3.3e-43	62.3
QAT64678.1\|1380299_1380728_-	XRE family transcriptional regulator	Q5YAA4	Bacillus_phage	6.0e-37	56.7
QAT64679.1\|1381072_1381600_+	hypothetical protein	A0A0N9SGJ9	Paenibacillus_phage	2.3e-06	26.5
QAT64680.1\|1381893_1382418_+	hypothetical protein	NA	NA	NA	NA
QAT64681.1\|1382665_1383445_+	hypothetical protein	A0A2H4IZK6	uncultured_Caudovirales_phage	2.3e-58	50.8
QAT64682.1\|1383622_1384054_+	hypothetical protein	A0A2H4IZM8	uncultured_Caudovirales_phage	5.7e-11	39.3
QAT67807.1\|1384053_1385112_+	hypothetical protein	A0A142F1R1	Bacillus_phage	7.2e-15	28.4
QAT64683.1\|1385112_1385292_+	hypothetical protein	NA	NA	NA	NA
QAT64684.1\|1385486_1387745_+	DNA polymerase I	A0A2H4J6W7	uncultured_Caudovirales_phage	1.4e-172	48.6
QAT64685.1\|1387744_1388449_+	3'-5' exonuclease	U5PXE0	Bacillus_virus	5.1e-33	41.7
QAT64686.1\|1388449_1389499_+	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	1.4e-82	54.9
QAT64687.1\|1389498_1389708_+	hypothetical protein	NA	NA	NA	NA
QAT64688.1\|1389700_1390264_+	hypothetical protein	A0A0N9ST03	Paenibacillus_phage	2.9e-07	42.4
QAT64689.1\|1390260_1390566_+	ImmA/IrrE family metallo-endopeptidase	A0A1S5SA91	Streptococcus_phage	6.2e-12	32.6
QAT64690.1\|1390566_1390932_+	hypothetical protein	X2JKY6	Bacillus_phage	7.0e-10	37.4
QAT64691.1\|1390936_1391197_+	hypothetical protein	NA	NA	NA	NA
QAT64692.1\|1391193_1391394_+	hypothetical protein	NA	NA	NA	NA
QAT64693.1\|1391533_1391890_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.2e-30	57.6
QAT64694.1\|1391879_1393979_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	78.8
QAT64695.1\|1394010_1394343_+	DUF1140 family protein	NA	NA	NA	NA
QAT67808.1\|1395070_1395592_+	HNH endonuclease	A0A1P8CX39	Bacillus_phage	7.8e-71	74.6
QAT64696.1\|1396207_1396717_+	deoxyuridine 5'-triphosphate nucleotidohydrolase	D2XR49	Bacillus_phage	1.3e-41	55.0
QAT64697.1\|1396691_1397198_+	Fis family transcriptional regulator	A0A2H4J152	uncultured_Caudovirales_phage	3.7e-25	48.7
QAT67809.1\|1397213_1397975_+	FAD-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	1.3e-87	69.1
QAT67810.1\|1398119_1398665_+	hypothetical protein	A0A142F1S8	Bacillus_phage	3.2e-27	62.4
QAT64698.1\|1398661_1398847_+	hypothetical protein	NA	NA	NA	NA
QAT64699.1\|1398863_1399319_+	methyltransferase domain-containing protein	A8ATY8	Listeria_phage	1.9e-65	75.3
QAT64700.1\|1399335_1400340_+	hypothetical protein	A0A1P8CWY7	Bacillus_phage	7.0e-20	39.4
QAT64701.1\|1400336_1400900_+	dephospho-CoA kinase	A0A0N9SJZ0	Paenibacillus_phage	3.6e-37	47.8
QAT64702.1\|1400888_1401275_-	hypothetical protein	NA	NA	NA	NA
QAT64703.1\|1401393_1401783_+	DUF134 domain-containing protein	A0A0N9RZI0	Paenibacillus_phage	6.7e-19	44.3
QAT64704.1\|1401775_1402297_+	hypothetical protein	A0A2H4J2L4	uncultured_Caudovirales_phage	6.6e-30	49.3
QAT64705.1\|1402385_1403186_+	hypothetical protein	A0A0N9S810	Paenibacillus_phage	9.7e-73	55.0
QAT64706.1\|1403216_1403396_-	hypothetical protein	NA	NA	NA	NA
QAT64707.1\|1403420_1403990_-	hypothetical protein	NA	NA	NA	NA
QAT64708.1\|1404160_1404334_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	8.9e-24	87.5
QAT64709.1\|1404477_1404660_-	hypothetical protein	NA	NA	NA	NA
QAT64710.1\|1404909_1405242_-	hypothetical protein	NA	NA	NA	NA
QAT64711.1\|1405234_1405435_-	hypothetical protein	NA	NA	NA	NA
QAT64712.1\|1405911_1406130_+	XRE family transcriptional regulator	A0A1Z1DA26	Bacillus_phage	1.7e-08	43.8
QAT64713.1\|1406652_1407042_+	hypothetical protein	A0A0N7GFF5	Paenibacillus_phage	1.4e-19	42.1
QAT64714.1\|1408778_1409348_+	hypothetical protein	NA	NA	NA	NA
QAT67811.1\|1409693_1409975_+	hypothetical protein	NA	NA	NA	NA
QAT64715.1\|1409994_1410543_-\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	1.0e-28	44.4
QAT64716.1\|1411129_1412692_+	hypothetical protein	A0A0N9RZA7	Paenibacillus_phage	2.1e-151	53.9
QAT64717.1\|1412758_1414243_+\|portal	phage portal protein	D9ZNC8	Clostridium_phage	4.5e-15	22.4
QAT64718.1\|1414336_1415062_+	scaffolding protein	Q4ZC70	Staphylococcus_virus	3.2e-06	54.2
QAT64719.1\|1415121_1416246_+\|capsid	phage major capsid protein	NA	NA	NA	NA
QAT64720.1\|1416714_1416906_+	hypothetical protein	NA	NA	NA	NA
QAT64721.1\|1416920_1417259_+	hypothetical protein	NA	NA	NA	NA
QAT64722.1\|1417255_1418065_+	hypothetical protein	NA	NA	NA	NA
QAT64723.1\|1418080_1418470_+	hypothetical protein	NA	NA	NA	NA
QAT64724.1\|1418466_1418823_+	HK97 gp10 family phage protein	NA	NA	NA	NA
QAT64725.1\|1418819_1419260_+	hypothetical protein	NA	NA	NA	NA
QAT64726.1\|1419277_1419748_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
QAT64727.1\|1419701_1419998_+	fibronectin type III domain-containing protein	Q0PDK9	Bacillus_phage	1.1e-26	77.1
QAT64728.1\|1420054_1420420_+	hypothetical protein	NA	NA	NA	NA
QAT64729.1\|1420503_1420722_+	hypothetical protein	NA	NA	NA	NA
QAT64730.1\|1420737_1423875_+\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	3.0e-77	44.3
QAT64731.1\|1423871_1424690_+\|tail	phage tail family protein	A6M962	Geobacillus_virus	2.1e-75	53.3
QAT64732.1\|1424701_1426051_+	endopeptidase	A6M966	Geobacillus_virus	5.0e-53	36.0
QAT64733.1\|1426066_1428631_+	peptidase G2	D6R401	Bacillus_phage	0.0e+00	65.0
QAT64734.1\|1428643_1430011_+\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	6.4e-64	52.2
QAT64735.1\|1430025_1430310_+	hypothetical protein	M4ZR44	Bacillus_phage	4.3e-15	44.7
QAT64736.1\|1430311_1430533_+	XkdX family protein	M4ZS22	Bacillus_phage	5.0e-11	68.1
QAT64737.1\|1430536_1430800_+\|holin	holin	NA	NA	NA	NA
QAT64738.1\|1430865_1431807_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	1.9e-96	63.8
QAT64739.1\|1431827_1432058_+\|holin	phage holin	A0A1D6Z272	Staphylococcus_phage	4.8e-17	57.1
QAT64740.1\|1432174_1432975_+	hypothetical protein	A6M971	Geobacillus_virus	3.6e-19	37.8
QAT64741.1\|1433043_1433250_-	XRE family transcriptional regulator	A0A0A0RVA6	Bacillus_phage	1.2e-06	40.3

DBSCAN-SWA_6

1458061 : 1468878

uncultured_Caudovirales_phage(55.56%)

portal,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT64764.1\|1458061_1459483_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	2.2e-19	24.9
QAT64765.1\|1459484_1460066_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
QAT64766.1\|1460175_1460589_-	hypothetical protein	NA	NA	NA	NA
QAT64767.1\|1460720_1461350_+	hypothetical protein	F8WQ53	Bacillus_phage	3.2e-47	48.2
QAT64768.1\|1461352_1462015_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	1.4e-40	52.3
QAT64769.1\|1462184_1462538_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.1e-17	46.9
QAT64770.1\|1463274_1464114_+\|portal	phage portal protein	S6BFM4	Thermus_phage	9.4e-26	30.3
QAT64771.1\|1464013_1464814_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	48.3
QAT64772.1\|1465087_1465423_+	hypothetical protein	NA	NA	NA	NA
QAT64773.1\|1465413_1465623_+	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	3.3e-12	57.8
QAT67812.1\|1467447_1468278_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
QAT64774.1\|1468330_1468600_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.8e-23	61.8
QAT64775.1\|1468614_1468878_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.8e-28	71.3

DBSCAN-SWA_7

1522152 : 1575632

Bacillus_phage(45.45%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT64818.1\|1522152_1523583_-\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	5.3e-122	50.0
QAT64819.1\|1523700_1524150_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAT64820.1\|1524294_1524708_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
QAT64821.1\|1524778_1525426_+	hypothetical protein	NA	NA	NA	NA
QAT64822.1\|1525443_1525914_-	nucleoside deaminase	A0A0B5J096	Pandoravirus	7.6e-25	38.0
QAT64823.1\|1526061_1526694_+	histidine phosphatase family protein	NA	NA	NA	NA
QAT64824.1\|1526820_1528179_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	4.2e-84	40.3
QAT64825.1\|1528309_1529026_-	hypothetical protein	NA	NA	NA	NA
QAT64826.1\|1529026_1529338_-	DUF5082 domain-containing protein	NA	NA	NA	NA
QAT64827.1\|1529516_1531805_-	5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase	NA	NA	NA	NA
QAT64828.1\|1532267_1533221_-\|protease	serine protease	A0A127AWU5	Bacillus_phage	1.5e-75	49.8
QAT64829.1\|1533450_1533630_+	hypothetical protein	NA	NA	NA	NA
QAT64830.1\|1534188_1535544_+	magnesium transporter	NA	NA	NA	NA
QAT64831.1\|1535633_1536026_+	hypothetical protein	NA	NA	NA	NA
QAT64832.1\|1536057_1536390_-	MerR family transcriptional regulator	NA	NA	NA	NA
QAT64833.1\|1536580_1536736_+	hypothetical protein	NA	NA	NA	NA
QAT64834.1\|1536839_1537010_+	Fur-regulated basic protein FbpA	NA	NA	NA	NA
QAT64835.1\|1537193_1537655_+	MarR family transcriptional regulator	NA	NA	NA	NA
QAT64836.1\|1537658_1539506_-	DNA ligase D	NA	NA	NA	NA
QAT64837.1\|1539509_1540373_-	Ku protein	A0A249XRB2	Mycobacterium_phage	6.0e-36	33.2
QAT64838.1\|1540459_1542799_-	GGDEF and EAL domain-containing protein	NA	NA	NA	NA
QAT67816.1\|1543013_1543670_+	DedA family protein	NA	NA	NA	NA
QAT64839.1\|1543938_1544706_+	hypothetical protein	A0A068EP98	Bacillus_phage	1.4e-31	43.1
QAT64840.1\|1546641_1547397_+	RNA polymerase sigma factor SigI	NA	NA	NA	NA
QAT64841.1\|1547393_1548485_+	anti-sigma factor domain-containing protein	NA	NA	NA	NA
QAT64842.1\|1548497_1548695_-	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	7.5e-11	58.6
QAT64843.1\|1548824_1549544_-	DUF1836 domain-containing protein	NA	NA	NA	NA
QAT64844.1\|1549685_1550579_+\|protease	protease HtpX	NA	NA	NA	NA
QAT64845.1\|1550724_1552074_+	TrkH family potassium uptake protein	NA	NA	NA	NA
QAT64846.1\|1552143_1553503_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-108	72.8
QAT64847.1\|1553626_1555621_+	penicillin-binding transpeptidase domain-containing protein	NA	NA	NA	NA
QAT64848.1\|1555833_1556058_+	hypothetical protein	NA	NA	NA	NA
QAT64849.1\|1556094_1557111_-	acyltransferase family protein	NA	NA	NA	NA
QAT64850.1\|1557380_1559591_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
QAT64851.1\|1559595_1560093_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y3R2	Acanthamoeba_polyphaga_mimivirus	7.0e-21	53.8
QAT64852.1\|1560305_1561376_-	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
QAT64853.1\|1561377_1562577_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
QAT64854.1\|1562871_1563651_-	carbon-nitrogen family hydrolase	NA	NA	NA	NA
QAT64855.1\|1563745_1564936_+	pyridoxal phosphate-dependent aminotransferase	NA	NA	NA	NA
QAT64856.1\|1565180_1566398_+	2,3-diketo-5-methylthiopentyl-1-phosphate enolase	NA	NA	NA	NA
QAT64857.1\|1566394_1567096_+	2-hydroxy-3-keto-5-methylthiopentenyl-1- phosphate phosphatase	NA	NA	NA	NA
QAT64858.1\|1567053_1567680_+	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
QAT64859.1\|1567703_1568243_+	cupin domain-containing protein	NA	NA	NA	NA
QAT64860.1\|1568274_1568739_-	metallothiol transferase FosB	Q2LI91	Bacillus_phage	3.7e-32	55.2
QAT64861.1\|1568728_1569025_-	DUF1232 domain-containing protein	NA	NA	NA	NA
QAT64862.1\|1569239_1569476_+	aspartyl-phosphate phosphatase Spo0E family protein	NA	NA	NA	NA
QAT64863.1\|1569556_1571068_-	two-component sensor histidine kinase	NA	NA	NA	NA
QAT64864.1\|1571304_1571772_+	MarR family transcriptional regulator	NA	NA	NA	NA
QAT64865.1\|1571782_1572565_-	flagellar motor protein MotB	NA	NA	NA	NA
QAT64866.1\|1572557_1573352_-	flagellar motor protein MotA	NA	NA	NA	NA
QAT64867.1\|1573538_1575632_-\|protease	ATP-dependent Clp protease ATP-binding subunit	H6X3M6	Enterobacteria_phage	2.5e-128	41.8

DBSCAN-SWA_8

1877239 : 1938597

Bacillus_phage(66.67%)

protease,holin,tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT65152.1\|1877239_1878505_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
QAT65153.1\|1878551_1880270_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
QAT65154.1\|1880355_1884672_+	PolC-type DNA polymerase III	A0A0A7RWA3	Clostridium_phage	1.1e-24	31.2
QAT67830.1\|1885045_1887013_+	endoglucanase	NA	NA	NA	NA
QAT65155.1\|1887073_1889188_+	glycoside hydrolase	G0YQI6	Erwinia_phage	1.3e-111	36.6
QAT65156.1\|1889300_1890956_+	glycoside hydrolase	NA	NA	NA	NA
QAT65157.1\|1891035_1892211_+	glycoside hydrolase	NA	NA	NA	NA
QAT65158.1\|1892406_1892880_+	ribosome maturation factor RimP	NA	NA	NA	NA
QAT65159.1\|1892911_1894027_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
QAT65160.1\|1894040_1894316_+	YlxR family protein	NA	NA	NA	NA
QAT65161.1\|1894316_1894619_+	YlxQ family RNA-binding protein	NA	NA	NA	NA
QAT65162.1\|1894638_1896807_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.3e-23	25.5
QAT65163.1\|1896803_1897082_+	DUF503 domain-containing protein	NA	NA	NA	NA
QAT65164.1\|1897100_1897451_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
QAT65165.1\|1897528_1898458_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
QAT65166.1\|1898474_1899434_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	1.1e-06	29.4
QAT65167.1\|1899632_1899902_+	30S ribosomal protein S15	NA	NA	NA	NA
QAT65168.1\|1900101_1902219_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
QAT67831.1\|1902437_1903337_+	hypothetical protein	NA	NA	NA	NA
QAT65169.1\|1903374_1904604_+	insulinase family protein	G3MBJ8	Bacillus_virus	1.7e-47	31.7
QAT65170.1\|1904691_1904949_+	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
QAT65171.1\|1906784_1907669_+	dipicolinic acid synthetase subunit A	NA	NA	NA	NA
QAT65172.1\|1908042_1909677_-	recombinase family protein	O64015	Bacillus_phage	1.9e-155	51.8
QAT65173.1\|1910077_1912036_+	hypothetical protein	O64023	Bacillus_phage	1.3e-38	25.6
QAT65174.1\|1912049_1912472_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAT65175.1\|1912512_1912977_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAT65176.1\|1913376_1914468_+	DUF2325 domain-containing protein	NA	NA	NA	NA
QAT65177.1\|1914742_1915270_+	transcriptional repressor Rok	NA	NA	NA	NA
QAT65178.1\|1915347_1915701_+	hypothetical protein	NA	NA	NA	NA
QAT65179.1\|1915803_1916901_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	1.9e-39	27.9
QAT65180.1\|1917543_1917705_-\|holin	putative holin-like toxin	NA	NA	NA	NA
QAT65181.1\|1917829_1918138_-	hypothetical protein	NA	NA	NA	NA
QAT65182.1\|1918156_1918438_-\|holin	phage holin	A0A1P8CWN5	Bacillus_phage	2.4e-10	44.1
QAT65183.1\|1918456_1918843_-	hypothetical protein	A0A1P8CWP1	Bacillus_phage	3.1e-40	72.7
QAT65184.1\|1918974_1920066_-	N-acetylmuramoyl-L-alanine amidase family protein	A0A1P8CWN6	Bacillus_phage	2.6e-113	69.5
QAT65185.1\|1920402_1922967_-	hypothetical protein	D6R401	Bacillus_phage	2.2e-158	40.6
QAT65186.1\|1922985_1923783_-	hypothetical protein	O64043	Bacillus_phage	5.5e-76	59.7
QAT65187.1\|1923798_1926438_-	hypothetical protein	A0A1P8CWQ0	Bacillus_phage	2.6e-239	51.3
QAT65188.1\|1926441_1927203_-\|tail	phage tail protein	A0A1P8CWP8	Bacillus_phage	2.1e-80	59.4
QAT65189.1\|1927257_1932495_-\|tail	phage tail tape measure protein	A0A1P8CWQ1	Bacillus_phage	0.0e+00	61.6
QAT65190.1\|1933138_1934533_-\|tail	phage tail tape measure protein	A0A1P8CWQ1	Bacillus_phage	9.9e-105	57.3
QAT65191.1\|1934622_1934865_-	hypothetical protein	NA	NA	NA	NA
QAT65192.1\|1934907_1935603_-	hypothetical protein	A0A290FZK7	Caldibacillus_phage	5.6e-32	53.3
QAT65193.1\|1935550_1935802_-	hypothetical protein	NA	NA	NA	NA
QAT65194.1\|1936007_1936247_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT65195.1\|1936296_1936548_+	hypothetical protein	NA	NA	NA	NA
QAT65196.1\|1936563_1937202_-	hypothetical protein	Q37974	Bacillus_phage	1.8e-05	31.6
QAT65197.1\|1937249_1937939_-	immunity protein	Q37974	Bacillus_phage	7.7e-42	42.2
QAT65198.1\|1937961_1938597_-	immunity protein	A0A0H3UZD5	Geobacillus_virus	1.9e-23	33.2

DBSCAN-SWA_9

1945126 : 1981716

Bacillus_phage(73.33%)

integrase

attL 1943470:1943484|attR 1949325:1949339

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1943470:1943484	attL	NA	NA	NA	NA
QAT65206.1\|1945126_1946206_-	serine/threonine protein kinase	G9L673	Escherichia_phage	9.5e-55	39.1
QAT65207.1\|1946198_1946696_-	hypothetical protein	NA	NA	NA	NA
QAT65208.1\|1946839_1947841_-\|integrase	site-specific integrase	A0A1P8CWP6	Bacillus_phage	1.3e-170	85.9
QAT65209.1\|1947855_1948275_-	hypothetical protein	A0A1P8CWQ4	Bacillus_phage	5.7e-40	54.9
QAT67834.1\|1948274_1948757_-	hypothetical protein	A0A1P8CWQ6	Bacillus_phage	1.3e-16	34.6
QAT65210.1\|1948795_1948987_-	XkdX family protein	NA	NA	NA	NA
QAT65211.1\|1948983_1949301_-	hypothetical protein	NA	NA	NA	NA
QAT65212.1\|1949313_1950969_-	DNA-packaging protein	M4ZRP1	Bacillus_phage	6.0e-16	60.3
1949325:1949339	attR	NA	NA	NA	NA
QAT65213.1\|1950971_1951337_-	lysozyme	A0A1P8CWQ8	Bacillus_phage	1.2e-22	47.7
QAT65214.1\|1951908_1952715_-	hypothetical protein	A0A0N7GFG4	Staphylococcus_phage	7.1e-31	33.2
QAT65215.1\|1952759_1953479_-	hypothetical protein	A0A1P8CWQ7	Bacillus_phage	2.1e-50	42.9
QAT65216.1\|1953475_1954006_-	hypothetical protein	O64060	Bacillus_phage	5.0e-57	62.5
QAT65217.1\|1954002_1954662_-	hypothetical protein	A0A1P8CWR8	Bacillus_phage	1.2e-79	68.1
QAT65218.1\|1954648_1954891_-	hypothetical protein	A0A1P8CWS7	Bacillus_phage	1.0e-09	49.4
QAT65219.1\|1954887_1955286_-	hypothetical protein	A0A1P8CWR5	Bacillus_phage	3.4e-42	63.6
QAT65220.1\|1955297_1955768_-	hypothetical protein	A0A1P8CWS5	Bacillus_phage	8.5e-69	80.1
QAT65221.1\|1955802_1956819_-	hypothetical protein	A0A1P8CWR9	Bacillus_phage	9.2e-161	84.6
QAT65222.1\|1956863_1957466_-	hypothetical protein	A0A1P8CWS2	Bacillus_phage	2.0e-78	84.1
QAT65223.1\|1957491_1958931_-	hypothetical protein	A0A1P8CWR1	Bacillus_phage	5.0e-176	65.9
QAT65224.1\|1958964_1960485_-	hypothetical protein	O64068	Bacillus_phage	1.4e-245	82.0
QAT65225.1\|1960502_1962272_-	hypothetical protein	O64069	Bacillus_phage	0.0e+00	91.7
QAT65226.1\|1962255_1963188_-	hypothetical protein	A0A1P8CWS6	Bacillus_phage	8.3e-140	76.3
QAT65227.1\|1963468_1964659_-	metallophosphatase family protein	A0A0N9SK37	Staphylococcus_phage	7.0e-67	38.0
QAT65228.1\|1964671_1964863_-	hypothetical protein	A0A1P8CWT3	Bacillus_phage	8.9e-25	88.9
QAT65229.1\|1965507_1966023_-	hypothetical protein	L0L915	Bacillus_phage	1.9e-37	49.7
QAT65230.1\|1966088_1966319_-	hypothetical protein	NA	NA	NA	NA
QAT65231.1\|1967263_1967539_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	3.5e-30	75.6
QAT65232.1\|1967644_1968445_-	hypothetical protein	NA	NA	NA	NA
QAT65233.1\|1968441_1971216_-	hypothetical protein	H7BV05	unidentified_phage	2.3e-105	29.4
QAT65234.1\|1971246_1971699_-	hypothetical protein	NA	NA	NA	NA
QAT65235.1\|1972319_1972733_-	DUF2283 domain-containing protein	NA	NA	NA	NA
QAT65236.1\|1972747_1973443_-	DUF4258 domain-containing protein	NA	NA	NA	NA
QAT65237.1\|1973552_1974554_+	hypothetical protein	A0A2K9L199	Tupanvirus	1.5e-22	30.7
QAT65238.1\|1975316_1975754_-	hypothetical protein	M1HMZ7	Bacillus_phage	1.9e-09	30.8
QAT65239.1\|1975992_1976274_+	hypothetical protein	NA	NA	NA	NA
QAT65240.1\|1976886_1977066_+	hypothetical protein	NA	NA	NA	NA
QAT65241.1\|1977138_1977327_+	hypothetical protein	A0A1P8CWU4	Bacillus_phage	2.6e-05	46.3
QAT65242.1\|1977378_1978254_+	hypothetical protein	D2XPY2	Bacillus_virus	4.9e-09	36.9
QAT65243.1\|1978240_1979473_+	hypothetical protein	O64082	Bacillus_phage	5.9e-194	81.2
QAT65244.1\|1979784_1981716_+	hypothetical protein	A0A0H3UZM4	Geobacillus_virus	5.8e-63	35.1

DBSCAN-SWA_10

1997642 : 2009503

Bacillus_phage(76.92%)

integrase

attL 1990620:1990635|attR 2001462:2001477

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1990620:1990635	attL	NA	NA	NA	NA
QAT65270.1\|1997642_1999019_+	hypothetical protein	A0A1P8CWX1	Bacillus_phage	6.8e-58	32.9
QAT65271.1\|1999036_2000041_+\|integrase	site-specific integrase	O64101	Bacillus_phage	1.3e-58	39.1
QAT65272.1\|2000428_2000701_+	hypothetical protein	NA	NA	NA	NA
QAT65273.1\|2000714_2000909_+	hypothetical protein	NA	NA	NA	NA
QAT67835.1\|2001057_2001255_+	hypothetical protein	NA	NA	NA	NA
QAT65274.1\|2001490_2002228_+	hypothetical protein	A0A0A8WIT2	Clostridium_phage	3.0e-68	57.1
2001462:2001477	attR	NA	NA	NA	NA
QAT65275.1\|2002224_2002572_+	hypothetical protein	NA	NA	NA	NA
QAT65276.1\|2002599_2002848_+	hypothetical protein	NA	NA	NA	NA
QAT65277.1\|2002876_2003164_+	hypothetical protein	A0A0E3DEX0	Bacillus_phage	9.3e-18	51.6
QAT65278.1\|2003362_2003611_+	hypothetical protein	NA	NA	NA	NA
QAT65279.1\|2003646_2003937_+	hypothetical protein	A0A127AWI5	Bacillus_phage	1.7e-14	46.7
QAT67836.1\|2004105_2004324_+	hypothetical protein	NA	NA	NA	NA
QAT65280.1\|2004584_2004785_+	hypothetical protein	F8WPL5	Bacillus_phage	1.8e-15	60.6
QAT65281.1\|2005214_2005742_+	hypothetical protein	U5PUK4	Bacillus_phage	4.0e-51	58.1
QAT65282.1\|2006055_2006304_+	hypothetical protein	NA	NA	NA	NA
QAT65283.1\|2006313_2007126_-	ATP-dependent DNA ligase	O64130	Bacillus_phage	3.5e-118	75.8
QAT65284.1\|2007218_2007443_+	hypothetical protein	O64132	Bacillus_phage	4.9e-22	66.2
QAT65285.1\|2007619_2008291_+	hypothetical protein	A0A2H4JB05	uncultured_Caudovirales_phage	7.5e-42	42.7
QAT65286.1\|2008321_2008699_+	hypothetical protein	A8ASN9	Listeria_phage	6.7e-16	39.5
QAT65287.1\|2008847_2009294_+	hypothetical protein	A0A1B1P7V7	Bacillus_phage	4.0e-07	36.4
QAT65288.1\|2009290_2009503_+	hypothetical protein	F8WPM3	Bacillus_phage	1.4e-07	51.6

DBSCAN-SWA_11

2013723 : 2023548

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT65295.1\|2013723_2014056_+	hypothetical protein	A0A1P8CX10	Bacillus_phage	9.1e-17	49.5
QAT65296.1\|2014286_2015198_+	hypothetical protein	A0A1P8CX09	Bacillus_phage	1.1e-112	67.0
QAT65297.1\|2015252_2016224_+	ATP-binding protein	A0A1P8CX29	Bacillus_phage	2.0e-157	85.4
QAT65298.1\|2016265_2016736_+	hypothetical protein	A0A1P8CX08	Bacillus_phage	8.3e-56	67.3
QAT65299.1\|2016750_2018265_+	hypothetical protein	A0A1P8CWZ7	Bacillus_phage	2.0e-236	81.2
QAT65300.1\|2018281_2019415_+	hypothetical protein	A0A1P8CX05	Bacillus_phage	2.1e-161	71.0
QAT65301.1\|2019418_2021140_+	single-stranded-DNA-specific exonuclease RecJ	A0A1P8CX07	Bacillus_phage	8.7e-220	66.1
QAT65302.1\|2021155_2022565_+	PHP domain-containing protein	A0A1P8CX14	Bacillus_phage	4.0e-239	85.8
QAT65303.1\|2022615_2023548_+	helix-turn-helix domain-containing protein	A7KV45	Bacillus_phage	4.8e-31	36.4

DBSCAN-SWA_12

2031682 : 2049088

Bacillus_phage(82.35%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT67838.1\|2031682_2032027_+	antitoxin endoai	O64171	Bacillus_phage	7.5e-14	42.5
QAT65310.1\|2032026_2032431_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	R4JF54	Bacillus_phage	4.6e-39	62.8
QAT67839.1\|2032435_2035645_+	hypothetical protein	A0A1P8CX40	Bacillus_phage	0.0e+00	85.4
QAT65311.1\|2035667_2035889_+	hypothetical protein	A0A1P8CX04	Bacillus_phage	3.3e-23	68.5
QAT65312.1\|2035889_2036870_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4JMU8	Bacillus_phage	2.3e-148	82.2
QAT65313.1\|2037119_2037476_+\|tRNA	peptidyl-tRNA hydrolase	A0A1V0SFB5	Hokovirus	6.4e-08	30.6
QAT65314.1\|2037523_2037823_+	hypothetical protein	A0A0A0RSF8	Bacillus_phage	3.9e-11	38.0
QAT65315.1\|2037841_2038276_+	hypothetical protein	NA	NA	NA	NA
QAT65316.1\|2038319_2038754_+	dUTP diphosphatase	A0A1P8CX51	Bacillus_phage	5.5e-70	88.7
QAT65317.1\|2039072_2039261_+	hypothetical protein	NA	NA	NA	NA
QAT65318.1\|2039253_2039562_+	hypothetical protein	A0A1P8CX63	Bacillus_phage	2.6e-10	52.1
QAT65319.1\|2039551_2040109_+	hypothetical protein	G3MBK8	Bacillus_virus	3.1e-49	53.1
QAT65320.1\|2040110_2041208_+	hypothetical protein	G3MBL0	Bacillus_virus	4.0e-109	51.8
QAT65321.1\|2041220_2042060_+	thymidylate synthase	U5J9N5	Bacillus_phage	1.4e-53	42.0
QAT65322.1\|2042248_2042614_+	hypothetical protein	A0A1P8CX43	Bacillus_phage	1.2e-17	45.3
QAT65323.1\|2042933_2043332_+	hypothetical protein	NA	NA	NA	NA
QAT65324.1\|2043858_2044107_+	hypothetical protein	NA	NA	NA	NA
QAT65325.1\|2044129_2044474_+	hypothetical protein	NA	NA	NA	NA
QAT65326.1\|2044642_2044987_+	hypothetical protein	NA	NA	NA	NA
QAT65327.1\|2044987_2045995_+	hypothetical protein	R4JEY6	Bacillus_phage	4.1e-44	38.2
QAT65328.1\|2046324_2046525_-	alpha/beta-type small acid-soluble spore protein	Q77YX0	Bacillus_phage	3.7e-21	82.5
QAT65329.1\|2046613_2047129_+	hypothetical protein	NA	NA	NA	NA
QAT65330.1\|2047157_2047985_+	metallophosphoesterase	O64184	Bacillus_phage	1.6e-147	84.7
QAT65331.1\|2048000_2048357_+	hypothetical protein	NA	NA	NA	NA
QAT65332.1\|2048638_2049088_+	NADAR family protein	A0A172JI41	Bacillus_phage	4.4e-46	64.7

DBSCAN-SWA_13

2650586 : 2662845

Staphylococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT65870.1\|2650586_2651051_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.0e-45	71.1
QAT65871.1\|2651085_2652282_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	9.6e-117	54.2
QAT65872.1\|2652301_2652949_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.7e-38	42.2
QAT65873.1\|2652960_2654049_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.0e-56	38.9
QAT65874.1\|2654417_2654762_-	hypothetical protein	NA	NA	NA	NA
QAT65875.1\|2655358_2655655_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAT65876.1\|2655663_2656044_+	hypothetical protein	A0A0N9S8A3	Staphylococcus_phage	5.4e-05	31.6
QAT65877.1\|2656025_2656544_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	5.4e-40	50.0
QAT65878.1\|2656600_2657038_-	Hsp20/alpha crystallin family protein	NA	NA	NA	NA
QAT65879.1\|2657169_2657418_-	hypothetical protein	NA	NA	NA	NA
QAT65880.1\|2657407_2658538_-	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	3.6e-89	46.3
QAT67884.1\|2658774_2659212_-	peptidylprolyl isomerase	A0A2H4UTF4	Bodo_saltans_virus	2.4e-17	45.5
QAT65881.1\|2659492_2660389_+	DUF1002 domain-containing protein	NA	NA	NA	NA
QAT65882.1\|2660443_2661247_-	replication protein	O64134	Bacillus_phage	6.4e-56	51.1
QAT65883.1\|2661414_2662845_-	sensor histidine kinase	W8CYF6	Bacillus_phage	3.7e-30	31.1

DBSCAN-SWA_14

3184470 : 3270111

uncultured_Caudovirales_phage(35.0%)

protease,holin,head,coat,portal,tail,capsid,tRNA,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT66328.1\|3184470_3187113_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	9.8e-162	42.6
QAT66329.1\|3187573_3187765_+	hypothetical protein	NA	NA	NA	NA
QAT66330.1\|3187801_3188824_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
QAT66331.1\|3188840_3190346_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
QAT66332.1\|3190469_3191765_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
QAT66333.1\|3191791_3192766_-	porphobilinogen synthase	NA	NA	NA	NA
QAT66334.1\|3192769_3193558_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAT66335.1\|3193547_3194489_-	hydroxymethylbilane synthase	NA	NA	NA	NA
QAT66336.1\|3194524_3195355_-	cytochrome C assembly protein	NA	NA	NA	NA
QAT66337.1\|3195359_3196721_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
QAT66338.1\|3196906_3197392_+	hypothetical protein	NA	NA	NA	NA
QAT66339.1\|3197439_3198027_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
QAT66340.1\|3198023_3200348_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	6.5e-186	45.2
QAT66341.1\|3200551_3202207_-\|protease	ATP-dependent protease LonB	A0A0R6PGP8	Moraxella_phage	8.3e-18	36.6
QAT66342.1\|3202333_3203599_-\|protease	ATP-dependent protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.9e-147	63.8
QAT66343.1\|3203869_3205144_-	trigger factor	NA	NA	NA	NA
QAT66344.1\|3205373_3206381_-	tetratricopeptide repeat protein	NA	NA	NA	NA
QAT66345.1\|3206504_3207104_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
QAT66346.1\|3207116_3208535_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
QAT66347.1\|3208568_3209681_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
QAT66348.1\|3209708_3211265_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	3.0e-09	26.5
QAT66349.1\|3211251_3212280_-	ketol-acid reductoisomerase	NA	NA	NA	NA
QAT66350.1\|3212311_3212830_-	acetolactate synthase small subunit	NA	NA	NA	NA
QAT66351.1\|3212826_3214551_-	acetolactate synthase large subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	5.2e-63	30.2
QAT66352.1\|3214957_3215872_-	branched-chain-amino-acid transaminase	NA	NA	NA	NA
QAT66353.1\|3216329_3216617_+	hypothetical protein	NA	NA	NA	NA
QAT67920.1\|3216636_3217986_-	NADP-specific glutamate dehydrogenase	NA	NA	NA	NA
QAT66354.1\|3218784_3219180_-	hypothetical protein	NA	NA	NA	NA
QAT67921.1\|3219816_3220278_-	SMI1/KNR4 family protein	NA	NA	NA	NA
QAT66355.1\|3222772_3223285_-	metallophosphoesterase	NA	NA	NA	NA
QAT66356.1\|3223305_3223890_-	XTP/dITP diphosphatase	A0A2H4UUV7	Bodo_saltans_virus	5.4e-12	31.6
QAT66357.1\|3223915_3224659_-	ribonuclease PH	NA	NA	NA	NA
QAT66358.1\|3224781_3225891_-	sporulation protein	NA	NA	NA	NA
QAT66359.1\|3226050_3226875_-	glutamate racemase	NA	NA	NA	NA
QAT66360.1\|3226882_3227326_-	MarR family transcriptional regulator	NA	NA	NA	NA
QAT67922.1\|3227488_3227563_-	DNA-binding response regulator	NA	NA	NA	NA
QAT66361.1\|3227609_3229133_-	recombinase family protein	A0A290FZV2	Caldibacillus_phage	7.1e-149	52.9
QAT67923.1\|3229314_3229635_+	YolD-like family protein	O64030	Bacillus_phage	2.7e-10	34.0
QAT66362.1\|3229658_3230120_-	hypothetical protein	NA	NA	NA	NA
QAT67924.1\|3230126_3230534_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	6.1e-23	45.6
QAT66363.1\|3231081_3231312_+	hypothetical protein	NA	NA	NA	NA
QAT66364.1\|3231336_3231918_-	hypothetical protein	NA	NA	NA	NA
QAT66365.1\|3232082_3233165_-	N-acetylmuramoyl-L-alanine amidase	A0A1P8CWN6	Bacillus_phage	2.1e-46	54.1
QAT66366.1\|3233216_3233480_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	5.1e-31	72.4
QAT66367.1\|3233495_3233765_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	62.9
QAT66368.1\|3233850_3234117_-	hypothetical protein	NA	NA	NA	NA
QAT66369.1\|3234131_3234320_-	XkdX family protein	NA	NA	NA	NA
QAT66370.1\|3234446_3234833_-	hypothetical protein	NA	NA	NA	NA
QAT66371.1\|3234853_3238249_-	hypothetical protein	Q5YA57	Bacillus_phage	1.8e-131	44.9
QAT66372.1\|3238261_3239026_-\|tail	phage tail family protein	A0A059T682	Listeria_phage	1.8e-07	26.7
QAT66373.1\|3239022_3243903_-	hypothetical protein	Q4ZC60	Staphylococcus_virus	9.3e-33	26.3
QAT66374.1\|3243918_3244215_-	hypothetical protein	NA	NA	NA	NA
QAT66375.1\|3244262_3244775_-	hypothetical protein	NA	NA	NA	NA
QAT66376.1\|3244858_3245185_-	fibronectin type III domain-containing protein	R4JF61	Bacillus_phage	1.5e-24	67.5
QAT67925.1\|3245114_3245633_-\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
QAT66377.1\|3245646_3246045_-	DUF3168 domain-containing protein	W8EK61	Geobacillus_phage	6.4e-25	45.4
QAT66378.1\|3246060_3246480_-	HK97 gp10 family phage protein	O48447	Bacillus_phage	9.4e-35	59.1
QAT67926.1\|3246472_3246817_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
QAT66379.1\|3246816_3247125_-	hypothetical protein	A0A1W6JQJ1	Staphylococcus_phage	5.7e-13	40.2
QAT66380.1\|3247137_3247410_-	hypothetical protein	NA	NA	NA	NA
QAT66381.1\|3247411_3247750_-	hypothetical protein	NA	NA	NA	NA
QAT66382.1\|3247753_3248674_-\|capsid	phage major capsid protein	A0A2H4JCG0	uncultured_Caudovirales_phage	9.1e-107	64.0
QAT66383.1\|3248689_3249271_-	DUF4355 domain-containing protein	A0A2H4J4P4	uncultured_Caudovirales_phage	2.2e-50	56.0
QAT66384.1\|3249668_3249992_-	hypothetical protein	NA	NA	NA	NA
QAT66385.1\|3250141_3251065_-\|head	phage head morphogenesis protein	A0A1Q1PVS0	Bacillus_phage	3.0e-81	51.5
QAT66386.1\|3251051_3252446_-\|portal	phage portal protein	A0A2H4J4Q7	uncultured_Caudovirales_phage	6.5e-149	59.7
QAT66387.1\|3252442_3253720_-\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	1.2e-154	70.0
QAT66388.1\|3253716_3254466_-	hypothetical protein	A0A2P1JTW4	Anoxybacillus_phage	4.0e-60	53.8
QAT66389.1\|3254870_3255326_-	sigma-70 family RNA polymerase sigma factor	A0A2H4J4R7	uncultured_Caudovirales_phage	3.4e-62	78.1
QAT66390.1\|3255865_3256105_-	hypothetical protein	NA	NA	NA	NA
QAT66391.1\|3256104_3256368_-	hypothetical protein	NA	NA	NA	NA
QAT66392.1\|3256424_3256631_-	hypothetical protein	NA	NA	NA	NA
QAT66393.1\|3256632_3256965_-	hypothetical protein	NA	NA	NA	NA
QAT66394.1\|3257131_3257401_-	hypothetical protein	A0A2H4JDM6	uncultured_Caudovirales_phage	1.9e-09	39.1
QAT66395.1\|3257416_3257689_-	DUF5052 family protein	F8WQ63	Bacillus_phage	8.5e-29	70.3
QAT66396.1\|3257934_3258186_-	hypothetical protein	NA	NA	NA	NA
QAT66397.1\|3258182_3258500_-	hypothetical protein	NA	NA	NA	NA
QAT66398.1\|3258496_3258898_-	hypothetical protein	S5MUL4	Brevibacillus_phage	4.0e-27	47.1
QAT66399.1\|3258894_3259341_-	hypothetical protein	A0A1B1P7V7	Bacillus_phage	8.0e-08	37.4
QAT66400.1\|3259375_3259582_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	5.3e-15	60.0
QAT66401.1\|3259941_3260400_-	DUF1064 domain-containing protein	A0A2H4J891	uncultured_Caudovirales_phage	7.8e-51	70.0
QAT66402.1\|3260649_3261558_-	ATP-binding protein IstB	A0A2H4J4P8	uncultured_Caudovirales_phage	5.1e-102	70.6
QAT66403.1\|3262560_3263412_-	recombinase RecT	A0A2H4JCY8	uncultured_Caudovirales_phage	2.3e-120	78.9
QAT66404.1\|3263413_3264364_-	hypothetical protein	A0A2H4JA52	uncultured_Caudovirales_phage	6.0e-138	76.5
QAT66405.1\|3264363_3264552_-	hypothetical protein	NA	NA	NA	NA
QAT66406.1\|3264544_3264739_-	hypothetical protein	NA	NA	NA	NA
QAT67927.1\|3265281_3265539_-	hypothetical protein	NA	NA	NA	NA
QAT66407.1\|3265540_3266104_-	helix-turn-helix domain-containing protein	A0A2H4J884	uncultured_Caudovirales_phage	8.7e-60	54.0
QAT66408.1\|3266170_3266860_-	phage antirepressor	A0A1B1IMQ3	Lactococcus_phage	1.9e-32	45.8
QAT66409.1\|3267176_3267488_+	hypothetical protein	NA	NA	NA	NA
QAT66410.1\|3267635_3267872_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAT66411.1\|3268006_3268375_+	XRE family transcriptional regulator	A0A0B5CYL9	Listeria_phage	1.3e-11	35.6
QAT66412.1\|3268638_3268920_+	hypothetical protein	NA	NA	NA	NA
QAT66413.1\|3269013_3269535_+	hypothetical protein	NA	NA	NA	NA
QAT66414.1\|3269634_3270111_+	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	3.9e-29	40.9

DBSCAN-SWA_15

3397512 : 3410930

Bacillus_phage(81.82%)

holin,tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT67932.1\|3397512_3397836_+	YolD-like family protein	O64030	Bacillus_phage	1.7e-07	29.4
QAT66522.1\|3398249_3398960_-	DUF421 domain-containing protein	NA	NA	NA	NA
QAT67933.1\|3399164_3400016_+	DUF2202 domain-containing protein	NA	NA	NA	NA
QAT66523.1\|3400169_3400763_+	cupin domain-containing protein	Q2I8C5	Bacillus_phage	6.4e-53	67.6
QAT66524.1\|3400883_3401825_-	LysM peptidoglycan-binding domain-containing protein	A0A141HSE6	Bacillus_phage	6.5e-60	42.3
QAT66525.1\|3401872_3402283_-\|holin	holin	A0A0N7GFE6	Paenibacillus_phage	1.1e-24	50.8
QAT66526.1\|3402356_3403717_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-108	72.8
QAT66527.1\|3403749_3403947_-	XkdX family protein	A0EWM9	Staphylococcus_virus	7.3e-06	45.8
QAT66528.1\|3403943_3404246_-	hypothetical protein	O64053	Bacillus_phage	7.8e-07	33.9
QAT66529.1\|3404260_3405757_-	DUF2479 domain-containing protein	D6R402	Bacillus_phage	1.5e-63	64.6
QAT66530.1\|3405769_3408334_-	peptidase G2	D6R401	Bacillus_phage	7.1e-311	61.0
QAT66531.1\|3408368_3410081_-	alkaline phosphatase	D6R400	Bacillus_phage	1.3e-223	67.7
QAT66532.1\|3410093_3410930_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	2.2e-107	67.9

DBSCAN-SWA_16

3691137 : 3778741

Bacillus_phage(60.0%)

protease,holin,head,coat,integrase,portal,tail,capsid,plate,transposase,terminase

attL 3726978:3726994|attR 3778295:3778311

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT66769.1\|3691137_3692145_-\|coat	spore coat protein YutH	NA	NA	NA	NA
QAT67954.1\|3692280_3692781_+	phosphatidylglycerophosphatase A	G3MBC5	Bacillus_virus	1.7e-38	51.3
QAT66770.1\|3692833_3693604_-	TIGR01457 family HAD-type hydrolase	NA	NA	NA	NA
QAT66771.1\|3693622_3694063_-	DUF86 domain-containing protein	NA	NA	NA	NA
QAT66772.1\|3694087_3694363_-	DUF1027 domain-containing protein	NA	NA	NA	NA
QAT66773.1\|3694466_3695066_+	hypothetical protein	NA	NA	NA	NA
QAT67955.1\|3695117_3696014_-	lipoyl synthase	NA	NA	NA	NA
QAT66774.1\|3696270_3697254_+	M23 family metallopeptidase	A0A075BS18	Microcystis_phage	2.5e-06	34.3
QAT66775.1\|3697281_3698043_-	sporulation protein YunB	NA	NA	NA	NA
QAT66776.1\|3698113_3698419_-	DUF1805 domain-containing protein	NA	NA	NA	NA
QAT66777.1\|3698495_3699866_-	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
QAT66778.1\|3699890_3700709_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAT66779.1\|3700727_3701579_-	DUF72 domain-containing protein	NA	NA	NA	NA
QAT66780.1\|3701702_3702236_-	hypothetical protein	NA	NA	NA	NA
QAT66781.1\|3702326_3702914_+	TetR family transcriptional regulator	NA	NA	NA	NA
QAT66782.1\|3704317_3705571_-	alanine--glyoxylate aminotransferase family protein	NA	NA	NA	NA
QAT66783.1\|3705585_3706836_-	allantoate amidohydrolase	NA	NA	NA	NA
QAT66784.1\|3707014_3708583_+	PucR family transcriptional regulator	NA	NA	NA	NA
QAT66785.1\|3708706_3710046_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-108	72.8
QAT66786.1\|3710113_3711310_-	tetracycline resistance MFS efflux pump	NA	NA	NA	NA
QAT66787.1\|3711998_3713399_-	YfcC family protein	NA	NA	NA	NA
QAT66788.1\|3713630_3713831_+	hypothetical protein	NA	NA	NA	NA
QAT66789.1\|3713934_3714750_+	ribonuclease	NA	NA	NA	NA
QAT66790.1\|3714798_3715890_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	Q6GZ03	Mycoplasma_phage	1.9e-18	47.1
QAT66791.1\|3716000_3716729_+	transcriptional regulator PhoB	NA	NA	NA	NA
QAT66792.1\|3716719_3717556_-	fructoselysine 6-kinase	NA	NA	NA	NA
QAT66793.1\|3717563_3718463_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
QAT66794.1\|3718466_3719345_-	sugar ABC transporter permease	NA	NA	NA	NA
QAT66795.1\|3719359_3720622_-	extracellular solute-binding protein	NA	NA	NA	NA
QAT66796.1\|3720716_3721715_-	SIS domain-containing protein	A0A2K9V905	Bandra_megavirus	4.3e-09	22.4
QAT66797.1\|3721848_3722322_-	(2Fe-2S)-binding protein	A0A0P0IVM8	Acinetobacter_phage	1.1e-18	36.0
QAT66798.1\|3722299_3723157_-	xanthine dehydrogenase	NA	NA	NA	NA
QAT66799.1\|3725466_3726117_-	xanthine dehydrogenase	NA	NA	NA	NA
QAT67956.1\|3726113_3727103_-	XdhC/CoxI family protein	NA	NA	NA	NA
3726978:3726994	attL	NA	NA	NA	NA
QAT66800.1\|3727240_3728359_-	FAD-binding oxidoreductase	NA	NA	NA	NA
QAT66801.1\|3730005_3730320_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAT66802.1\|3730839_3731523_+	hypothetical protein	NA	NA	NA	NA
QAT67957.1\|3731676_3731997_+	YolD-like family protein	O64030	Bacillus_phage	4.7e-10	33.0
QAT66803.1\|3732119_3732428_-	DUF4325 domain-containing protein	J7KJ12	Streptococcus_phage	2.8e-12	45.0
QAT66804.1\|3732415_3733327_-	ATP-binding protein	J7KDG8	Streptococcus_phage	2.6e-37	33.8
QAT66805.1\|3733427_3733673_-	DNA-binding protein	A0A2H4JDR0	uncultured_Caudovirales_phage	9.4e-19	56.2
QAT66806.1\|3734237_3735764_+\|transposase	transposase	NA	NA	NA	NA
QAT66807.1\|3735781_3736120_+	hypothetical protein	NA	NA	NA	NA
QAT66808.1\|3736183_3737266_-	N-acetylmuramoyl-L-alanine amidase	A0A1P8CWN6	Bacillus_phage	6.2e-46	53.6
QAT66809.1\|3737317_3737581_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.3e-29	72.4
QAT66810.1\|3737596_3737866_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.6e-24	62.9
QAT66811.1\|3737927_3738110_-	XkdX family protein	A0EWM9	Staphylococcus_virus	2.7e-07	52.1
QAT66812.1\|3738106_3738409_-	hypothetical protein	O64053	Bacillus_phage	1.2e-07	35.7
QAT66813.1\|3738423_3739764_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	3.3e-65	51.4
QAT66814.1\|3739776_3742341_-	peptidase G2	D6R401	Bacillus_phage	3.9e-309	60.0
QAT66815.1\|3742375_3744088_-	alkaline phosphatase	D6R400	Bacillus_phage	4.5e-224	67.7
QAT66816.1\|3744100_3744937_-\|tail	phage tail family protein	D6R3Z9	Bacillus_phage	2.2e-107	68.2
QAT66817.1\|3744936_3749403_-\|tail	phage tail tape measure protein	A6M961	Geobacillus_virus	1.2e-71	42.4
QAT66818.1\|3749612_3749978_-	hypothetical protein	NA	NA	NA	NA
QAT66819.1\|3750034_3750652_-\|tail	phage tail protein	NA	NA	NA	NA
QAT66820.1\|3750666_3751050_-	hypothetical protein	NA	NA	NA	NA
QAT66821.1\|3751046_3751445_-	hypothetical protein	NA	NA	NA	NA
QAT66822.1\|3751444_3751753_-\|head,tail	head-tail adaptor protein	A0A2H4JCB1	uncultured_Caudovirales_phage	1.1e-11	38.6
QAT66823.1\|3751742_3752045_-\|head,tail	phage gp6-like head-tail connector protein	A0A0S2GLH6	Bacillus_phage	8.0e-12	45.1
QAT66824.1\|3752065_3752494_-	collagen-like protein	D6R3Z0	Bacillus_phage	1.4e-14	56.6
QAT66825.1\|3752519_3753803_-\|capsid	phage major capsid protein	A0A288WG01	Bacillus_phage	1.8e-81	45.2
QAT66826.1\|3753841_3754573_-\|protease	Clp protease ClpP	A0A2I7SCY8	Paenibacillus_phage	3.1e-57	56.4
QAT66827.1\|3754517_3755828_-\|portal	phage portal protein	D6R3Y6	Bacillus_phage	2.7e-104	46.4
QAT66828.1\|3755828_3756020_-	DUF1056 family protein	NA	NA	NA	NA
QAT66829.1\|3756031_3757741_-\|terminase	terminase large subunit	A0A0S2GLF0	Bacillus_phage	7.4e-211	63.8
QAT66830.1\|3757737_3758253_-\|terminase	phage terminase small subunit P27 family	A6M947	Geobacillus_virus	7.0e-32	43.5
QAT66831.1\|3758481_3758856_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	1.2e-28	50.8
QAT66832.1\|3758882_3759200_-	hypothetical protein	NA	NA	NA	NA
QAT66833.1\|3759393_3759702_-	hypothetical protein	NA	NA	NA	NA
QAT66834.1\|3759688_3759925_-	hypothetical protein	NA	NA	NA	NA
QAT66835.1\|3760103_3760658_-	hypothetical protein	NA	NA	NA	NA
QAT66836.1\|3760676_3761615_-	hypothetical protein	A0A1L2JY39	Aeribacillus_phage	2.7e-21	28.9
QAT66837.1\|3761818_3762001_+	type II toxin-antitoxin system HicA family toxin	D6R431	Bacillus_phage	1.7e-25	90.0
QAT66838.1\|3762057_3762474_+	type II toxin-antitoxin system HicB family antitoxin	D6R430	Bacillus_phage	1.6e-66	86.9
QAT66839.1\|3762855_3763236_-	ArpU family transcriptional regulator	Q9ZXB9	Bacillus_phage	3.0e-48	83.7
QAT66840.1\|3763382_3763664_-	hypothetical protein	NA	NA	NA	NA
QAT66841.1\|3763703_3763952_-	hypothetical protein	NA	NA	NA	NA
QAT66842.1\|3763899_3764214_-	hypothetical protein	NA	NA	NA	NA
QAT66843.1\|3764210_3764765_-	hypothetical protein	Q5YA89	Bacillus_phage	1.2e-21	43.1
QAT66844.1\|3764761_3765277_-	hypothetical protein	D6R425	Bacillus_phage	1.8e-83	84.2
QAT66845.1\|3765279_3765450_-	Fur-regulated basic protein FbpA	A0A0S2SXY0	Bacillus_phage	3.0e-08	56.6
QAT66846.1\|3765446_3765986_-	nuclease	Q9ZXC2	Bacillus_phage	2.5e-88	89.4
QAT66847.1\|3765982_3766420_-	hypothetical protein	Q9ZXC3	Bacillus_phage	1.5e-64	78.6
QAT66848.1\|3766663_3769090_-	DNA primase	D6R422	Bacillus_phage	0.0e+00	85.6
QAT66849.1\|3769150_3769588_-	DUF669 domain-containing protein	Q9ZXC5	Bacillus_phage	2.0e-75	93.1
QAT66850.1\|3769587_3770520_-	hypothetical protein	Q9ZXC7	Bacillus_phage	1.2e-154	89.8
QAT66851.1\|3770523_3771081_-	hypothetical protein	Q9ZXC8	Bacillus_phage	1.1e-70	71.9
QAT66852.1\|3771146_3771416_-	hypothetical protein	NA	NA	NA	NA
QAT66853.1\|3771509_3771779_-	hypothetical protein	Q9ZXC9	Bacillus_phage	1.8e-23	56.3
QAT66854.1\|3771833_3772148_+	hypothetical protein	NA	NA	NA	NA
QAT66855.1\|3772219_3772465_-	hypothetical protein	NA	NA	NA	NA
QAT66856.1\|3772807_3773077_-	group-specific protein	A0A0S2SXU9	Bacillus_phage	1.4e-23	56.3
QAT67958.1\|3773082_3773268_-	XRE family transcriptional regulator	A0A0M3ULF9	Bacillus_phage	4.0e-14	70.5
QAT66857.1\|3773542_3773971_+	XRE family transcriptional regulator	Q5YAA4	Bacillus_phage	1.5e-40	59.6
QAT66858.1\|3773981_3774440_+	ImmA/IrrE family metallo-endopeptidase	A0A0S2SXM3	Bacillus_phage	1.5e-46	63.0
QAT66859.1\|3774446_3775604_+\|integrase	site-specific integrase	S5MBZ0	Brevibacillus_phage	7.8e-156	69.9
QAT66860.1\|3775669_3777067_-	Fe-S cluster assembly protein SufB	NA	NA	NA	NA
QAT66861.1\|3777084_3777531_-	SUF system NifU family Fe-S cluster assembly protein	A0A2P1CJL8	Mycobacterium_phage	2.6e-14	37.0
QAT66862.1\|3777520_3778741_-	cysteine desulfurase	Q2XUY6	environmental_halophage	1.2e-117	47.1
3778295:3778311	attR	NA	NA	NA	NA

DBSCAN-SWA_17

3910743 : 3960847

Bacillus_phage(38.46%)

protease,holin,head,integrase,transposase,portal,tail,capsid,terminase

attL 3908675:3908694|attR 3945668:3945687

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3908675:3908694	attL	NA	NA	NA	NA
QAT66974.1\|3910743_3911823_-	N-acetylmuramoyl-L-alanine amidase	S6BFI4	Thermus_phage	2.1e-46	49.8
QAT66975.1\|3911874_3912138_-\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	3.0e-31	74.7
QAT66976.1\|3912153_3912423_-	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	1.7e-21	60.7
QAT67967.1\|3912497_3914108_-	DUF2479 domain-containing protein	D6R402	Bacillus_phage	2.5e-59	58.2
QAT66977.1\|3914123_3916691_-	peptidase G2	D6R401	Bacillus_phage	5.4e-298	58.9
QAT66978.1\|3916709_3918596_-	autolysin	D6R400	Bacillus_phage	2.7e-65	30.6
QAT66979.1\|3918610_3919438_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	1.5e-39	37.5
QAT66980.1\|3919434_3923754_-\|tail	phage tail tape measure protein	A0A1L2JY60	Aeribacillus_phage	1.1e-66	44.1
QAT66981.1\|3923957_3924320_-	hypothetical protein	NA	NA	NA	NA
QAT66982.1\|3924319_3924952_-	hypothetical protein	A0A2H4J8F3	uncultured_Caudovirales_phage	7.6e-20	33.2
QAT66983.1\|3924951_3925332_-	DUF3168 domain-containing protein	NA	NA	NA	NA
QAT66984.1\|3925328_3925742_-	hypothetical protein	NA	NA	NA	NA
QAT66985.1\|3925719_3926082_-\|head,tail	head-tail adaptor protein	A0A1W6JP44	Morganella_phage	4.6e-06	34.7
QAT67968.1\|3926038_3926320_-\|head,tail	phage gp6-like head-tail connector protein	A0A1C8E967	Bacillus_phage	3.8e-16	46.0
QAT66986.1\|3926306_3927608_-\|capsid	phage major capsid protein	A0A1C8E976	Bacillus_phage	7.1e-89	54.2
QAT66987.1\|3927604_3928195_-\|head,protease	HK97 family phage prohead protease	A0A1B2APW1	Phage_Wrath	2.4e-52	56.4
QAT66988.1\|3928187_3929366_-\|portal	phage portal protein	A0A2H4J9C7	uncultured_Caudovirales_phage	2.3e-107	53.4
QAT67969.1\|3929378_3931085_-\|terminase	terminase large subunit	A0A1B0T685	Bacillus_phage	1.6e-189	56.7
QAT67970.1\|3931129_3931534_-\|terminase	terminase small subunit	A0A1C8E969	Bacillus_phage	9.4e-24	44.9
QAT66989.1\|3931611_3931983_-	HNH endonuclease	NA	NA	NA	NA
QAT66990.1\|3931979_3932189_-	hypothetical protein	NA	NA	NA	NA
QAT66991.1\|3932494_3933124_-	hypothetical protein	NA	NA	NA	NA
QAT66992.1\|3933111_3933357_-	hypothetical protein	NA	NA	NA	NA
QAT66993.1\|3933359_3933584_-	hypothetical protein	NA	NA	NA	NA
QAT66994.1\|3933945_3934128_+	type II toxin-antitoxin system HicA family toxin	D6R431	Bacillus_phage	1.7e-25	90.0
QAT66995.1\|3934176_3934593_+	type II toxin-antitoxin system HicB family antitoxin	D6R430	Bacillus_phage	3.8e-68	88.3
QAT66996.1\|3935097_3935640_-\|integrase	site-specific integrase	D2XR58	Bacillus_phage	2.5e-56	61.1
QAT66997.1\|3935639_3936080_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	1.5e-35	50.4
QAT66998.1\|3936506_3937316_-	DNA adenine methylase	U5P0W8	Brevibacillus_phage	1.2e-89	59.1
QAT66999.1\|3937389_3937641_-	hypothetical protein	NA	NA	NA	NA
QAT67000.1\|3937637_3937871_-	hypothetical protein	NA	NA	NA	NA
QAT67001.1\|3937905_3938112_-	hypothetical protein	A0A2H4J4M6	uncultured_Caudovirales_phage	1.4e-07	47.6
QAT67002.1\|3938184_3938334_-	BH0509 family protein	NA	NA	NA	NA
QAT67003.1\|3938438_3938987_-	hypothetical protein	NA	NA	NA	NA
QAT67004.1\|3939310_3940144_-	ATP-binding protein	Q2I8C8	Bacillus_phage	6.4e-35	37.4
QAT67005.1\|3940127_3940985_-	DNA replication protein DnaD	A0A0U3TZZ4	Bacillus_phage	7.8e-60	52.3
QAT67006.1\|3940977_3941208_-	hypothetical protein	NA	NA	NA	NA
QAT67007.1\|3941260_3941659_+	hypothetical protein	R9VW35	Paenibacillus_phage	7.4e-05	34.6
QAT67008.1\|3941645_3941921_-	hypothetical protein	NA	NA	NA	NA
QAT67009.1\|3941922_3942168_-	hypothetical protein	NA	NA	NA	NA
QAT67010.1\|3942238_3943009_-	phage antirepressor Ant	A0A290FZK7	Caldibacillus_phage	4.9e-106	73.5
QAT67011.1\|3943005_3943212_-	XRE family transcriptional regulator	A0A1B2APY7	Phage_Wrath	2.1e-11	56.7
QAT67012.1\|3943248_3943449_-	XRE family transcriptional regulator	A0A2P1JU05	Anoxybacillus_phage	1.4e-12	55.7
QAT67013.1\|3943599_3944016_+	XRE family transcriptional regulator	A0A2P1JU09	Anoxybacillus_phage	4.5e-29	55.5
QAT67014.1\|3944038_3944482_+	ImmA/IrrE family metallo-endopeptidase	Q9T201	Bacillus_phage	4.2e-49	62.8
QAT67015.1\|3944530_3945595_+\|integrase	site-specific integrase	A0A1B2AQ00	Phage_Wrath	2.0e-134	64.3
QAT67016.1\|3946140_3946614_-	SsrA-binding protein	W5RAM5	Staphylococcus_phage	3.5e-46	62.5
3945668:3945687	attR	NA	NA	NA	NA
QAT67017.1\|3946726_3949030_-	ribonuclease R	Q0GXV6	Lactococcus_phage	4.5e-94	41.4
QAT67018.1\|3949043_3949790_-	alpha/beta fold hydrolase	NA	NA	NA	NA
QAT67019.1\|3949907_3950138_-	preprotein translocase subunit SecG	NA	NA	NA	NA
QAT67020.1\|3950297_3950582_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A0K2CZ86	Paenibacillus_phage	3.2e-10	50.0
QAT67971.1\|3950610_3950796_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAT67021.1\|3950996_3951401_+	transcriptional regulator	S6C481	Thermus_phage	7.7e-18	65.3
QAT67022.1\|3951551_3951956_+	XRE family transcriptional regulator	S6C481	Thermus_phage	4.7e-15	60.3
QAT67972.1\|3952002_3952680_-	ABC transporter permease	NA	NA	NA	NA
QAT67023.1\|3952700_3953618_-	osmoprotectant ABC transporter substrate-binding protein	NA	NA	NA	NA
QAT67024.1\|3953631_3954285_-	ABC transporter permease	NA	NA	NA	NA
QAT67025.1\|3954297_3955440_-	ATP-binding cassette domain-containing protein	F2Y1V5	Organic_Lake_phycodnavirus	2.3e-14	31.1
QAT67026.1\|3955699_3956236_+	GbsR/MarR family transcriptional regulator	NA	NA	NA	NA
QAT67027.1\|3956286_3957647_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-108	72.8
QAT67028.1\|3957720_3958353_-	NAAT family transporter	NA	NA	NA	NA
QAT67029.1\|3958501_3959281_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
QAT67030.1\|3959416_3960847_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	5.3e-122	50.0

DBSCAN-SWA_18

3980221 : 4052449

Bacillus_phage(28.12%)

holin,integrase,portal,tail,capsid,plate,transposase

attL 3999147:3999162|attR 4057031:4057046

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT67046.1\|3980221_3981581_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.1e-108	72.8
QAT67047.1\|3981657_3981975_-	hypothetical protein	NA	NA	NA	NA
QAT67048.1\|3982038_3982965_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.7e-28	33.2
QAT67049.1\|3982964_3983654_-	hypothetical protein	NA	NA	NA	NA
QAT67050.1\|3983813_3984638_+	MerR family transcriptional regulator	NA	NA	NA	NA
QAT67051.1\|3984634_3986392_+	CocE/NonD family hydrolase	NA	NA	NA	NA
QAT67052.1\|3986435_3987158_-	lactate utilization protein C	NA	NA	NA	NA
QAT67053.1\|3987154_3988582_-	iron-sulfur cluster-binding protein	NA	NA	NA	NA
QAT67054.1\|3988621_3989338_-	(Fe-S)-binding protein	NA	NA	NA	NA
QAT67975.1\|3989497_3990196_-	FadR family transcriptional regulator	NA	NA	NA	NA
QAT67055.1\|3990439_3992128_+	L-lactate permease	NA	NA	NA	NA
QAT67056.1\|3992158_3993472_-	RNA polymerase sigma-54 factor	NA	NA	NA	NA
QAT67057.1\|3993544_3993757_+	hypothetical protein	NA	NA	NA	NA
QAT67058.1\|3993778_3994744_-	pyruvyl transferase	NA	NA	NA	NA
QAT67059.1\|3994755_3995901_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2D2W2B8	Stenotrophomonas_phage	5.4e-08	25.6
QAT67976.1\|3995923_3996550_-	acetyltransferase	NA	NA	NA	NA
QAT67060.1\|3996549_3997152_-	sugar transferase	NA	NA	NA	NA
QAT67061.1\|3997171_3998719_-	MATE family efflux transporter	NA	NA	NA	NA
QAT67062.1\|3998724_3999744_-	glycosyltransferase	NA	NA	NA	NA
3999147:3999162	attL	NA	NA	NA	NA
QAT67063.1\|3999740_4000820_-	pyruvyl transferase	NA	NA	NA	NA
QAT67064.1\|4000831_4001863_-	glycosyltransferase	A0A1V0SAH6	Catovirus	1.4e-10	38.0
QAT67065.1\|4001932_4003036_-	EpsG family protein	NA	NA	NA	NA
QAT67066.1\|4003038_4004199_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
QAT67067.1\|4004191_4005034_-	glycosyltransferase	NA	NA	NA	NA
QAT67068.1\|4005030_4006179_-	glycosyltransferase family 1 protein	NA	NA	NA	NA
QAT67069.1\|4006190_4008008_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	3.4e-28	31.0
QAT67070.1\|4008264_4008957_-	tyrosine-protein kinase family protein	A0A1X9I5D6	Streptococcus_phage	2.3e-22	33.2
QAT67071.1\|4008937_4009690_-	hypothetical protein	NA	NA	NA	NA
QAT67072.1\|4009926_4010385_+	helix-turn-helix domain-containing protein	A0A0K2CP57	Brevibacillus_phage	5.0e-05	47.2
QAT67073.1\|4010779_4011304_+	general stress protein	NA	NA	NA	NA
QAT67074.1\|4011343_4012627_-	MFS transporter	NA	NA	NA	NA
QAT67075.1\|4012696_4013647_-	hydroxyacid dehydrogenase	A0A1V0SBV6	Catovirus	3.9e-36	33.0
QAT67076.1\|4013674_4014673_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
QAT67077.1\|4014676_4015948_-	four-carbon acid sugar kinase family protein	NA	NA	NA	NA
QAT67078.1\|4015960_4017127_-	iron-containing alcohol dehydrogenase	NA	NA	NA	NA
QAT67079.1\|4017140_4018028_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
QAT67977.1\|4018269_4019628_+\|transposase	IS1182 family transposase	A0A1X9I5T2	Streptococcus_phage	4.2e-84	40.3
QAT67080.1\|4019756_4021475_-	propionate catabolism operon regulatory protein PrpR	NA	NA	NA	NA
QAT67081.1\|4021574_4021898_-	transcriptional regulator	NA	NA	NA	NA
QAT67082.1\|4023609_4025061_+	glycoside hydrolase family 68 protein	NA	NA	NA	NA
QAT67083.1\|4025141_4026677_+	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	2.4e-96	42.7
QAT67084.1\|4026874_4027306_+	SMI1/KNR4 family protein	NA	NA	NA	NA
QAT67085.1\|4027594_4028413_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAT67086.1\|4028552_4028759_+	XRE family transcriptional regulator	A0A0A0RVA6	Bacillus_phage	1.1e-07	38.1
QAT67087.1\|4028814_4029117_-	hypothetical protein	NA	NA	NA	NA
QAT67088.1\|4029312_4029912_-	N-acetyltransferase	NA	NA	NA	NA
QAT67089.1\|4030359_4030590_-\|holin	phage holin	A0A1D6Z272	Staphylococcus_phage	4.8e-17	57.1
QAT67090.1\|4030610_4031552_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	4.8e-95	62.9
QAT67091.1\|4031617_4031881_-\|holin	holin	NA	NA	NA	NA
QAT67092.1\|4031884_4032106_-	XkdX family protein	M4ZS22	Bacillus_phage	5.0e-11	68.1
QAT67093.1\|4032107_4032392_-	hypothetical protein	M4ZR44	Bacillus_phage	4.3e-15	44.7
QAT67094.1\|4032406_4033774_-\|plate	phage baseplate upper protein	M4ZRP1	Bacillus_phage	1.1e-63	52.2
QAT67095.1\|4033786_4036351_-	peptidase G2	D6R401	Bacillus_phage	0.0e+00	65.1
QAT67096.1\|4036366_4037743_-	endopeptidase	A6M966	Geobacillus_virus	1.4e-42	35.5
QAT67978.1\|4037752_4038529_-\|tail	phage tail family protein	A0A2H4JBY6	uncultured_Caudovirales_phage	1.3e-58	45.6
QAT67979.1\|4038612_4041357_-\|tail	phage tail tape measure protein	A0A0N9SJR9	Paenibacillus_phage	3.8e-68	35.2
QAT67097.1\|4041783_4042152_-	hypothetical protein	NA	NA	NA	NA
QAT67098.1\|4042203_4042767_-	hypothetical protein	A0A0N9SHI3	Paenibacillus_phage	4.6e-53	60.1
QAT67099.1\|4042804_4043179_-	hypothetical protein	NA	NA	NA	NA
QAT67100.1\|4043182_4043593_-	hypothetical protein	A0A0N9SJT1	Paenibacillus_phage	4.1e-27	49.3
QAT67101.1\|4043589_4043928_-	hypothetical protein	A0A0N9RTI3	Paenibacillus_phage	2.4e-20	48.2
QAT67102.1\|4043928_4044315_-	hypothetical protein	A0A0N9SGG4	Paenibacillus_phage	1.3e-25	47.2
QAT67103.1\|4044329_4044542_-	hypothetical protein	NA	NA	NA	NA
QAT67104.1\|4044596_4045688_-	hypothetical protein	A0A2H4J2M3	uncultured_Caudovirales_phage	4.8e-131	66.9
QAT67105.1\|4045742_4046474_-	OmpH family outer membrane protein	A0A2H4IZP8	uncultured_Caudovirales_phage	2.0e-24	39.1
QAT67106.1\|4046584_4047139_-	hypothetical protein	S5MA16	Bacillus_phage	7.8e-13	40.3
QAT67107.1\|4047135_4047963_-\|capsid	minor capsid protein	A0A0N9SJR1	Paenibacillus_phage	5.9e-81	55.3
QAT67108.1\|4047959_4049597_-\|portal	phage portal protein	A0A2H4J180	uncultured_Caudovirales_phage	3.1e-166	57.2
QAT67109.1\|4049599_4050028_-	hypothetical protein	A0A2H4J6Z8	uncultured_Caudovirales_phage	1.9e-22	56.4
QAT67110.1\|4050044_4051799_-	hypothetical protein	A0A2H4J484	uncultured_Caudovirales_phage	9.4e-254	72.6
QAT67111.1\|4051903_4052449_+\|integrase	site-specific integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	5.3e-30	44.7
4057031:4057046	attR	NA	NA	NA	NA

DBSCAN-SWA_19

4057452 : 4089801

Bacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAT67117.1\|4057452_4057626_+	hypothetical protein	A0A1P8CWV7	Bacillus_phage	2.9e-22	83.6
QAT67118.1\|4057661_4058006_-	DUF1433 domain-containing protein	NA	NA	NA	NA
QAT67119.1\|4058056_4059484_+	lipase	NA	NA	NA	NA
QAT67120.1\|4059495_4059807_+	hypothetical protein	NA	NA	NA	NA
QAT67121.1\|4059839_4060640_-	hypothetical protein	A0A0N9S810	Paenibacillus_phage	7.7e-70	53.5
QAT67122.1\|4060727_4061216_-	hypothetical protein	A0A0N7GFF4	Paenibacillus_phage	3.4e-12	35.8
QAT67123.1\|4061208_4061598_-	DUF134 domain-containing protein	A0A0N9RZI0	Paenibacillus_phage	6.7e-19	44.3
QAT67124.1\|4061716_4062103_+	hypothetical protein	NA	NA	NA	NA
QAT67125.1\|4062091_4062655_-	dephospho-CoA kinase	A0A0N9SJZ0	Paenibacillus_phage	3.6e-37	47.8
QAT67126.1\|4062651_4063656_-	hypothetical protein	A0A1P8CWY7	Bacillus_phage	7.0e-20	39.4
QAT67127.1\|4063672_4064128_-	methyltransferase domain-containing protein	A8ATY8	Listeria_phage	1.9e-65	75.3
QAT67128.1\|4064144_4064330_-	hypothetical protein	NA	NA	NA	NA
QAT67980.1\|4064326_4064872_-	hypothetical protein	A0A142F1S8	Bacillus_phage	3.2e-27	62.4
QAT67981.1\|4065016_4065778_-	FAD-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	1.3e-87	69.1
QAT67129.1\|4065793_4066300_-	Fis family transcriptional regulator	A0A2H4J152	uncultured_Caudovirales_phage	3.7e-25	48.7
QAT67130.1\|4066274_4066784_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	D2XR49	Bacillus_phage	1.3e-41	55.0
QAT67982.1\|4067399_4067921_-	HNH endonuclease	A0A1P8CX39	Bacillus_phage	7.8e-71	74.6
QAT67131.1\|4068648_4068981_-	DUF1140 family protein	NA	NA	NA	NA
QAT67132.1\|4069012_4071112_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	78.8
QAT67133.1\|4071101_4071458_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	5.9e-30	56.8
QAT67134.1\|4071597_4071798_-	hypothetical protein	NA	NA	NA	NA
QAT67135.1\|4071794_4072052_-	hypothetical protein	NA	NA	NA	NA
QAT67136.1\|4072056_4072422_-	hypothetical protein	A0A218KDD8	Bacillus_phage	2.6e-12	39.3
QAT67137.1\|4072421_4072988_-	hypothetical protein	A0A0N9ST03	Paenibacillus_phage	5.0e-07	52.6
QAT67138.1\|4072980_4073190_-	hypothetical protein	NA	NA	NA	NA
QAT67139.1\|4073189_4074239_-	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	1.4e-82	54.9
QAT67140.1\|4074253_4076500_-	DNA polymerase I	A0A2H4J6W7	uncultured_Caudovirales_phage	3.6e-173	48.6
QAT67141.1\|4076682_4076946_-	hypothetical protein	NA	NA	NA	NA
QAT67142.1\|4076986_4077418_-	hypothetical protein	A0A2H4IZM8	uncultured_Caudovirales_phage	5.2e-12	41.0
QAT67143.1\|4077595_4078375_-	hypothetical protein	A0A2H4IZK6	uncultured_Caudovirales_phage	6.6e-58	50.4
QAT67144.1\|4078622_4079147_-	hypothetical protein	NA	NA	NA	NA
QAT67145.1\|4079440_4080076_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
QAT67146.1\|4080339_4081578_-	hypothetical protein	A0A288WG12	Bacillus_phage	3.3e-43	28.6
QAT67147.1\|4081689_4081899_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT67983.1\|4081911_4082196_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAT67148.1\|4082192_4083212_-	DNA primase	A0A2H4J6E6	uncultured_Caudovirales_phage	1.0e-74	46.9
QAT67149.1\|4083233_4084595_-	DNA helicase	A0A2H4IZL9	uncultured_Caudovirales_phage	4.2e-124	51.3
QAT67150.1\|4084613_4085402_-	phage antirepressor Ant	A0A2P1JTZ2	Anoxybacillus_phage	1.1e-63	56.4
QAT67151.1\|4085398_4085902_-	hypothetical protein	NA	NA	NA	NA
QAT67152.1\|4085898_4086726_-	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	4.1e-74	53.8
QAT67153.1\|4086744_4086948_-	hypothetical protein	A0A1P8CX62	Bacillus_phage	1.2e-14	63.2
QAT67154.1\|4086944_4087949_-	hypothetical protein	R4JEY6	Bacillus_phage	3.0e-55	43.0
QAT67155.1\|4087965_4088349_-	hypothetical protein	NA	NA	NA	NA
QAT67156.1\|4088332_4088752_-	hypothetical protein	NA	NA	NA	NA
QAT67157.1\|4089471_4089801_-	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	2.5e-06	33.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage