CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP035392	Bacillus subtilis strain SRCM103689 plasmid unnamed1	0 crisprs	NA	0	0	1	0
CP035391	Bacillus subtilis strain SRCM103689 chromosome, complete genome	1 crisprs	csa3,cas3,DEDDh,WYL,DinG	0	1	10	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4243 : 26016

Bacillus_phage(50.0%)

holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV86625.1\|4243_6709_+	hypothetical protein	M5AC19	Bacillus_phage	2.8e-78	44.5
QAV86626.1\|6726_8151_+	hypothetical protein	NA	NA	NA	NA
QAV86627.1\|8163_8532_+	hypothetical protein	NA	NA	NA	NA
QAV86628.1\|8551_8833_+	XkdX family protein	NA	NA	NA	NA
QAV86629.1\|8855_9140_+\|holin	holin	NA	NA	NA	NA
QAV86630.1\|9212_10157_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.1e-89	61.7
QAV86631.1\|10175_10433_+\|holin	holin	A0A0U4JE55	Bacillus_phage	3.3e-22	57.6
QAV86632.1\|10565_10880_+	hypothetical protein	NA	NA	NA	NA
QAV86633.1\|10898_11234_-	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	6.2e-13	35.8
QAV86634.1\|11279_11504_-	transcriptional regulator	B3RH35	Bacillus_virus	8.3e-22	63.0
QAV86635.1\|11784_12072_+	hypothetical protein	NA	NA	NA	NA
QAV86655.1\|12068_13223_+	DNA translocase FtsK	Q0H250	Geobacillus_phage	1.0e-83	45.2
QAV86636.1\|13209_13842_+	hypothetical protein	Q0H249	Geobacillus_phage	2.7e-62	57.6
QAV86637.1\|13858_14077_-	hypothetical protein	NA	NA	NA	NA
QAV86638.1\|14096_14303_-	XRE family transcriptional regulator	NA	NA	NA	NA
QAV86639.1\|14433_15270_+	helix-turn-helix domain-containing protein	A0A288WFX2	Bacillus_phage	2.3e-16	29.9
QAV86640.1\|15764_16709_+	hypothetical protein	A0A142F1N9	Bacillus_phage	1.5e-24	27.8
QAV86641.1\|16861_17314_+	hypothetical protein	NA	NA	NA	NA
QAV86642.1\|18028_18406_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAV86643.1\|18757_19081_+	hypothetical protein	NA	NA	NA	NA
QAV86644.1\|19116_19473_+	hypothetical protein	NA	NA	NA	NA
QAV86645.1\|19459_19828_+	hypothetical protein	A0A2H4J134	uncultured_Caudovirales_phage	2.5e-23	47.4
QAV86646.1\|19856_20609_+	hypothetical protein	A0A1P8CX46	Bacillus_phage	6.1e-77	62.7
QAV86647.1\|20777_21593_+	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	4.3e-68	49.8
QAV86648.1\|21589_22102_+	hypothetical protein	NA	NA	NA	NA
QAV86649.1\|22206_22482_+	hypothetical protein	NA	NA	NA	NA
QAV86650.1\|22478_23873_+	DNA helicase	A0A2H4IZL9	uncultured_Caudovirales_phage	2.9e-128	52.2
QAV86651.1\|23983_24997_+	DNA primase	A0A2H4J6E6	uncultured_Caudovirales_phage	1.8e-76	49.2
QAV86652.1\|24993_25260_-	XRE family transcriptional regulator	A0A1P8CWW6	Bacillus_phage	4.0e-07	47.6
QAV86653.1\|25389_26016_+	hypothetical protein	I3WU00	Bacillus_phage	2.3e-21	32.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP035391

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP035391_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP035391_2

3041612-3041719

Orphan

Consensus_repeat	Method
TGATGGGAATCGAACCCACGACAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP035391_2

>merge|CP035391|2|3041612-3041719|CRISPRCasFinder
TGATGGGAATCGAACCCACGACATCAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGATTGATGGGAATCGAACCCACGAATG

>CP035391|2|2|3041612-3041719|CRISPRCasFinder
TGATGGGAATCGAACCCACGACAT	CAGCTTGGAAGGCTGAGGTTTTACCACTAAACTACACCCGCAATTTTTATTTGGGGCGAT
TGATGGGAATCGAACCCACGAATG

Protein	Signature genes	Signature genes Name	Protein_function
CP035391.1\|QAV85482.1\|3029047_3030103_-\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035391.1\|QAV85496.1\|3052556_3053135_-\|MOSC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377051
CP035391.1\|QAV85495.1\|3052062_3052551_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|378981
CP035391.1\|QAV85498.1\|3056118_3056661_+\|GbsR/MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224427
CP035391.1\|QAV85493.1\|3049820_3051350_-\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|225177
CP035391.1\|QAV85481.1\|3028614_3029046_-\|hypothetical-protein	unknown	unknown	unknown
CP035391.1\|QAV85494.1\|3051370_3051895_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376684
CP035391.1\|QAV85492.1\|3049281_3049803_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
CP035391.1\|QAV85484.1\|3031440_3032514_+\|CotS-family-spore-coat-protein	unknown	unknown	gnl\|CDD\|131952
CP035391.1\|QAV85491.1\|3048661_3049240_+\|energy-coupled-thiamine-transporter-ThiT	unknown	unknown	gnl\|CDD\|226377
CP035391.1\|QAV85499.1\|3056858_3057404_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379999
CP035391.1\|QAV85490.1\|3039119_3041003_-\|1,4-alpha-glucan-branching-enzyme	unknown	unknown	gnl\|CDD\|273667
CP035391.1\|QAV86592.1\|3053222_3054431_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341481
CP035391.1\|QAV85489.1\|3037980_3039123_-\|glucose-1-phosphate-adenylyltransferase	unknown	unknown	gnl\|CDD\|179997
CP035391.1\|QAV85486.1\|3033091_3035488_-\|glycogen/starch/alpha-glucan-phosphorylase	unknown	unknown	gnl\|CDD\|273967
CP035391.1\|QAV85485.1\|3032593_3033061_+\|tryptophan-rich-sensory-protein	unknown	unknown	gnl\|CDD\|226007
CP035391.1\|QAV85483.1\|3030117_3031251_-\|glycosyltransferase-family-1-protein	unknown	unknown	gnl\|CDD\|340831
CP035391.1\|QAV85497.1\|3054447_3055920_-\|betaine-aldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143437
CP035391.1\|QAV85487.1\|3035474_3036929_-\|glycogen-synthase-GlgA	unknown	unknown	gnl\|CDD\|234809
CP035391.1\|QAV85488.1\|3036925_3037957_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	unknown	unknown	gnl\|CDD\|273966

Protein	Function_ID	Function_description	E-value
CP035391.1\|QAV85482.1\|3029047_3030103_-\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	3.63842e-130
CP035391.1\|QAV85495.1\|3052062_3052551_+\|DinB-family-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	3.20062e-17
CP035391.1\|QAV85498.1\|3056118_3056661_+\|GbsR/MarR-family-transcriptional-regulator	gnl\|CDD\|224427	COG1510, COG1510, Predicted transcriptional regulators [Transcription].	1.21185e-72
CP035391.1\|QAV85493.1\|3049820_3051350_-\|flotillin-family-protein	gnl\|CDD\|225177	COG2268, COG2268, Uncharacterized protein conserved in bacteria [Function unknown].	5.60281e-123
CP035391.1\|QAV85488.1\|3036925_3037957_-\|glucose-1-phosphate-adenylyltransferase-subunit-GlgD	gnl\|CDD\|273966	TIGR02092, Glycogen_biosynthesis_protein_GlgD, glucose-1-phosphate adenylyltransferase, GlgD subunit. This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, TIGR02091) in a subset of bacteria that use GlgC for glycogen biosynthesis. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035391.1\|QAV85494.1\|3051370_3051895_-\|hypothetical-protein	gnl\|CDD\|376684	pfam01957, NfeD, NfeD-like C-terminal, partner-binding. NfeD-like proteins are widely distributed throughout prokaryotes and are frequently associated with genes encoding stomatin-like proteins (slipins). There appear to be three major groups: an ancestral group with only an N-terminal serine protease domain and this C-terminal beta sheet-rich domain which is structurally very similar to the OB-fold domain, associated with its neighboring slipin cluster; a second major group with an additional middle, membrane-spanning domain, associated in some species with eoslipin and in others with yqfA; a final 'artificial' group which unites truncated forms lacking the protease region and associated with their ancestral gene partner, either yqfA or eoslipin. This NefD, C-terminal, domain appears to be the major one for relating to the associated protein. NfeD homologs are clearly reliant on their conserved gene neighbor which is assumed to be necessary for function, either through direct physical interaction or by functioning in the same pathway, possibly involve with lipid-rafts.	0.000174975
CP035391.1\|QAV85492.1\|3049281_3049803_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	4.59125e-12
CP035391.1\|QAV85484.1\|3031440_3032514_+\|CotS-family-spore-coat-protein	gnl\|CDD\|131952	TIGR02906, Spore_coat_protein_S, spore coat protein, CotS family. Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination].	1.50788e-132
CP035391.1\|QAV85491.1\|3048661_3049240_+\|energy-coupled-thiamine-transporter-ThiT	gnl\|CDD\|226377	COG3859, COG3859, Predicted membrane protein [Function unknown].	1.328e-72
CP035391.1\|QAV85499.1\|3056858_3057404_+\|hypothetical-protein	gnl\|CDD\|379999	pfam17735, BslA, Biofilm surface layer A. This family includes members such as BslA (previously called YuaB). Secreted BslA from Bacillus subtillis has been shown to form surface layers around the biofilm self-assembling at interfaces of B. subtilis biofilms, forming an elastic film. structural analysis revealed that BslA consists of an Ig-type fold with the addition of an unusual, extremely hydrophobic cap region. The hydrophobic cap exhibits physiochemical properties similar to the hydrophobic surface found in fungal hydrophobins; thus, BslA is defined as member of a class of bacterially produced hydrophobins.	5.35887e-46
CP035391.1\|QAV85490.1\|3039119_3041003_-\|1,4-alpha-glucan-branching-enzyme	gnl\|CDD\|273667	TIGR01515, branching_enzym, alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP\|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI\|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP\|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035391.1\|QAV86592.1\|3053222_3054431_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341481	cd08551, Fe-ADH, iron-containing alcohol dehydrogenases (Fe-ADH)-like. This family contains large metal-containing alcohol dehydrogenases (ADH), known as iron-containing alcohol dehydrogenases. They contain a dehydroquinate synthase-like protein structural fold and mostly contain iron. They are distinct from other alcohol dehydrogenases which contains different protein domains. There are several distinct families of alcohol dehydrogenases: Zinc-containing long-chain alcohol dehydrogenases, insect-type, or short-chain alcohol dehydrogenases, iron-containing alcohol dehydrogenases, among others. The iron-containing family has a Rossmann fold-like topology that resembles the fold of the zinc-dependent alcohol dehydrogenases, but lacks sequence homology, and differs in strand arrangement. ADH catalyzes the reversible oxidation of alcohol to acetaldehyde with the simultaneous reduction of NAD(P)+ to NAD(P)H.	1.69004e-175
CP035391.1\|QAV85489.1\|3037980_3039123_-\|glucose-1-phosphate-adenylyltransferase	gnl\|CDD\|179997	PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional.	0
CP035391.1\|QAV85486.1\|3033091_3035488_-\|glycogen/starch/alpha-glucan-phosphorylase	gnl\|CDD\|273967	TIGR02093, Glycogen_phosphorylase, glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides].	0
CP035391.1\|QAV85485.1\|3032593_3033061_+\|tryptophan-rich-sensory-protein	gnl\|CDD\|226007	COG3476, COG3476, Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) [Signal transduction mechanisms].	1.51044e-40
CP035391.1\|QAV85483.1\|3030117_3031251_-\|glycosyltransferase-family-1-protein	gnl\|CDD\|340831	cd03801, GT4_PimA-like, phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.	1.47076e-74
CP035391.1\|QAV85497.1\|3054447_3055920_-\|betaine-aldehyde-dehydrogenase	gnl\|CDD\|143437	cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like. Included in this CD is the NAD+-dependent, betaine aldehyde dehydrogenase (BADH, GbsA, EC=1.2.1.8) of Bacillus subtilis involved in the synthesis of the osmoprotectant glycine betaine from choline or glycine betaine aldehyde.	0
CP035391.1\|QAV85487.1\|3035474_3036929_-\|glycogen-synthase-GlgA	gnl\|CDD\|234809	PRK00654, glgA, glycogen synthase GlgA.	0
CP035391.1\|QAV85496.1\|3052556_3053135_-\|MOSC-domain-containing-protein	gnl\|CDD\|377051	pfam03473, MOSC, MOSC domain. The MOSC (MOCO sulfurase C-terminal) domain is a superfamily of beta-strand-rich domains identified in the molybdenum cofactor sulfurase and several other proteins from both prokaryotes and eukaryotes. These MOSC domains contain an absolutely conserved cysteine and occur either as stand-alone forms or fused to other domains such as NifS-like catalytic domain in Molybdenum cofactor sulfurase. The MOSC domain is predicted to be a sulfur-carrier domain that receives sulfur abstracted by the pyridoxal phosphate-dependent NifS-like enzymes, on its conserved cysteine, and delivers it for the formation of diverse sulfur-metal clusters.	6.56018e-06

>CP035391.1|QAV85490.1|3039119_3041003_-|1,4-alpha-glucan-branching-enzyme
MAAASPTAHDVYLFHEGSLFKSYQLFGSHYRELNGKSGYEFCVWAPHASEVRVAGDFNSWSGEEHVMHRVNDNGIWTLFIPGIGEKERYKYEIVTNNGEIRLKADPYAIYSEVRPNTASLTYNLEGYSWQDQKWQNKQKAKTLYEKPVFIYELHLGSWKKHSDGRHYSYKELSQTLIPYIKEHGFTHIELLPVYEHPYDRSWGYQGTGYYSPTSRFGPPHDLMKFVDECHQQNIGVILDWVPGHFCKDAHGLYMFDGEPLYEYKEERDRENWLWGTANFDLGKPEVHSFLISNALYWAEFYHIDGFRVDAVANILYWPNQDERHTNPYAVEFLKKLNQTMREAYPHVMMIAEDSTEWPQVTGAVEEGGLGFHYKWNMGWMNDVLKYMETPPEERRHCHQLISFSLLYAFSEHFVLPFSHDEVVYGKKSLLNKMPGDYWQKFAQYRLLLGYMTVHPGKKLIFMGSEFAQFDEWKDTEQLDWFLDSFPMHQKASVFTQDLLRFYQKSKILYEHDHRAQSFEWIDVHNDEQSIFSFIRYGKKHGEALVIICNFTPVVYHQYDVGVPFFTQYIEVLNSDSETYGGSGQINKKPLSAKKGALHHKPCYITMTIPPYGISILRAVKKRGEIKR
>CP035391.1|QAV85489.1|3037980_3039123_-|glucose-1-phosphate-adenylyltransferase
MKKQCVAMLLAGGKGSRLSGLTKNMAKPAVSFGGKYRIIDFTLSNCSNSGIDTVGILTQYQPLELNSYIGIGSAWDLDRYNGGVTVLPPYAESSEVKWYKGTASAIYENLNYLNQYDPEYVLILSGDHIYKMDYGKMLDYHIEKKADVTISVIEVGWEEASRFGIMKANPDGTITHFDEKPKFPKSNLASMGIYIFNWPLLKQYLEMDDQNPYSSHDFGKDIIPLLLEEKKKLSAYPFKGYWKDVGTVQSLWEANMDLLKEDSELKLFERKWKIYSVNPNQPPQFISSDAQVQDSLVNEGCVVYGNVSHSVLFQGVTVGKHTTVTSSVIMPDVTIGEHVVIENAIVPNGMVLPDGAVIRSEKDIEEVLLVSEEFVEKELI
>CP035391.1|QAV85488.1|3036925_3037957_-|glucose-1-phosphate-adenylyltransferase-subunit-GlgD
MFNNQMLGVIDETTYKHSLQDLTAQRSLGAIPFAGRYRLIDFMLSNMVNADIRSVAIFPKYRYRSLMDHLGAGKEWDLHRKKDGLFFFPSPHLHHEYDEFGSFRQFSDHLDYFHRSTQQYAVISNSHTVCNIQFQYVLKRHQEVGCDVTEVFQDGQSLQIYIMSTTLLKDLIYGHSEKGYKTIQEAVEKESSALTICPYEYSGYAAVIDSVEKYYTHSMELIQPRFWQQVFLPQQPIYTKVKDEPPTKYGKHSTVKNSLVANGCVLEGEVENCILFRAVHVGKGTKLKNCIIMQKTQIGEDCLLEQVISDKDVKIGKATEAAGTVDQPLVLRKGLVQGELMNS
>CP035391.1|QAV85487.1|3035474_3036929_-|glycogen-synthase-GlgA
MKILFAVSECAPFVKSGGLADVAGALPKALARLGNEVAVMLPKYSQIPEPWKKRMKKQAECTVAVGWRQQYCGIEHMAKDDVNYYFIDNEYYFNRDSLYGHYDDGERFAFFSRAVLEAAKVVNVQADIVHTHDWHTAMVNYLLKEEYRKHPFYERMKSVLTIHNLQFQGIFPPDVTHDLLGLEMDHFHYERLECNGFVNFMKAGIIAADHVTTVSPTYRNEIMTPYYGEQLEQVLQYREDDVTGILNGIDDTFYQPKSDPYIEAQYDSGDLACKLENKTKLQQRMGLPEKNDIPLISMVTRLTKQKGLDLVRRIMHELLEEQDIQLIVLGTGEREFEDYFRYAEFAFHEKCRAYIGFDEPLAHQIYAGSDMFLMPSKFEPCGLGQLIALQYGAIPIVRETGGLYDTVRAYQEEEGTGNGFTFSAFNAHDLKFTIERALSFYRQQDVWKSIVKTAMNADYSWGKSAKEYQRIFEQVTRSGRDVLE
>CP035391.1|QAV85486.1|3033091_3035488_-|glycogen/starch/alpha-glucan-phosphorylase
MFSSKERFADLFLKRLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQLLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDAGLGNGGLGRLAACFLDSLASLNLPGHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSGRLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAEPYAHYHGGNILSYKRETEAVSEFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPALAVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIEEINERFCRAVWEKYPGDWKRIEDMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKEREMRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATDPAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLYNRLKEDSGFSIYPQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLENYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPDCIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLLPHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIWGIKPMM
>CP035391.1|QAV85485.1|3032593_3033061_+|tryptophan-rich-sensory-protein
MKKIVGALAVFVITYALFSAAGYLFPVDQEWYNSLKKPDWTPSGTAIGIIWAILFALISLSAAIVYAAFSIKGAKSFWFTLLINYVLNQAFSYFQFTQKNLLAASLDCLLVAITAIVLLIIAKKYSRAASYLLLPYFLWSAFATFLSFTINSMNL
>CP035391.1|QAV85484.1|3031440_3032514_+|CotS-family-spore-coat-protein
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVVYDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPVFTKLGRWPNHYTKRCKQMETWKLMAEAENEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYIPWTEQLKKSPNLCHQDYGTGNTLLGDNEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDEETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALNQLI
>CP035391.1|QAV85483.1|3030117_3031251_-|glycosyltransferase-family-1-protein
MKIALIATEKLPVPSVRGGAIQIYLEAVAPLIAKKHEVTVFSIKDPNLADREKVDGVHYVHLDEDRYEEAVGAELKKSRFDLVHVCNRPSWVPKLKKQAPDAVFILSVHNEMFAYDKISQAEGEICIDSVAQIVTVSDYIGQTITSRFPSARSKTKTVYSGVDLKTYHPRWTNEGQRAREEMRSELGLHGKKIVLFVGRLSKVKGPHILLQALPDIIEEHPDVMMVFIGSKWFGDNELNNYVKHLHTLGAMQKDHVTFIQFVKPKDIPRLYTMSDVFVCSSQWQEPLARVHYEAMAAGLPIITSNRGGNPEVIEEGKNGYIIHDFENPKQYAERINDLLSSSEKRERLGKYSRREAESNFGWQRVAENLLSVYEKNR
>CP035391.1|QAV85482.1|3029047_3030103_-|CotS-family-spore-coat-protein
MYQKEHEEQIVSEILSYYPFHIDHVALKSNKSGRKIWEVETDHGPKLLKEAQMKPERMLFITQAHAHLQEKGLPIAPIHQTKNGGSCLGTDQVSYSLYDKVTGKEMIYYDAEQMKKVMSFAGHFHHASKGYVCTDESKKRSRLGKWHKLYRWKLQELEGNMQIAASYPDDVFSQTFLKHADKMLARGKEALQALDDSEYETWTKETLEHGGFCFQDFTLARLTEIEGEPFLKELHSITYDLPSRDLRILLNKVMVKLSVWDTDFMVTLLAAYDAVYPLTEKQYEVLWIDLAFPHLFCAIGHKYYLKQKKTWSDEKYNWALQNMISVEESKDSFLDKLPELYKKIKAYREAN
>CP035391.1|QAV85481.1|3028614_3029046_-|hypothetical-protein
MRSSRQKASISKLDLDQFVFTPPGPMGWQAHDSISAEKEEEEKHLDVGSIRELPHINAPKEYQEETKEKETDHKIVDDEEETKFETTLEPEEERDSKRSVPPYEEEDEDEEPELAEEAKVEIIILPSESKPAPWFSQTVKRKA
>CP035391.1|QAV85491.1|3048661_3049240_+|energy-coupled-thiamine-transporter-ThiT
MNQSKQLVRLIEIAIMTAAAVILDIVSGMFLSMPQGGSVSIMMIPIFLISFRWGVKAGLTTGLLTGLVQIAIGNLFAQHPVQLLLDYIVAFAAIGISGCFASSVRKAAVSKTKGKLIVSVVSAVFIGSLLRYAAHVISGAVFFGSFAPKGTPVWIYSLTYNATYMVPSFIICAIVLCLLFMTAPRLLKSDKA
>CP035391.1|QAV85492.1|3049281_3049803_-|GNAT-family-N-acetyltransferase
MVTVREAKLEDIKGIAKVHVDSWRTTYHETIPIDYLNSLNYKEFEDKWKSRSLKGVFVAQDEMGSVFGFASFGPIRSEQEGYDGELYAIYLLEERQRQGAGRALLAKGAEYLLQHGFSSMFVWVIEQNPSIIFYQAYSPERVAEDNFEIAGVRLKEVGLGWPDLSALKTLLNR
>CP035391.1|QAV85493.1|3049820_3051350_-|flotillin-family-protein
MTMPIIMIIGVVFFLLIALIAVFITKYRTAGPDEALIVTGSYLGNKNVHVDEGGNRIKIVRGGGTFVLPVFQQAEPLSLLSSKLDVSTPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRSILGSMTVEEIYKNREKFSQEVQRVASQDLAKMGLVIVSFTIKDVRDKNGYLESLGKPRIAQVKRDADIATAEADKETRIKRAEADKDAKKSELERATEIAEAEKINQLKMAEFRREQDTAKANADQAYDLETARARQQVTEQEMQVKIIERQKQIELEEKEILRRERQYDSEVKKKADADRYSVEQSAAAEKAKQLAEADAKKYSIEAMAKAEAEKVRIDGLAKAEAEKAKGETEAEVIRLKGLAEAEAKEKIAAAFEQYGQAAIFDMIVKMLPEYAKQAAAPLSNIDKITVVDTGGSGESSGANKVTSYATNLMSSLQESLKASSGIDVKEMLENFSGKGNVKQSINELTNEIKEAKTVQKSE
>CP035391.1|QAV85494.1|3051370_3051895_-|hypothetical-protein
MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFAGLPEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI
>CP035391.1|QAV85495.1|3052062_3052551_+|DinB-family-protein
MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA
>CP035391.1|QAV85496.1|3052556_3053135_-|MOSC-domain-containing-protein
MWKRMTAKVEGLYIADTKSFVTKQMDKLDFDYGGIPGDLHFGLTKKAGAREPMFSRGTEIFNRRQISIVSIEECNEIALKMGVPRILPEWLGANVAVSGMPDLTSLKEGSRIIFPSGAALLCEGENDPCIQPGEVIQSYYPDQPKLAPAFVRHALGIRGIVCIVERPGAVYTGDEIEVHSYQRKVKRKAERV
>CP035391.1|QAV86592.1|3053222_3054431_-|iron-containing-alcohol-dehydrogenase
MTLNMKVESMQKFHTFEIPTVIKHGIGAIKHTGEEVAALGVSKALLVTDPGIYKAGVADPVIESLKEAGIEVVLFNKVEPNPPVRLVNEGSELYKKENCNGLVAVGGGSSMDTAKAIGVEATHEGSVLDYEAADGKKPLENRIPPLTTIPTTAGTGSEVTQWAVITDEEREFKFNTGGPLIAAHLTIIDPELHVSMPPHVTAMTGIDALAHAIECYTMKFAQPITDAVALMAIEYAAHYIKRAFADGEDLEARYGMAQAAMLAGLSYGSESAGAAHAMSQTLGGIIPVAHGQCVAAMMGPVMEYNWKGYPEKFARIAKAFGIDTSKMTTEEAAKASVNWMYDLVEDLEVPTLEEQGVSPDMIERLSKEAMKDPQTFGNPRDLNEKAYNWIYKRCFNLTPKTV
>CP035391.1|QAV85497.1|3054447_3055920_-|betaine-aldehyde-dehydrogenase
MSQTLFIDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLERGKIVLKIAELIRRDLEELAELESLDTGKTLEESKADMDDIANVFQYYAGLADKDGGEIISSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIKVFKLMEEAGVPKGVANLVLGPGATVGDELAVNRDVDLISFTGGIETGKKIMRAASGNVKKIALELGGKNPNIVFKDADLEVAVDQALNAVFFHAGQVCSAGSRLLVEDAIHDQFLAELVKRAKRIKLGNGFHAETESGPLISAEHRAKVEKYVEIGIEEGAKLETGGKRPEDPALQNGFFYEPTIFSNCNSDMRIVQEEVFGPVLTVETFSSEEEVIELANDTIYGLAGAVWSKDIEKCERVAARLRMGTVWINDFHPYFAQAPWGGYKQSGFGRELGKIGLEEYTEVKHVYRNTKPAAVNWFNS
>CP035391.1|QAV85498.1|3056118_3056661_+|GbsR/MarR-family-transcriptional-regulator
MDENPEFAAIEQARDLVIDSIAETMDLYGITRSVGILYGTMYMRDEMTLDEMREELQMSKPSMSTGVKKLQDLNVVKKTFHRGIRKHTFVAEKDFFKFFTNFFPPKWEREVQVNVAAIEEAQADLQKVLCKEDLDEDIKNEALQLYDQLESSKAYYDWLKRLAESVQTGEIFKFIPIETK
>CP035391.1|QAV85499.1|3056858_3057404_+|hypothetical-protein
MKRKLLSSLAISALSLGLLVSAPTASFAAESTSTKAHTESTMRTQSTASLFATITGASKTEWSFSDIELTYRPNTLLSLGVMEFTLPSGFTANTKDTLNGNALRTTQILNNGKTVRVPLALDLLGAGEFKLKLNNKTLPAAGTYTFRAENKSLSIGNKFYAEASIDVAKRSTPPTQPCGCN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	10417-10476	7	0.883
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	70764-70823	7	0.883
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	1318-1377	7	0.883
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	838-897	7	0.883
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	75825-75884	7	0.883
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NC_020451	Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence	1960-2019	9	0.85
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_CP015440	Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence	64773-64832	12	0.8
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	483791-483850	13	0.783
CP035391_2	2.1\|3041636\|60\|CP035391\|CRISPRCasFinder	3041636-3041695	60	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	57361-57420	14	0.767

1. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

2. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

3. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

4. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

5. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.883

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatatttta-aagtggcggt	Protospacer
******************************************  *****   * ****.*

6. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NC_020451 (Vibrio coralliilyticus strain ATCC BAA-450 plasmid, complete sequence) position: , mismatch: 9, identity: 0.85

cagcttggaaggctgaggttttaccactaaactacacccgcaatttttatttggggcgat	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcattttagttatggcccggg	Protospacer
****************************************** ***   * ***  **.

7. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_CP015440 (Anoxybacillus amylolyticus strain DSM 15939 plasmid pDSM15939_2, complete sequence) position: , mismatch: 12, identity: 0.8

cagcttggaaggctgaggttttaccactaaactacacccgca-------atttttatttg	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcataataatatataccattg	Protospacer
******************************************       ** * .  ***

8. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 13, identity: 0.783

cagcttggaaggctgaggttttaccactaaactacacccgc--------aatttttattt	CRISPR spacer
cagcttggaaggctgaggttttaccactaaactacacccgcatggttaaaagttttgcca	Protospacer
*****************************************        ** ****...

9. spacer 2.1|3041636|60|CP035391|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 14, identity: 0.767

cagcttggaaggctgaggttttaccactaaactacacccgc---------aatttttatt	CRISPR spacer
cagcttggaaggctgtagttttaccactaaactacacccgcatagtaagtagttcttagt	Protospacer
*************** .************************         *.**.*** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

677905 : 686271

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV83177.1\|677905_679201_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	5.9e-19	25.7
QAV83178.1\|679274_680000_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3G7P8	Synechococcus_phage	4.1e-46	44.1
QAV83179.1\|679992_680247_+	phosphoribosylformylglycinamidine synthase, purS protein	NA	NA	NA	NA
QAV83180.1\|680243_680927_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
QAV83181.1\|680910_683139_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	6.5e-159	40.1
QAV83182.1\|683114_684545_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.2e-52	32.5
QAV83183.1\|684646_685687_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.8e-64	42.0
QAV83184.1\|685683_686271_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	9.1e-28	40.4

DBSCAN-SWA_2

1185690 : 1219802

Planktothrix_phage(20.0%)

tRNA,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV83662.1\|1185690_1186683_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
QAV83663.1\|1187426_1189064_+	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
QAV83664.1\|1189171_1190107_+	peptide ABC transporter permease	NA	NA	NA	NA
QAV83665.1\|1190110_1191028_+	peptide ABC transporter permease	NA	NA	NA	NA
QAV83666.1\|1191032_1192109_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.1e-17	30.8
QAV83667.1\|1192110_1193028_+	ATP-binding cassette domain-containing protein	M1HP82	Acanthocystis_turfacea_Chlorella_virus	1.2e-05	24.6
QAV86536.1\|1193135_1194353_+	MFS transporter	NA	NA	NA	NA
QAV83668.1\|1194516_1195095_+	N-acetyltransferase	NA	NA	NA	NA
QAV83669.1\|1195275_1195671_+	transcriptional regulator Spx	NA	NA	NA	NA
QAV83670.1\|1195925_1196582_-	TerC family protein	A0A2R2YAT9	Pseudomonas_phage	1.1e-29	38.0
QAV83671.1\|1196751_1196892_+	hypothetical protein	NA	NA	NA	NA
QAV83672.1\|1196858_1197515_+	adaptor protein MecA	NA	NA	NA	NA
QAV83673.1\|1197509_1197632_-	hypothetical protein	NA	NA	NA	NA
QAV83674.1\|1197675_1198827_+	competence protein CoiA	NA	NA	NA	NA
QAV83675.1\|1198873_1200886_+	oligoendopeptidase F	NA	NA	NA	NA
QAV83676.1\|1200923_1201091_-	hypothetical protein	NA	NA	NA	NA
QAV83677.1\|1201186_1201390_-	hypothetical protein	NA	NA	NA	NA
QAV83678.1\|1201404_1202304_-	DsbA family protein	NA	NA	NA	NA
QAV83679.1\|1202300_1202699_-	thiol management oxidoreductase	NA	NA	NA	NA
QAV86537.1\|1202950_1203496_-	lytic transglycosylase domain-containing protein	A0A1P8CWQ1	Bacillus_phage	4.8e-39	61.0
QAV83680.1\|1203699_1204272_-	CYTH domain-containing protein	NA	NA	NA	NA
QAV83681.1\|1204396_1204765_+	hypothetical protein	NA	NA	NA	NA
QAV83682.1\|1204793_1205429_+	GTP pyrophosphokinase YjbM	NA	NA	NA	NA
QAV83683.1\|1205447_1206248_+	NAD(+) kinase	NA	NA	NA	NA
QAV86538.1\|1206310_1207162_+	RluA family pseudouridine synthase	NA	NA	NA	NA
QAV83684.1\|1207174_1207909_-	bis(5'-nucleosyl)-tetraphosphatase PrpE	M4Q4T6	Vibrio_phage	5.5e-06	23.3
QAV83685.1\|1208140_1209985_+	sodium:proton antiporter	NA	NA	NA	NA
QAV83686.1\|1210233_1210944_+	thiaminase II	NA	NA	NA	NA
QAV83687.1\|1210918_1211536_+	thiazole tautomerase TenI	NA	NA	NA	NA
QAV83688.1\|1211519_1212629_+	glycine oxidase ThiO	NA	NA	NA	NA
QAV86539.1\|1212628_1212829_+	sulfur carrier protein ThiS	NA	NA	NA	NA
QAV83689.1\|1212825_1213596_+	thiazole synthase	NA	NA	NA	NA
QAV83690.1\|1213592_1214603_+	thiazole biosynthesis adenylyltransferase ThiF	NA	NA	NA	NA
QAV83691.1\|1214621_1215437_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAV83692.1\|1215572_1216349_+	enoyl-[acyl-carrier-protein] reductase FabI	NA	NA	NA	NA
QAV83693.1\|1216449_1217133_+\|coat	spore coat protein O	NA	NA	NA	NA
QAV83694.1\|1217225_1217672_-\|coat	spore coat protein Z	NA	NA	NA	NA
QAV83695.1\|1217799_1218288_-\|coat	spore coat protein Y	NA	NA	NA	NA
QAV83696.1\|1218439_1218958_-\|coat	spore coat protein X	NA	NA	NA	NA
QAV83697.1\|1219059_1219374_-\|coat	spore coat protein CotW	NA	NA	NA	NA
QAV83698.1\|1219415_1219802_-\|coat	spore coat protein V	NA	NA	NA	NA

DBSCAN-SWA_3

1247535 : 1319088

Bacillus_phage(29.73%)

portal,coat,terminase,tRNA,plate,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV83724.1\|1247535_1248015_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
QAV83725.1\|1248055_1248250_-	DUF4177 domain-containing protein	NA	NA	NA	NA
QAV83726.1\|1248415_1248745_-	DUF4306 domain-containing protein	NA	NA	NA	NA
QAV83727.1\|1249151_1249346_+	hypothetical protein	NA	NA	NA	NA
QAV86541.1\|1249364_1250354_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
QAV83728.1\|1250476_1250722_-\|coat	spore coat protein CotT	NA	NA	NA	NA
QAV83729.1\|1250975_1252379_+	DUF4163 domain-containing protein	NA	NA	NA	NA
QAV83730.1\|1252418_1252892_-	DUF2690 domain-containing protein	NA	NA	NA	NA
QAV83731.1\|1253020_1253188_-	putative motility protein	NA	NA	NA	NA
QAV83732.1\|1253313_1254213_+	hypothetical protein	NA	NA	NA	NA
QAV83733.1\|1254222_1254621_-	DUF2809 domain-containing protein	NA	NA	NA	NA
QAV83734.1\|1254721_1255297_-	DUF4309 domain-containing protein	NA	NA	NA	NA
QAV83735.1\|1255442_1258400_+	formate dehydrogenase subunit alpha	NA	NA	NA	NA
QAV83736.1\|1258392_1258953_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAV83737.1\|1259244_1259835_+	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	1.1e-07	34.3
QAV83738.1\|1259927_1260545_+	NUDIX domain-containing protein	NA	NA	NA	NA
QAV83739.1\|1260575_1260854_-	hypothetical protein	NA	NA	NA	NA
QAV83740.1\|1261244_1262435_+	cytochrome P450	NA	NA	NA	NA
QAV83741.1\|1262457_1263636_+	UDP-glucosyltransferase	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	1.1e-08	28.9
QAV83742.1\|1263676_1263865_-	hypothetical protein	A0A1P8CWV7	Bacillus_phage	1.5e-21	75.4
QAV83743.1\|1264038_1264854_+	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAV83744.1\|1264898_1265651_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
QAV83745.1\|1265650_1266403_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.1e-17	31.4
QAV83746.1\|1267169_1267667_+	cupin domain-containing protein	NA	NA	NA	NA
QAV83747.1\|1268055_1268478_+	DUF1641 domain-containing protein	NA	NA	NA	NA
QAV83748.1\|1268517_1269696_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
QAV83749.1\|1269894_1271316_+	glucuronate isomerase	NA	NA	NA	NA
QAV83750.1\|1271383_1272763_+	MFS transporter	NA	NA	NA	NA
QAV83751.1\|1272867_1273881_+	ureidoglycolate dehydrogenase	NA	NA	NA	NA
QAV83752.1\|1273886_1274906_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
QAV83753.1\|1274931_1276011_+	mannonate dehydratase	NA	NA	NA	NA
QAV83754.1\|1276007_1276844_+	SDR family NAD(P)-dependent oxidoreductase	M1NMS3	Moumouvirus	2.7e-09	30.4
QAV83755.1\|1276891_1278160_+	MFS transporter	NA	NA	NA	NA
QAV83756.1\|1278247_1279249_+	LacI family transcriptional regulator	NA	NA	NA	NA
QAV83757.1\|1279323_1280766_+	tagaturonate reductase	NA	NA	NA	NA
QAV83758.1\|1280762_1282256_+	altronate dehydratase	NA	NA	NA	NA
QAV83759.1\|1282294_1283059_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
QAV83760.1\|1283282_1283747_-	hypothetical protein	NA	NA	NA	NA
QAV83761.1\|1283895_1285167_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	A0A1V0SEI6	Indivirus	8.6e-15	37.1
QAV83762.1\|1285312_1286449_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	4.9e-94	47.4
QAV83763.1\|1286438_1286573_+	phosphatase RapA inhibitor PhrA	NA	NA	NA	NA
QAV83764.1\|1286602_1286860_-	hypothetical protein	NA	NA	NA	NA
QAV83765.1\|1286980_1287934_+	LysM peptidoglycan-binding domain-containing protein	A0A218KC88	Bacillus_phage	7.3e-67	74.1
QAV83766.1\|1287973_1288351_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	4.7e-17	42.3
QAV83767.1\|1288455_1289058_+	hypothetical protein	F8WQ53	Bacillus_phage	1.1e-44	49.2
QAV83768.1\|1289133_1289970_+	manganese catalase family protein	NA	NA	NA	NA
QAV83769.1\|1290013_1290610_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	8.1e-40	51.7
QAV83770.1\|1290772_1291114_-	XRE family transcriptional regulator	A0A2H4J6F9	uncultured_Caudovirales_phage	1.3e-18	45.8
QAV83771.1\|1291292_1291472_+	hypothetical protein	NA	NA	NA	NA
QAV83772.1\|1291458_1292295_+\|portal	phage portal protein	S6BFM4	Thermus_phage	1.3e-24	28.2
QAV83773.1\|1292194_1292995_+	ATP-binding protein	A6XMI1	Bacillus_virus	1.1e-60	51.7
QAV83774.1\|1292994_1293162_+	hypothetical protein	NA	NA	NA	NA
QAV83775.1\|1293246_1293597_+	phage-like element PBSX protein XkdD	NA	NA	NA	NA
QAV86542.1\|1293600_1293795_+	DUF3304 domain-containing protein	NA	NA	NA	NA
QAV83776.1\|1293915_1294425_+	sigma-70 family RNA polymerase sigma factor	A0A1L2JY33	Aeribacillus_phage	6.5e-22	39.2
QAV83777.1\|1294539_1295337_+\|terminase	PBSX phage terminase small subunit	A0A0S2MVB6	Bacillus_phage	3.6e-59	50.2
QAV83778.1\|1295333_1296635_+\|terminase	PBSX family phage terminase large subunit	A0A2P1JTW5	Anoxybacillus_phage	2.4e-153	60.2
QAV86543.1\|1296638_1298126_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	3.8e-139	55.3
QAV83779.1\|1298145_1298973_+\|portal	phage portal protein	A0A1B1P7E4	Bacillus_phage	2.1e-54	58.7
QAV83780.1\|1298998_1299934_+	phage-like element PBSX protein XkdG	A0A1B1P7E3	Bacillus_phage	1.1e-104	63.8
QAV83781.1\|1299955_1300339_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	3.7e-14	41.1
QAV83782.1\|1300335_1300692_+	DUF3599 family protein	NA	NA	NA	NA
QAV83783.1\|1300688_1301174_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.1e-38	47.0
QAV83784.1\|1301186_1301627_+	phage-like element PBSX protein XkdJ	NA	NA	NA	NA
QAV83785.1\|1301630_1301849_+	hypothetical protein	NA	NA	NA	NA
QAV83786.1\|1301845_1303246_+	phage-like element PBSX protein XkdK	A0A0A7S087	Clostridium_phage	1.4e-77	39.3
QAV83787.1\|1303247_1303691_+	phage-like element PBSX protein XkdM	A0A0K2CNG3	Brevibacillus_phage	1.1e-25	45.2
QAV83788.1\|1303775_1304222_+\|portal	phage portal protein	A0A0A7RTY8	Clostridium_phage	5.9e-11	37.7
QAV86544.1\|1304263_1304404_+	hypothetical protein	NA	NA	NA	NA
QAV83789.1\|1304404_1309489_+\|portal	phage portal protein	A0A1L2JY60	Aeribacillus_phage	7.4e-41	43.4
QAV83790.1\|1309481_1310141_+	LysM peptidoglycan-binding domain-containing protein	A0A0A8WJR4	Clostridium_phage	8.1e-25	33.2
QAV83791.1\|1310156_1311134_+\|portal	phage portal protein	H7BV96	unidentified_phage	1.0e-39	32.6
QAV83792.1\|1311133_1311400_+	DUF2577 domain-containing protein	S6C459	Thermus_phage	8.4e-05	35.2
QAV83793.1\|1311456_1311882_+	DUF2634 domain-containing protein	A0A2H4J6K5	uncultured_Caudovirales_phage	2.3e-12	38.7
QAV83794.1\|1311874_1312921_+\|plate	baseplate J/gp47 family protein	S6AVU3	Thermus_phage	4.1e-71	43.8
QAV83795.1\|1312904_1313483_+	DUF2313 domain-containing protein	A0A2H4J717	uncultured_Caudovirales_phage	8.7e-15	33.1
QAV83796.1\|1313479_1313752_+	hypothetical protein	NA	NA	NA	NA
QAV83797.1\|1313754_1316196_+	hypothetical protein	A0A2H4J4R1	uncultured_Caudovirales_phage	8.2e-22	35.2
QAV83798.1\|1316213_1316540_+\|portal	phage portal protein	NA	NA	NA	NA
QAV83799.1\|1316536_1316701_+	XkdX family protein	A0A2H4JAA1	uncultured_Caudovirales_phage	1.9e-15	67.9
QAV83800.1\|1316744_1317584_+\|portal	phage portal protein	NA	NA	NA	NA
QAV83801.1\|1317636_1317906_+	protein xhlA	A0A2H4JD40	uncultured_Caudovirales_phage	4.8e-24	64.8
QAV83802.1\|1317918_1318182_+\|holin	phage holin	A0A2H4J6M0	uncultured_Caudovirales_phage	1.4e-23	64.4
QAV83803.1\|1318194_1319088_+	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	8.9e-83	69.2

DBSCAN-SWA_4

1838212 : 1844771

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV84262.1\|1838212_1838605_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	G3MBF1	Bacillus_virus	3.2e-29	58.3
QAV84263.1\|1838564_1840667_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	U5PY35	Bacillus_phage	0.0e+00	86.8
QAV84264.1\|1840684_1841674_+	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.9e-155	83.5
QAV84265.1\|1841723_1842344_+	hypothetical protein	A0A127AYS1	Bacillus_phage	1.6e-46	48.4
QAV84266.1\|1842407_1843175_-	N-acetylmuramoyl-L-alanine amidase	E5DV68	Deep-sea_thermophilic_phage	2.0e-51	49.5
QAV86554.1\|1843802_1844771_+	stage V sporulation protein K	G3MAX6	Bacillus_virus	5.2e-52	40.5

DBSCAN-SWA_5

2266451 : 2272547

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV84684.1\|2266451_2267045_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	2.0e-14	35.4
QAV84685.1\|2267034_2267790_-	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.2e-09	26.2
QAV84686.1\|2268070_2268595_+	DUF309 domain-containing protein	NA	NA	NA	NA
QAV84687.1\|2268608_2268983_-	GNAT family N-acetyltransferase RibT	NA	NA	NA	NA
QAV84688.1\|2269095_2269560_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	5.5e-44	60.0
QAV84689.1\|2269592_2270789_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.3e-115	54.9
QAV84690.1\|2270803_2271451_-	riboflavin synthase subunit alpha	A0A2H4PQS5	Staphylococcus_phage	8.5e-43	45.9
QAV84691.1\|2271461_2272547_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.1e-56	36.1

DBSCAN-SWA_6

2654343 : 2726853

Bacillus_phage(45.83%)

protease,coat,portal,head,terminase,tRNA,capsid,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV85104.1\|2654343_2654682_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
QAV85105.1\|2654684_2654993_-	50S ribosomal protein L21	NA	NA	NA	NA
QAV85106.1\|2655139_2656006_-	stage IV sporulation protein FB	NA	NA	NA	NA
QAV85107.1\|2655998_2656793_-	stage IV sporulation protein FA	NA	NA	NA	NA
QAV85108.1\|2656941_2657748_-	septum site-determining protein MinD	NA	NA	NA	NA
QAV85109.1\|2657749_2658430_-	septum site-determining protein MinC	NA	NA	NA	NA
QAV85110.1\|2658482_2659001_-	rod shape-determining protein MreD	NA	NA	NA	NA
QAV85111.1\|2658997_2659870_-	rod shape-determining protein MreC	NA	NA	NA	NA
QAV85112.1\|2659900_2660914_-	rod shape-determining protein MreB	NA	NA	NA	NA
QAV85113.1\|2661005_2661701_-	JAB domain-containing protein	NA	NA	NA	NA
QAV85114.1\|2661737_2662307_-	septum formation protein Maf	NA	NA	NA	NA
QAV85115.1\|2662459_2663458_-	SPOR domain-containing protein	NA	NA	NA	NA
QAV85116.1\|2663591_2664338_-	prepilin peptidase	NA	NA	NA	NA
QAV85117.1\|2664478_2665771_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
QAV85118.1\|2665830_2668473_-\|tRNA	valine--tRNA ligase	A0A1V0S951	Catovirus	3.7e-161	42.6
QAV85119.1\|2668920_2669112_+	hypothetical protein	NA	NA	NA	NA
QAV85120.1\|2669130_2670156_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
QAV85121.1\|2670188_2671916_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
QAV85122.1\|2672046_2673339_-	glutamate-1-semialdehyde-2,1-aminomutase	NA	NA	NA	NA
QAV85123.1\|2673368_2674343_-	porphobilinogen synthase	NA	NA	NA	NA
QAV85124.1\|2674339_2675128_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
QAV85125.1\|2675117_2676062_-	hydroxymethylbilane synthase	NA	NA	NA	NA
QAV85126.1\|2676094_2676925_-	protein HemX	NA	NA	NA	NA
QAV85127.1\|2676932_2678300_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
QAV85128.1\|2678529_2679027_+	hypothetical protein	NA	NA	NA	NA
QAV85129.1\|2679048_2679636_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
QAV85130.1\|2679632_2681957_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.0e-182	43.7
QAV85131.1\|2682137_2683796_-\|protease	Lon protease 2	A0A1V0SHJ7	Hokovirus	8.1e-05	33.7
QAV85132.1\|2683947_2685210_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.3e-148	64.9
QAV85133.1\|2685481_2686756_-	trigger factor	NA	NA	NA	NA
QAV85134.1\|2686983_2687988_-	tetratricopeptide repeat protein	NA	NA	NA	NA
QAV85135.1\|2688106_2688706_-	3-isopropylmalate dehydratase small subunit	NA	NA	NA	NA
QAV85136.1\|2688718_2690137_-	3-isopropylmalate dehydratase large subunit	NA	NA	NA	NA
QAV85137.1\|2690186_2691284_-	3-isopropylmalate dehydrogenase	NA	NA	NA	NA
QAV85138.1\|2691304_2692861_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	6.0e-10	39.4
QAV85139.1\|2692847_2693876_-	ketol-acid reductoisomerase	NA	NA	NA	NA
QAV85140.1\|2693899_2694418_-	acetolactate synthase small subunit	NA	NA	NA	NA
QAV85141.1\|2694414_2696139_-	acetolactate synthase large subunit	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	2.4e-60	30.2
QAV85142.1\|2696953_2697289_+	hypothetical protein	NA	NA	NA	NA
QAV85143.1\|2697451_2697907_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAV85144.1\|2698030_2699332_-	DUF1668 domain-containing protein	NA	NA	NA	NA
QAV85145.1\|2699549_2700371_+	YsnF/AvaK domain-containing protein	NA	NA	NA	NA
QAV85146.1\|2700657_2701494_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAV85147.1\|2701624_2701831_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAV85148.1\|2701850_2702069_+	hypothetical protein	NA	NA	NA	NA
QAV85149.1\|2702085_2702718_-	hypothetical protein	Q0H249	Geobacillus_phage	2.7e-62	57.6
QAV86582.1\|2702704_2703859_-	DNA translocase FtsK	Q0H250	Geobacillus_phage	1.0e-83	45.2
QAV85150.1\|2703855_2704143_-	hypothetical protein	NA	NA	NA	NA
QAV85151.1\|2704423_2704648_+	transcriptional regulator	B3RH35	Bacillus_virus	8.3e-22	63.0
QAV85152.1\|2704693_2705029_+	YolD-like family protein	A0A2H4JAP8	uncultured_Caudovirales_phage	6.2e-13	35.8
QAV85153.1\|2705047_2705362_-	hypothetical protein	NA	NA	NA	NA
QAV85154.1\|2705494_2705752_-\|holin	holin	A0A0U4JE55	Bacillus_phage	3.3e-22	57.6
QAV85155.1\|2705770_2706715_-	LysM peptidoglycan-binding domain-containing protein	Q9ZXD7	Bacillus_phage	5.1e-89	61.7
QAV85156.1\|2706787_2707072_-\|holin	holin	NA	NA	NA	NA
QAV85157.1\|2707094_2707376_-	XkdX family protein	NA	NA	NA	NA
QAV85158.1\|2707395_2707764_-	hypothetical protein	NA	NA	NA	NA
QAV85159.1\|2707776_2709201_-	hypothetical protein	NA	NA	NA	NA
QAV85160.1\|2709218_2711684_-	hypothetical protein	M5AC19	Bacillus_phage	2.8e-78	44.5
QAV85161.1\|2711680_2712511_-\|tail	phage tail family protein	M4ZS20	Bacillus_phage	9.2e-58	44.6
QAV85162.1\|2712510_2718003_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	5.1e-112	47.0
QAV86583.1\|2718664_2719252_-\|tail	phage tail protein	NA	NA	NA	NA
QAV85163.1\|2719269_2719614_-	hypothetical protein	A0A0S2SY15	Bacillus_phage	1.0e-23	49.6
QAV86584.1\|2719610_2720012_-	hypothetical protein	NA	NA	NA	NA
QAV85164.1\|2720035_2720377_-\|head,tail	head-tail adaptor protein	A6M954	Geobacillus_virus	9.1e-20	46.7
QAV85165.1\|2720381_2720621_-\|head,tail	phage gp6-like head-tail connector protein	H0USW7	Bacillus_phage	2.4e-11	48.6
QAV85166.1\|2720623_2721112_-	hypothetical protein	NA	NA	NA	NA
QAV85167.1\|2721152_2722307_-\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	9.9e-127	62.0
QAV85168.1\|2722306_2723053_-\|protease	Clp protease ClpP	A0A0B5A796	Paenibacillus_phage	3.4e-59	51.1
QAV85169.1\|2723006_2724305_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	7.1e-89	43.6
QAV85170.1\|2724316_2726098_-\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	1.5e-246	67.1
QAV85171.1\|2726072_2726396_-\|terminase	P27 family phage terminase small subunit	A0A0K2CZN8	Paenibacillus_phage	2.2e-31	73.1
QAV85172.1\|2726517_2726853_-	HNH endonuclease	A0A1B1P8D2	Bacillus_phage	2.6e-27	57.3

DBSCAN-SWA_7

2730651 : 2754909

Bacillus_phage(63.16%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV85178.1\|2730651_2731680_-	glycosyltransferase	A0A1V0SAH6	Catovirus	2.0e-14	40.5
QAV85179.1\|2731777_2732002_-	XRE family transcriptional regulator	D0R7I7	Paenibacillus_phage	4.7e-09	74.4
QAV85180.1\|2732132_2732930_+	hypothetical protein	O64134	Bacillus_phage	8.0e-59	48.3
QAV85181.1\|2732929_2734693_+	right-handed parallel beta-helix repeat-containing protein	F8WPS8	Bacillus_phage	2.7e-139	44.2
QAV85182.1\|2735041_2735245_+	hypothetical protein	NA	NA	NA	NA
QAV85183.1\|2735350_2735788_+	hypothetical protein	A0A2H4J8A0	uncultured_Caudovirales_phage	1.7e-50	70.0
QAV85184.1\|2735949_2736138_+	hypothetical protein	NA	NA	NA	NA
QAV85185.1\|2736139_2736376_+	hypothetical protein	NA	NA	NA	NA
QAV85186.1\|2736586_2737033_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAV85187.1\|2737049_2737229_-	hypothetical protein	NA	NA	NA	NA
QAV85188.1\|2737267_2737765_-	hypothetical protein	A0A0N7GFF4	Paenibacillus_phage	2.7e-20	43.1
QAV85189.1\|2738475_2738874_+	hypothetical protein	NA	NA	NA	NA
QAV85190.1\|2738849_2739800_-	DNA cytosine methyltransferase	A0A1P8CX13	Bacillus_phage	3.6e-122	68.3
QAV85191.1\|2739796_2740363_-	dephospho-CoA kinase	J9Q953	Bacillus_phage	6.1e-37	45.4
QAV85192.1\|2740359_2741322_-	hypothetical protein	A0A1P8CWY7	Bacillus_phage	5.7e-35	51.3
QAV85193.1\|2741502_2742093_-	hypothetical protein	A0A142F1S8	Bacillus_phage	3.6e-24	55.9
QAV85194.1\|2742062_2742845_-	FAD-dependent thymidylate synthase	A0A142F1S2	Bacillus_phage	5.6e-81	63.1
QAV85195.1\|2743319_2743853_-	deoxyuridine 5'-triphosphate nucleotidohydrolase	D2XR49	Bacillus_phage	3.7e-44	54.8
QAV86586.1\|2744104_2745070_-	class 1b ribonucleoside-diphosphate reductase subunit beta	F8WQ21	Bacillus_phage	1.5e-144	78.3
QAV85196.1\|2745203_2745548_+	hypothetical protein	NA	NA	NA	NA
QAV85197.1\|2745552_2747646_-	class 1b ribonucleoside-diphosphate reductase subunit alpha	R4JDX9	Bacillus_phage	0.0e+00	79.9
QAV85198.1\|2747617_2747986_-	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	2.8e-27	51.7
QAV85199.1\|2747979_2748174_-	hypothetical protein	NA	NA	NA	NA
QAV85200.1\|2748179_2748365_-	hypothetical protein	NA	NA	NA	NA
QAV85201.1\|2748361_2748628_-	hypothetical protein	NA	NA	NA	NA
QAV85202.1\|2748633_2749191_-	hypothetical protein	NA	NA	NA	NA
QAV85203.1\|2749187_2749508_-	hypothetical protein	NA	NA	NA	NA
QAV85204.1\|2749507_2750566_-	hypothetical protein	A0A0N9SHN6	Paenibacillus_phage	6.6e-77	51.6
QAV86587.1\|2750566_2751274_-	3'-5' exonuclease	U5PXE0	Bacillus_virus	5.1e-33	42.2
QAV85205.1\|2751275_2753522_-	DNA polymerase I	A0A2H4J6W7	uncultured_Caudovirales_phage	3.4e-171	48.0
QAV85206.1\|2753874_2754909_-	hypothetical protein	A0A142F1R1	Bacillus_phage	2.8e-19	30.4

DBSCAN-SWA_8

2758089 : 2770535

uncultured_Caudovirales_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV85210.1\|2758089_2759313_-	hypothetical protein	A0A288WGM1	Bacillus_phage	4.5e-69	38.1
QAV85211.1\|2759442_2759709_+	XRE family transcriptional regulator	NA	NA	NA	NA
QAV85212.1\|2759705_2760719_-	DNA primase	A0A2H4J6E6	uncultured_Caudovirales_phage	1.8e-76	49.2
QAV85213.1\|2760829_2762224_-	DNA helicase	A0A2H4IZL9	uncultured_Caudovirales_phage	2.9e-128	52.2
QAV85214.1\|2762220_2762496_-	hypothetical protein	NA	NA	NA	NA
QAV85215.1\|2762600_2763113_-	hypothetical protein	NA	NA	NA	NA
QAV85216.1\|2763109_2763925_-	DNA replication protein	A0A0N7GFF0	Paenibacillus_phage	4.3e-68	49.8
QAV85217.1\|2764093_2764846_-	hypothetical protein	A0A1P8CX46	Bacillus_phage	6.1e-77	62.7
QAV85218.1\|2764874_2765243_-	hypothetical protein	A0A2H4J134	uncultured_Caudovirales_phage	2.5e-23	47.4
QAV85219.1\|2765229_2765586_-	hypothetical protein	NA	NA	NA	NA
QAV85220.1\|2765621_2765945_-	hypothetical protein	A0A0N9SHL8	Paenibacillus_phage	9.2e-06	31.6
QAV85221.1\|2766296_2766674_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
QAV85222.1\|2766677_2767382_-	hypothetical protein	A0A2H4IZR0	uncultured_Caudovirales_phage	1.2e-29	64.6
QAV85223.1\|2767388_2767841_-	hypothetical protein	NA	NA	NA	NA
QAV85224.1\|2767993_2768938_-	hypothetical protein	A0A218M4I3	Erwinia_phage	3.2e-14	28.7
QAV85225.1\|2769413_2769923_-	metallophosphoesterase	NA	NA	NA	NA
QAV85226.1\|2769938_2770535_-	XTP/dITP diphosphatase	A0A2H4UUV7	Bodo_saltans_virus	5.5e-12	33.5

DBSCAN-SWA_9

3717505 : 3741251

Staphylococcus_phage(66.67%)

tRNA,protease,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV86128.1\|3717505_3719176_-\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
QAV86129.1\|3719172_3719601_-	DUF1934 domain-containing protein	NA	NA	NA	NA
QAV86130.1\|3719913_3720045_+\|bacteriocin	subtilosin A family bacteriocin	NA	NA	NA	NA
QAV86131.1\|3720001_3720154_+\|bacteriocin	bacteriocin-like protein SboX	NA	NA	NA	NA
QAV86132.1\|3720178_3721525_+	subtilosin maturase AlbA	NA	NA	NA	NA
QAV86133.1\|3721537_3721699_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbB	NA	NA	NA	NA
QAV86134.1\|3721695_3722415_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-19	27.2
QAV86135.1\|3722407_3723718_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbD	NA	NA	NA	NA
QAV86615.1\|3723707_3724868_+	insulinase family protein	NA	NA	NA	NA
QAV86136.1\|3724872_3726153_+	insulinase family protein	NA	NA	NA	NA
QAV86137.1\|3726149_3726851_+\|bacteriocin	antilisterial bacteriocin subtilosin biosynthesis protein AlbG	NA	NA	NA	NA
QAV86138.1\|3726856_3728233_-	YncE family protein	NA	NA	NA	NA
QAV86139.1\|3728272_3729628_-	YncE family protein	NA	NA	NA	NA
QAV86140.1\|3729624_3729855_-	hypothetical protein	NA	NA	NA	NA
QAV86141.1\|3729857_3731003_+	tetratricopeptide repeat protein	A0A1P8CWN8	Bacillus_phage	5.0e-78	43.0
QAV86142.1\|3730986_3731106_+	phosphatase RapF inhibitor	NA	NA	NA	NA
QAV86143.1\|3731333_3731810_+	hypothetical protein	NA	NA	NA	NA
QAV86144.1\|3731967_3732756_+	hypothetical protein	NA	NA	NA	NA
QAV86145.1\|3732742_3733417_+	hypothetical protein	NA	NA	NA	NA
QAV86146.1\|3733416_3734229_+	hypothetical protein	NA	NA	NA	NA
QAV86147.1\|3734231_3734879_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	9.1e-29	40.9
QAV86148.1\|3734871_3735435_+	hypothetical protein	NA	NA	NA	NA
QAV86149.1\|3735726_3736599_-	agmatinase	NA	NA	NA	NA
QAV86150.1\|3736659_3737490_-	spermidine synthase	NA	NA	NA	NA
QAV86151.1\|3737691_3739767_+	penicillin-binding protein	NA	NA	NA	NA
QAV86152.1\|3740059_3740578_-	hypothetical protein	NA	NA	NA	NA
QAV86153.1\|3740591_3741251_-\|protease	site-2 protease family protein	NA	NA	NA	NA

DBSCAN-SWA_10

3770854 : 3819692

Enterobacteria_phage(25.0%)

holin,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
QAV86181.1\|3770854_3771310_-\|coat	spore coat protein	NA	NA	NA	NA
QAV86182.1\|3771302_3772154_-	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.7e-38	38.9
QAV86183.1\|3772167_3773115_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	9.8e-72	43.8
QAV86184.1\|3773114_3773855_-	glucose-1-phosphate thymidylyltransferase	I7I009	Enterobacteria_phage	4.5e-48	41.9
QAV86185.1\|3773879_3774899_-\|coat	spore coat protein	NA	NA	NA	NA
QAV86186.1\|3774901_3775624_-\|coat	spore coat protein	NA	NA	NA	NA
QAV86187.1\|3775616_3776738_-\|coat	spore coat protein	NA	NA	NA	NA
QAV86188.1\|3776737_3777607_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
QAV86189.1\|3777607_3778777_-	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A1D8KU11	Synechococcus_phage	5.0e-17	27.2
QAV86190.1\|3778797_3780222_-	CDP-glycerol glycerophosphotransferase family protein	NA	NA	NA	NA
QAV86191.1\|3780226_3780997_-	glycosyltransferase family 2 protein	A0A0F7L2F7	uncultured_marine_virus	5.8e-06	28.6
QAV86192.1\|3780962_3781169_-	hypothetical protein	NA	NA	NA	NA
QAV86193.1\|3781316_3781862_+\|coat	spore coat protein GerQ	NA	NA	NA	NA
QAV86194.1\|3781905_3782277_-	DUF423 domain-containing protein	NA	NA	NA	NA
QAV86195.1\|3782338_3783661_-	purine permease	NA	NA	NA	NA
QAV86196.1\|3783680_3783998_-	hypothetical protein	NA	NA	NA	NA
QAV86197.1\|3784165_3785536_+	aldehyde dehydrogenase	NA	NA	NA	NA
QAV86198.1\|3785560_3786238_-	uracil-DNA glycosylase	A0A172DS90	Canid_alphaherpesvirus	8.3e-49	46.1
QAV86199.1\|3786251_3787058_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
QAV86200.1\|3787249_3788065_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
QAV86201.1\|3788155_3788404_-	hypothetical protein	NA	NA	NA	NA
QAV86202.1\|3788497_3789937_-	sucrose-6-phosphate hydrolase	F8WPR5	Bacillus_phage	3.1e-21	27.3
QAV86203.1\|3789933_3791319_-	PTS system sucrose transporter subunit IIBC	NA	NA	NA	NA
QAV86204.1\|3791620_3792391_+	transporter	NA	NA	NA	NA
QAV86205.1\|3792430_3793261_-	transcription antiterminator	NA	NA	NA	NA
QAV86206.1\|3793300_3793603_-	hypothetical protein	NA	NA	NA	NA
QAV86207.1\|3794132_3796553_+	peptidase S8	A0A217EQY2	Bacillus_phage	1.2e-20	36.8
QAV86208.1\|3796590_3797592_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
QAV86209.1\|3797766_3798516_-	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
QAV86210.1\|3798622_3799804_-	FtsW/RodA/SpoVE family cell cycle protein	NA	NA	NA	NA
QAV86211.1\|3800300_3800564_+	spore morphogenesis/germination protein YwcE	NA	NA	NA	NA
QAV86212.1\|3800605_3800980_-	quinol oxidase subunit 4	NA	NA	NA	NA
QAV86213.1\|3800981_3801596_-	Quinol oxidase subunit 3	NA	NA	NA	NA
QAV86214.1\|3801609_3803559_-	cytochrome aa3 quinol oxidase subunit I	NA	NA	NA	NA
QAV86215.1\|3803586_3804552_-	cytochrome aa3 quinol oxidase subunit II	NA	NA	NA	NA
QAV86216.1\|3805067_3805313_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
QAV86217.1\|3805383_3806925_-	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
QAV86218.1\|3806928_3808101_-	galactokinase	NA	NA	NA	NA
QAV86219.1\|3808181_3808565_-	GtrA family protein	NA	NA	NA	NA
QAV86220.1\|3808582_3809254_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
QAV86221.1\|3809608_3809767_+	DNA-binding anti-repressor SinI	NA	NA	NA	NA
QAV86222.1\|3810209_3810518_+	DUF485 domain-containing protein	NA	NA	NA	NA
QAV86223.1\|3810514_3812056_+	cation acetate symporter	NA	NA	NA	NA
QAV86224.1\|3812086_3812689_-	DsbA family protein	NA	NA	NA	NA
QAV86225.1\|3812778_3814029_-	deferrochelatase/peroxidase EfeB	NA	NA	NA	NA
QAV86226.1\|3814047_3815205_-	Efem/EfeO family lipoprotein	NA	NA	NA	NA
QAV86227.1\|3815201_3816647_-	iron transporter	NA	NA	NA	NA
QAV86228.1\|3816803_3817472_-	thiamine phosphate synthase	NA	NA	NA	NA
QAV86229.1\|3817468_3818287_-	hydroxyethylthiazole kinase	NA	NA	NA	NA
QAV86230.1\|3818294_3819200_-	LysR family transcriptional regulator	NA	NA	NA	NA
QAV86231.1\|3819305_3819692_+\|holin	CidA/LrgA family holin-like protein	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP035392

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP035391

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection